F272467

General Info

Members Datasets Scaffolds Average Seq Length
178 108 356 162

Family's Representative Sequence

Representative Sequence 3300044684|Ga0466966_0091608|Ga0466966_0091608_214_705
Length 163
Sequence MEMTDPHSLPYRLGVGLVLFNREGLVWVGRRLDQKGEAWQMPQGGVDEGETPEQAALRELEEEIGTGKAEIVGETRGWLTYELPPELVGVAWKGRYRGQKQKWFALRFTGTDADIRIDTEHPEFAEWRWVAFDRLVELIVPFKRELYVRVCAEFAELARNMRP

Samples

Sample ID Description Type Environment
1 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
8 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
9 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
10 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
11 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
12 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
13 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
14 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
15 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
16 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
17 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
18 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
19 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
20 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
21 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
22 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
23 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
24 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
25 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
26 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
40 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
41 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
42 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
43 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
44 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
45 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
46 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
47 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
48 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
49 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
50 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
51 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
52 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
53 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
54 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
55 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
56 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
57 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
58 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
59 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
60 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
61 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
62 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
63 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
64 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
65 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
66 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
67 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
68 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
69 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
70 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
71 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
72 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
73 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
74 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
75 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
76 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
77 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
78 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
79 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
80 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
81 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
82 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
83 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
84 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
85 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
86 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
87 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
88 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
89 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
90 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
91 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
92 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
93 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
94 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
95 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
96 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
97 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
99 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
100 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
101 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
103 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
104 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
105 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
106 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
107 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
108 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.56
Nodule 0
Rhizoplane 0.56
Rhizosphere 89.89
Stem 0
Stem Tuber 0
Unclassified 8.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466966_0091608 3300044684 Bacteria 1887
2 Ga0070670_101062929 3300005331 Unclassified 737
3 Ga0070682_101230096 3300005337 Bacteria 633
4 Ga0068868_100227287 3300005338 Bacteria 1564
5 Ga0070714_100033428 3300005435 Bacteria 4298
6 Ga0070714_101082103 3300005435 Unclassified 781
7 Ga0070713_100176586 3300005436 Unclassified 1917
8 Ga0070713_100229865 3300005436 Bacteria 1685
9 Ga0070713_100305857 3300005436 Bacteria 1465
10 Ga0070713_100691861 3300005436 Bacteria 973
11 Ga0070711_100062809 3300005439 Bacteria 2590
12 Ga0070678_100043100 3300005456 Bacteria 3212
13 Ga0070679_100071863 3300005530 Bacteria 3452
14 Ga0070665_101418694 3300005548 Bacteria 703
15 Ga0070665_102036761 3300005548 Bacteria 579
16 Ga0068855_100355376 3300005563 Bacteria 1613
17 Ga0068856_100054823 3300005614 Bacteria 3933
18 Ga0068856_101262375 3300005614 Unclassified 754
19 Ga0068851_10549330 3300005834 Bacteria 698
20 Ga0070717_10082859 3300006028 Bacteria 2696
21 Ga0070717_10350889 3300006028 Unclassified 1319
22 Ga0070715_10453417 3300006163 Bacteria 724
23 Ga0070716_100619056 3300006173 Bacteria 817
24 Ga0070712_100233097 3300006175 Bacteria 1463
25 Ga0105239_10341964 3300010375 Bacteria 1689
26 Ga0157369_10219691 3300013105 Unclassified 1989
27 Ga0163162_10379543 3300013306 Bacteria 1547
28 Ga0163163_10021977 3300014325 Bacteria 6031
29 Ga0163163_10068083 3300014325 Bacteria 3542
30 Ga0213872_10000639 3300021361 Bacteria 26467
31 Ga0213872_10017759 3300021361 Bacteria 3285
32 Ga0213872_10089798 3300021361 Bacteria 1375
33 Ga0213872_10305773 3300021361 Bacteria 659
34 Ga0213874_10203841 3300021377 Bacteria 713
35 Ga0213874_10239617 3300021377 Bacteria 665
36 Ga0213876_10230271 3300021384 Bacteria 985
37 Ga0213875_10002647 3300021388 Bacteria 10595
38 Ga0213875_10054896 3300021388 Bacteria 1865
39 Ga0207699_10180294 3300025906 Bacteria 1419
40 Ga0207693_10020489 3300025915 Bacteria 5259
41 Ga0207663_10390441 3300025916 Bacteria 1062
42 Ga0207660_10606618 3300025917 Bacteria 892
43 Ga0207652_10010596 3300025921 Bacteria 7420
44 Ga0207694_10836615 3300025924 Unclassified 778
45 Ga0207700_10055649 3300025928 Bacteria 2974
46 Ga0207700_10160154 3300025928 Unclassified 1868
47 Ga0207700_10767859 3300025928 Bacteria 862
48 Ga0207665_10222375 3300025939 Bacteria 1384
49 Ga0207667_10870476 3300025949 Bacteria 894
50 Ga0207640_11676406 3300025981 Bacteria 574
51 Ga0207658_10462972 3300025986 Bacteria 1124
52 Ga0207677_10199360 3300026023 Bacteria 1590
53 Ga0207683_10744022 3300026121 Bacteria 909
54 Ga0265338_10397863 3300028800 Bacteria 982
55 Ga0265320_10149064 3300031240 Bacteria 1057
56 Ga0373934_0258349 3300035086 Bacteria 720
57 Ga0373923_0072785 3300035111 Bacteria 1478
58 Ga0373936_0311946 3300035113 Bacteria 711
59 Ga0373953_0004196 3300035117 Bacteria 4574
60 Ga0373953_0039469 3300035117 Bacteria 1871
61 Ga0373954_0075487 3300035118 Bacteria 1605
62 Ga0373956_0084127 3300035119 Bacteria 1462
63 Ga0373957_0020251 3300035120 Bacteria 2349
64 Ga0373943_0050745 3300035170 Bacteria 2040
65 Ga0373955_0520087 3300035172 Bacteria 727
66 Ga0373924_0027302 3300035410 Bacteria 2269
67 Ga0373924_0270429 3300035410 Bacteria 753
68 Ga0373935_0684801 3300035692 Bacteria 753
69 Ga0373935_1223770 3300035692 Bacteria 560
70 Ga0373927_0264177 3300035695 Bacteria 1132
71 Ga0373933_0007633 3300035724 Bacteria 5904
72 Ga0373933_0248164 3300035724 Bacteria 1146
73 Ga0373933_0435017 3300035724 Bacteria 857
74 Ga0373947_0046759 3300035725 Bacteria 2592
75 Ga0373947_0416671 3300035725 Bacteria 907
76 Ga0373937_0003787 3300036401 Bacteria 12789
77 Ga0373937_0008271 3300036401 Bacteria 9033
78 Ga0373937_0016427 3300036401 Bacteria 6574
79 Ga0373937_0107882 3300036401 Bacteria 2589
80 Ga0373937_0207733 3300036401 Bacteria 1842
81 Ga0373937_0263969 3300036401 Unclassified 1624
82 Ga0373925_0034343 3300037068 Bacteria 3737
83 Ga0373925_0168891 3300037068 Bacteria 1726
84 Ga0373925_0298864 3300037068 Bacteria 1299
85 Ga0436364_0311475 3300037853 Bacteria 50260
86 Ga0436364_0588488 3300037853 Bacteria 48316
87 Ga0436364_1196747 3300037853 Bacteria 1042
88 Ga0436365_0937554 3300039437 Bacteria 1038
89 Ga0436365_1303586 3300039437 Bacteria 1366
90 Ga0436365_1823896 3300039437 Unclassified 1311
91 Ga0436360_0543816 3300039438 Bacteria 551
92 Ga0436360_0727595 3300039438 Unclassified 1200
93 Ga0436360_0818854 3300039438 Bacteria 917
94 Ga0436361_0019682 3300039447 Bacteria 41674
95 Ga0436361_0021782 3300039447 Bacteria 5000
96 Ga0436361_0148623 3300039447 Bacteria 2157
97 Ga0436361_0333091 3300039447 Bacteria 2456
98 Ga0436361_0660699 3300039447 Bacteria 1995
99 Ga0436361_0827433 3300039447 Unclassified 766
100 Ga0436361_0838208 3300039447 Bacteria 3134
101 Ga0436361_1098488 3300039447 Bacteria 599
102 Ga0436361_1115311 3300039447 Bacteria 1259
103 Ga0436363_0248329 3300039450 Bacteria 1083
104 Ga0436363_0401465 3300039450 Bacteria 620
105 Ga0436363_0556164 3300039450 Bacteria 705
106 Ga0436363_0864127 3300039450 Bacteria 982
107 Ga0436363_1604710 3300039450 Bacteria 825
108 Ga0436362_0720027 3300039453 Bacteria 2508
109 Ga0436362_0809606 3300039453 Unclassified 704
110 Ga0436362_1156848 3300039453 Bacteria 1552
111 Ga0466963_0205937 3300044694 Bacteria 1376
112 Ga0466971_0242492 3300044719 Bacteria 857
113 Ga0466957_0011126 3300044842 Bacteria 5182
114 Ga0466957_0820849 3300044842 Bacteria 661
115 Ga0466959_0037856 3300045049 Bacteria 3565
116 Ga0466967_0319976 3300045976 Bacteria 1496
117 Ga0466967_2197350 3300045976 Unclassified 548
118 Ga0495592_0025322 3300046454 Bacteria 4504
119 Ga0495592_0194489 3300046454 Bacteria 1373
120 Ga0495629_0075549 3300046459 Bacteria 2353
121 Ga0495629_0258262 3300046459 Bacteria 1198
122 Ga0495651_0006634 3300046462 Bacteria 8843
123 Ga0495653_0186706 3300046463 Bacteria 1418
124 Ga0495664_0011460 3300046477 Bacteria 5000
125 Ga0495664_0276998 3300046477 Bacteria 1014
126 Ga0495594_0285631 3300046499 Bacteria 940
127 Ga0495608_0007547 3300046511 Bacteria 7676
128 Ga0495608_0009596 3300046511 Bacteria 6755
129 Ga0495608_0372835 3300046511 Bacteria 876
130 Ga0495618_0226532 3300046514 Bacteria 1178
131 Ga0495618_0481506 3300046514 Bacteria 750
132 Ga0495628_0117595 3300046516 Bacteria 2041
133 Ga0495628_0142097 3300046516 Bacteria 1832
134 Ga0495640_0072491 3300046533 Bacteria 2308
135 Ga0495640_0188032 3300046533 Unclassified 1314
136 Ga0495640_0222118 3300046533 Bacteria 1191
137 Ga0495640_0464839 3300046533 Bacteria 772
138 Ga0495587_0027644 3300046536 Bacteria 3454
139 Ga0495587_0036750 3300046536 Bacteria 2945
140 Ga0495645_0000855 3300046543 Bacteria 20750
141 Ga0495667_0002047 3300046559 Bacteria 13376
142 Ga0495667_0063868 3300046559 Bacteria 2409
143 Ga0495667_0407130 3300046559 Bacteria 857
144 Ga0495635_0070545 3300046663 Bacteria 2395
145 Ga0495657_0181176 3300046675 Bacteria 1293
146 Ga0495599_0162752 3300046678 Bacteria 1379
147 Ga0495623_0074068 3300046679 Bacteria 2116
148 Ga0495623_0103340 3300046679 Bacteria 1734
149 Ga0495646_0222207 3300046680 Bacteria 1021
150 Ga0495647_0500105 3300046681 Bacteria 566
151 Ga0495658_0084826 3300046683 Bacteria 1866
152 Ga0495613_0196517 3300046689 Bacteria 1424
153 Ga0495600_0145063 3300046809 Bacteria 1539
154 Ga0495604_0016148 3300047317 Bacteria 5965
155 Ga0495674_0076221 3300047319 Bacteria 2885
156 Ga0495674_0148880 3300047319 Bacteria 1964
157 Ga0495674_0424969 3300047319 Bacteria 1070
158 Ga0495680_0064463 3300047322 Bacteria 2810
159 Ga0495680_0089873 3300047322 Bacteria 2305
160 Ga0495675_0003496 3300047444 Bacteria 9466
161 Ga0495675_0037058 3300047444 Bacteria 3107
162 Ga0495684_0084588 3300047471 Bacteria 2406
163 Ga0495602_0001864 3300048088 Bacteria 21078
164 Ga0496107_1040504 3300048910 Bacteria 593
165 Ga0501037_0113738 3300049573 Bacteria 1948
166 Ga0501038_0628068 3300049574 Bacteria 811
167 Ga0501047_0577095 3300049581 Bacteria 948
168 Ga0501073_0131496 3300049589 Bacteria 1735
169 Ga0501035_0107992 3300049822 Bacteria 2440
170 Ga0501044_1479498 3300049823 Bacteria 544
171 nmdc:mga0sz30_183780_c1 3300050516 Bacteria 928
172 Ga0495601_0037279 3300053077 Bacteria 3039
173 Ga0495612_0001369 3300053078 Bacteria 10044
174 Ga0495595_0012047 3300053084 Bacteria 3626
175 Ga0495619_0023831 3300053085 Bacteria 3923
176 Ga0495619_0060952 3300053085 Bacteria 2509
177 Ga0495619_0268406 3300053085 Bacteria 1183
178 Ga0466962_0129825 3300061719 Bacteria 1217
179 Ga0466966_0091608
180 Ga0070670_101062929
181 Ga0070682_101230096
182 Ga0068868_100227287
183 Ga0070714_100033428
184 Ga0070714_101082103
185 Ga0070713_100176586
186 Ga0070713_100229865
187 Ga0070713_100305857
188 Ga0070713_100691861
189 Ga0070711_100062809
190 Ga0070678_100043100
191 Ga0070679_100071863
192 Ga0070665_101418694
193 Ga0070665_102036761
194 Ga0068855_100355376
195 Ga0068856_100054823
196 Ga0068856_101262375
197 Ga0068851_10549330
198 Ga0070717_10082859
199 Ga0070717_10350889
200 Ga0070715_10453417
201 Ga0070716_100619056
202 Ga0070712_100233097
203 Ga0105239_10341964
204 Ga0157369_10219691
205 Ga0163162_10379543
206 Ga0163163_10021977
207 Ga0163163_10068083
208 Ga0213872_10000639
209 Ga0213872_10017759
210 Ga0213872_10089798
211 Ga0213872_10305773
212 Ga0213874_10203841
213 Ga0213874_10239617
214 Ga0213876_10230271
215 Ga0213875_10002647
216 Ga0213875_10054896
217 Ga0207699_10180294
218 Ga0207693_10020489
219 Ga0207663_10390441
220 Ga0207660_10606618
221 Ga0207652_10010596
222 Ga0207694_10836615
223 Ga0207700_10055649
224 Ga0207700_10160154
225 Ga0207700_10767859
226 Ga0207665_10222375
227 Ga0207667_10870476
228 Ga0207640_11676406
229 Ga0207658_10462972
230 Ga0207677_10199360
231 Ga0207683_10744022
232 Ga0265338_10397863
233 Ga0265320_10149064
234 Ga0373934_0258349
235 Ga0373923_0072785
236 Ga0373936_0311946
237 Ga0373953_0004196
238 Ga0373953_0039469
239 Ga0373954_0075487
240 Ga0373956_0084127
241 Ga0373957_0020251
242 Ga0373943_0050745
243 Ga0373955_0520087
244 Ga0373924_0027302
245 Ga0373924_0270429
246 Ga0373935_0684801
247 Ga0373935_1223770
248 Ga0373927_0264177
249 Ga0373933_0007633
250 Ga0373933_0248164
251 Ga0373933_0435017
252 Ga0373947_0046759
253 Ga0373947_0416671
254 Ga0373937_0003787
255 Ga0373937_0008271
256 Ga0373937_0016427
257 Ga0373937_0107882
258 Ga0373937_0207733
259 Ga0373937_0263969
260 Ga0373925_0034343
261 Ga0373925_0168891
262 Ga0373925_0298864
263 Ga0436364_0311475
264 Ga0436364_0588488
265 Ga0436364_1196747
266 Ga0436365_0937554
267 Ga0436365_1303586
268 Ga0436365_1823896
269 Ga0436360_0543816
270 Ga0436360_0727595
271 Ga0436360_0818854
272 Ga0436361_0019682
273 Ga0436361_0021782
274 Ga0436361_0148623
275 Ga0436361_0333091
276 Ga0436361_0660699
277 Ga0436361_0827433
278 Ga0436361_0838208
279 Ga0436361_1098488
280 Ga0436361_1115311
281 Ga0436363_0248329
282 Ga0436363_0401465
283 Ga0436363_0556164
284 Ga0436363_0864127
285 Ga0436363_1604710
286 Ga0436362_0720027
287 Ga0436362_0809606
288 Ga0436362_1156848
289 Ga0466963_0205937
290 Ga0466971_0242492
291 Ga0466957_0011126
292 Ga0466957_0820849
293 Ga0466959_0037856
294 Ga0466967_0319976
295 Ga0466967_2197350
296 Ga0495592_0025322
297 Ga0495592_0194489
298 Ga0495629_0075549
299 Ga0495629_0258262
300 Ga0495651_0006634
301 Ga0495653_0186706
302 Ga0495664_0011460
303 Ga0495664_0276998
304 Ga0495594_0285631
305 Ga0495608_0007547
306 Ga0495608_0009596
307 Ga0495608_0372835
308 Ga0495618_0226532
309 Ga0495618_0481506
310 Ga0495628_0117595
311 Ga0495628_0142097
312 Ga0495640_0072491
313 Ga0495640_0188032
314 Ga0495640_0222118
315 Ga0495640_0464839
316 Ga0495587_0027644
317 Ga0495587_0036750
318 Ga0495645_0000855
319 Ga0495667_0002047
320 Ga0495667_0063868
321 Ga0495667_0407130
322 Ga0495635_0070545
323 Ga0495657_0181176
324 Ga0495599_0162752
325 Ga0495623_0074068
326 Ga0495623_0103340
327 Ga0495646_0222207
328 Ga0495647_0500105
329 Ga0495658_0084826
330 Ga0495613_0196517
331 Ga0495600_0145063
332 Ga0495604_0016148
333 Ga0495674_0076221
334 Ga0495674_0148880
335 Ga0495674_0424969
336 Ga0495680_0064463
337 Ga0495680_0089873
338 Ga0495675_0003496
339 Ga0495675_0037058
340 Ga0495684_0084588
341 Ga0495602_0001864
342 Ga0496107_1040504
343 Ga0501037_0113738
344 Ga0501038_0628068
345 Ga0501047_0577095
346 Ga0501073_0131496
347 Ga0501035_0107992
348 Ga0501044_1479498
349 nmdc:mga0sz30_183780_c1
350 Ga0495601_0037279
351 Ga0495612_0001369
352 Ga0495595_0012047
353 Ga0495619_0023831
354 Ga0495619_0060952
355 Ga0495619_0268406
356 Ga0466962_0129825

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00293

NUDIX

NUDIX domain

10

150

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
7sp3-assembly1.cif.gz_A e. coli rpph bound to ap4a 0.9372 6 159
6vcp-assembly1.cif.gz_A crystal structure of e.coli rpph in complex with utp 0.9179 1 159
6d1v-assembly1.cif.gz_B crystal structure of e. coli rpph-dapf complex, monomer bound to rna 0.9157 2 159
4s2x-assembly1.cif.gz_A structure of e. coli rpph bound to rna and two magnesium ions 0.9154 1 159
4s2y-assembly1.cif.gz_A structure of e. coli rpph bound to rna and three magnesium ions 0.914 1 159
ID Description Score Start End Superfamily
4s2yA00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.914 1 159 3.90.79.10
af_A0A0R0I796_20_164_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8805 20 158 3.90.79.10
4s2yA00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8744 1 159 3.90.79.10
af_C6SXU5_1_159_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8728 1 158 3.90.79.10
af_Q54FR0_1_169_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8661 1 158 3.90.79.10
ID Description Score Start End GO Terms
AF-A0A419WM21-F1-model_v4 deleted 0.9754 3 159
AF-A0A285RRW1-F1-model_v4 RNA pyrophosphohydrolase (EC 3.6.1.-) ((Di)nucleoside polyphosphate hydrolase) 0.9719 3 159 GO:0006753
GO:0008893
GO:0019693
GO:0034432
AF-A0A3M1K2Y2-F1-model_v4 RNA pyrophosphohydrolase (EC 3.6.1.-) ((Di)nucleoside polyphosphate hydrolase) 0.969 3 160 GO:0006753
GO:0008893
GO:0019693
GO:0034432
AF-A0A3M1Q8F0-F1-model_v4 RNA pyrophosphohydrolase (EC 3.6.1.-) ((Di)nucleoside polyphosphate hydrolase) 0.9685 3 159 GO:0006753
GO:0008893
GO:0019693
GO:0034432
AF-A0A7H1N3F1-F1-model_v4 RNA pyrophosphohydrolase (EC 3.6.1.-) ((Di)nucleoside polyphosphate hydrolase) 0.9671 3 159 GO:0005737
GO:0006402
GO:0034353

Map