F272016

General Info

Members Datasets Scaffolds Average Seq Length
178 136 164 302

Family's Representative Sequence

Representative Sequence 3300013105|Ga0157369_10068112|Ga0157369_100681121
Length 305
Sequence MSRPVSEIFDPGVWDAVAGFDSFTDITYHRTSDGRVVRVAFNRPEVRNAFRPHTVDELYRALEHARTDARVGVVLLTGNGPSPKDGGWAFCSGGDQRIRGRDGYKYSDVETSVVEGKTHGSVGRLHILEVQRLIRFMPKVVIAVVPGWAAGGGHSLHVVCDLTIASAEHARFKQTDADVGSFDGGYGSAYFARQVGQKLAREVFFLAQEYSARRAYEMGAVNAVVPHDELEPTALDWARTILTKSPTAIRMLKFAFNAVDDGMVGQQVFAGEATRLAYGTDEAVEGRDAFLEKREPDWSAFPWQY

Samples

Sample ID Description Type Environment
1 2582580736 Prauserella sp. Am3 Isolate Unclassified
2 2643221616 Leifsonia sp. Root227 Isolate Unclassified
3 2738541305 Nocardioides sp. CF167 Isolate Unclassified
4 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
5 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
6 2852677369 Pseudoclavibacter sp. JAI123 Isolate Rhizosphere
7 2857710386 Brevibacterium sp. R-73093 Isolate Unclassified
8 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
9 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
10 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
11 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
12 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
13 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
14 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
15 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
16 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
32 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
33 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
34 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
35 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
39 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
46 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
47 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
49 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
62 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
63 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
64 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
65 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
66 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
67 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
68 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
69 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
70 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
71 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
72 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
73 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
74 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
75 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
76 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
77 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
78 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
79 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
80 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
81 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
82 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
83 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
84 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
85 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
86 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
87 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
88 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
89 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
90 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
91 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
92 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
93 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
94 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
95 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
96 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
97 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
98 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
99 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
100 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
101 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
102 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
103 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
104 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
105 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
116 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
117 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
118 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
119 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
120 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
121 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
122 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
124 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
125 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
126 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
127 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
128 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
129 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
130 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
131 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
132 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
133 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
134 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
135 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
136 8002811521 Leucobacter chinensis NC76-1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.57
Metatranscriptomes 0.56
Isolates 7.87

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.42
Nodule 0
Rhizoplane 6.18
Rhizosphere 70.22
Stem 0
Stem Tuber 0.56
Unclassified 5.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1000092 3300003214 Bacteria 165407
2 Ga0055542_1000055 3300003762 Bacteria 171477
3 Ga0055529_1000066 3300003763 Bacteria 170902
4 Ga0070680_100000282 3300005336 Bacteria 33825
5 Ga0070682_100225011 3300005337 Bacteria 1338
6 Ga0070660_100111662 3300005339 Bacteria 2175
7 Ga0070703_10011293 3300005406 Bacteria 2521
8 Ga0070714_100054574 3300005435 Bacteria 3413
9 Ga0070705_100011886 3300005440 Bacteria 4407
10 Ga0070708_100462401 3300005445 Bacteria 1197
11 Ga0070681_10000327 3300005458 Bacteria 38821
12 Ga0070681_10017281 3300005458 Bacteria 7209
13 Ga0070681_10036615 3300005458 Bacteria 4926
14 Ga0070681_10042501 3300005458 Bacteria 4554
15 Ga0070707_100000797 3300005468 Bacteria 31116
16 Ga0070707_100346558 3300005468 Bacteria 1443
17 Ga0070679_100000542 3300005530 Bacteria 32069
18 Ga0070679_100027226 3300005530 Bacteria 5624
19 Ga0070679_100060774 3300005530 Bacteria 3766
20 Ga0070679_100113635 3300005530 Bacteria 2693
21 Ga0070679_100281773 3300005530 Bacteria 1615
22 Ga0070695_100009722 3300005545 Bacteria 5728
23 Ga0068860_100000255 3300005843 Bacteria 78861
24 Ga0070717_10113945 3300006028 Bacteria 2309
25 Ga0075365_10014136 3300006038 Bacteria 4795
26 Ga0075365_10036727 3300006038 Bacteria 3176
27 Ga0075365_10071013 3300006038 Bacteria 2343
28 Ga0075368_10090396 3300006042 Bacteria 1252
29 Ga0075363_100013351 3300006048 Bacteria 3978
30 Ga0075367_10033920 3300006178 Bacteria 2945
31 Ga0075369_10021908 3300006186 Bacteria 2631
32 Ga0105244_10014722 3300009036 Bacteria 4515
33 Ga0105248_10374156 3300009177 Bacteria 1604
34 Ga0105249_10216460 3300009553 Bacteria 1883
35 Ga0157369_10002366 3300013105 Bacteria 22674
36 Ga0157369_10010668 3300013105 Bacteria 10457
37 Ga0157369_10068112 3300013105 Bacteria 3824
38 Ga0157369_10158393 3300013105 Bacteria 2391
39 Ga0157374_10219882 3300013296 Bacteria 1864
40 Ga0157372_10569925 3300013307 Bacteria 1320
41 Ga0157375_10374362 3300013308 Bacteria 1591
42 Ga0206354_11586557 3300020081 Bacteria 1481
43 Ga0209672_100011 3300025228 Bacteria 856297
44 Ga0209147_100238 3300025229 Bacteria 54120
45 Ga0207427_100182 3300025231 Bacteria 64661
46 Ga0209437_107487 3300025233 Bacteria 1774
47 Ga0209148_1000132 3300025254 Bacteria 171529
48 Ga0209233_1000014 3300025261 Bacteria 996641
49 Ga0209455_1000122 3300025272 Bacteria 170954
50 Ga0207705_10063450 3300025909 Bacteria 2669
51 Ga0207684_10004995 3300025910 Bacteria 12358
52 Ga0207707_10002634 3300025912 Bacteria 16047
53 Ga0207707_10062077 3300025912 Bacteria 3252
54 Ga0207707_10218170 3300025912 Bacteria 1660
55 Ga0207660_10000511 3300025917 Bacteria 25901
56 Ga0207660_10113877 3300025917 Bacteria 2039
57 Ga0207657_10096955 3300025919 Bacteria 2452
58 Ga0207652_10000528 3300025921 Bacteria 38836
59 Ga0207652_10019272 3300025921 Bacteria 5609
60 Ga0207652_10155872 3300025921 Bacteria 2046
61 Ga0207646_10000388 3300025922 Bacteria 59041
62 Ga0207664_10114892 3300025929 Bacteria 2244
63 Ga0207661_10252106 3300025944 Bacteria 1569
64 Ga0207712_10145631 3300025961 Bacteria 1823
65 Ga0268264_10003157 3300028381 Bacteria 14279
66 Ga0307515_10038786 3300028794 Bacteria 7604
67 Ga0316576_10024488 3300031727 Bacteria 4214
68 Ga0307410_10294120 3300031852 Bacteria 1279
69 Ga0307412_10160216 3300031911 Bacteria 1671
70 Ga0316580_10026812 3300032139 Bacteria 1782
71 Ga0316574_0324927 3300035398 Bacteria 976
72 Ga0395899_0010314 3300037312 Bacteria 7164
73 Ga0395900_0014167 3300037418 Bacteria 8142
74 Ga0395898_0000158 3300037466 Bacteria 172981
75 Ga0436364_1280294 3300037853 Bacteria 3188
76 Ga0436365_1335857 3300039437 Bacteria 3856
77 Ga0439448_0010506 3300042005 Bacteria 2748
78 Ga0439449_0016680 3300042007 Bacteria 2759
79 Ga0439434_0032903 3300042435 Bacteria 1579
80 Ga0439460_0020216 3300042461 Bacteria 1809
81 Ga0439440_0000882 3300042993 Bacteria 5237
82 Ga0466969_0049443 3300044656 Bacteria 2075
83 Ga0466969_0089355 3300044656 Bacteria 1461
84 Ga0466972_0095237 3300044658 Bacteria 1410
85 Ga0466966_0187947 3300044684 Bacteria 1252
86 Ga0466961_0001004 3300044693 Bacteria 17412
87 Ga0466961_0037830 3300044693 Bacteria 3095
88 Ga0466961_0142394 3300044693 Bacteria 1501
89 Ga0466971_0029323 3300044719 Bacteria 2461
90 Ga0466968_0015279 3300044735 Bacteria 3041
91 Ga0466968_0073111 3300044735 Bacteria 1496
92 Ga0466970_0037114 3300044765 Bacteria 2582
93 Ga0466960_0052245 3300044901 Bacteria 1976
94 Ga0466960_0135323 3300044901 Bacteria 1304
95 Ga0466959_0081229 3300045049 Bacteria 2336
96 Ga0466959_0239807 3300045049 Bacteria 1253
97 Ga0466958_0064291 3300045836 Bacteria 2237
98 Ga0466967_0304844 3300045976 Bacteria 1533
99 Ga0495641_0028679 3300046461 Bacteria 2691
100 Ga0495651_0172250 3300046462 Bacteria 1540
101 Ga0495608_0008243 3300046511 Bacteria 7316
102 Ga0495657_0017105 3300046675 Bacteria 5270
103 Ga0495600_0082274 3300046809 Bacteria 2101
104 Ga0495604_0215912 3300047317 Bacteria 1323
105 Ga0495680_0132124 3300047322 Bacteria 1833
106 Ga0495675_0035512 3300047444 Bacteria 3184
107 Ga0495602_0041730 3300048088 Bacteria 4188
108 Ga0496100_0400269 3300048903 Bacteria 1045
109 Ga0496102_0012432 3300048905 Bacteria 7367
110 Ga0496104_0021199 3300048907 Bacteria 5964
111 Ga0496105_0381437 3300048908 Bacteria 1122
112 Ga0496114_0002602 3300048917 Bacteria 13775
113 Ga0496114_0051471 3300048917 Bacteria 3429
114 Ga0496114_0187010 3300048917 Bacteria 1810
115 Ga0496114_0245400 3300048917 Bacteria 1575
116 Ga0496115_0006942 3300048918 Bacteria 8323
117 Ga0496115_0060208 3300048918 Bacteria 3059
118 Ga0496115_0190474 3300048918 Bacteria 1694
119 Ga0496120_0062112 3300048923 Bacteria 2082
120 Ga0496126_0001593 3300048929 Bacteria 34557
121 Ga0501032_0042071 3300049569 Bacteria 3101
122 Ga0501036_0013083 3300049572 Bacteria 6893
123 Ga0501037_0028532 3300049573 Bacteria 4123
124 Ga0501037_0247450 3300049573 Bacteria 1248
125 Ga0501038_0025503 3300049574 Bacteria 5268
126 Ga0501040_0007410 3300049576 Bacteria 7104
127 Ga0501041_0181386 3300049577 Bacteria 1318
128 Ga0501042_0141793 3300049578 Bacteria 1733
129 Ga0501042_0354959 3300049578 Bacteria 1061
130 Ga0501043_0011024 3300049579 Bacteria 7081
131 Ga0501047_0035758 3300049581 Bacteria 4798
132 Ga0501048_0020871 3300049582 Bacteria 4798
133 Ga0501067_0033962 3300049583 Bacteria 2831
134 Ga0501070_0000823 3300049586 Bacteria 28146
135 Ga0501070_0014889 3300049586 Bacteria 6542
136 Ga0501070_0115234 3300049586 Bacteria 2220
137 Ga0501071_0002581 3300049587 Bacteria 11058
138 Ga0501071_0259245 3300049587 Bacteria 1313
139 Ga0501072_0272789 3300049588 Bacteria 1346
140 Ga0501073_0041301 3300049589 Bacteria 3259
141 Ga0501074_0019773 3300049590 Bacteria 4891
142 Ga0501076_0197951 3300049592 Bacteria 1640
143 Ga0501035_0067298 3300049822 Bacteria 3179
144 Ga0501044_0014401 3300049823 Bacteria 8540
145 Ga0501044_0038531 3300049823 Bacteria 4991
146 nmdc:mga03n38_125037_c1 3300050490 Bacteria 1268
147 nmdc:mga03n38_21600_c1 3300050490 Bacteria 2592
148 nmdc:mga0yw44_199444_c1 3300050492 Bacteria 1321
149 nmdc:mga0yw44_51697_c1 3300050492 Bacteria 2489
150 nmdc:mga0yw44_5257_c1 3300050492 Bacteria 6075
151 nmdc:mga0yw44_95022_c1 3300050492 Bacteria 1890
152 nmdc:mga06z11_181766_c1 3300050494 Bacteria 1213
153 nmdc:mga06z11_26822_c1 3300050494 Bacteria 2747
154 nmdc:mga09592_399538_c1 3300050508 Bacteria 1188
155 Ga0500635_0000059 3300053080 Bacteria 72321
156 Ga0495595_0001682 3300053084 Bacteria 8663
157 Ga0495619_0020307 3300053085 Bacteria 4229
158 Ga0500593_001425 3300053117 Bacteria 8597
159 Ga0500655_005468 3300053133 Bacteria 2292
160 Ga0500559_0000162 3300053136 Bacteria 52858
161 Ga0500559_0002433 3300053136 Bacteria 9636
162 Ga0500559_0006478 3300053136 Bacteria 5285
163 Ga0590075_029083 3300059424 Bacteria 1396
164 Ga0466962_0020362 3300061719 Bacteria 3187

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035398 Ga0316574_0324927 Ga0316574_0324927_19_837 265
2 3300050494 nmdc:mga06z11_181766_c1 nmdc:mga06z11_181766_c1_380_1198 272
3 3300045976 Ga0466967_0304844 Ga0466967_0304844_587_1489 275
4 3300006028 Ga0070717_10113945 Ga0070717_101139452 282
5 3300049588 Ga0501072_0272789 Ga0501072_0272789_15_878 287
6 3300042005 Ga0439448_0010506 Ga0439448_0010506_1133_2029 288
7 3300042461 Ga0439460_0020216 Ga0439460_0020216_94_990 288
8 3300042993 Ga0439440_0000882 Ga0439440_0000882_2420_3316 288
9 3300028794 Ga0307515_10038786 Ga0307515_100387865 290
10 3300048903 Ga0496100_0400269 Ga0496100_0400269_142_1017 291
11 3300048905 Ga0496102_0012432 Ga0496102_0012432_4617_5492 291
12 3300048907 Ga0496104_0021199 Ga0496104_0021199_4563_5438 291
13 3300048918 Ga0496115_0190474 Ga0496115_0190474_55_930 291
14 3300005530 Ga0070679_100113635 Ga0070679_1001136353 293
15 3300031852 Ga0307410_10294120 Ga0307410_102941202 293
16 3300048088 Ga0495602_0041730 Ga0495602_0041730_778_1704 294
17 3300053117 Ga0500593_001425 Ga0500593_001425_3413_4303 296
18 3300053133 Ga0500655_005468 Ga0500655_005468_1073_1963 296
19 3300053136 Ga0500559_0000162 Ga0500559_0000162_28620_29510 296
20 iso_pu_bacteria 2799112218 2799186714 296
21 iso_pu_bacteria 2939660829 2939664116 297
22 3300049578 Ga0501042_0354959 Ga0501042_0354959_74_970 298
23 iso_pu_bacteria 2857733635 2857736271 298
24 iso_pu_bacteria 2939657138 2939659754 298
25 iso_pu_bacteria 8002811521 8002812063 298
26 3300005336 Ga0070680_100000282 Ga0070680_10000028216 299
27 3300005435 Ga0070714_100054574 Ga0070714_1000545742 299
28 3300005458 Ga0070681_10000327 Ga0070681_1000032723 299
29 3300005458 Ga0070681_10036615 Ga0070681_100366152 299
30 3300005468 Ga0070707_100000797 Ga0070707_10000079723 299
31 3300005530 Ga0070679_100000542 Ga0070679_10000054223 299
32 3300005530 Ga0070679_100060774 Ga0070679_1000607742 299
33 3300005530 Ga0070679_100281773 Ga0070679_1002817732 299
34 3300006048 Ga0075363_100013351 Ga0075363_1000133513 299
35 3300009177 Ga0105248_10374156 Ga0105248_103741561 299
36 3300009553 Ga0105249_10216460 Ga0105249_102164602 299
37 3300013105 Ga0157369_10010668 Ga0157369_1001066810 299
38 3300013296 Ga0157374_10219882 Ga0157374_102198823 299
39 3300025909 Ga0207705_10063450 Ga0207705_100634505 299
40 3300025910 Ga0207684_10004995 Ga0207684_100049959 299
41 3300025912 Ga0207707_10002634 Ga0207707_100026342 299
42 3300025912 Ga0207707_10062077 Ga0207707_100620774 299
43 3300025917 Ga0207660_10000511 Ga0207660_1000051112 299
44 3300025921 Ga0207652_10000528 Ga0207652_1000052814 299
45 3300025921 Ga0207652_10155872 Ga0207652_101558723 299
46 3300025922 Ga0207646_10000388 Ga0207646_1000038826 299
47 3300025929 Ga0207664_10114892 Ga0207664_101148923 299
48 3300025961 Ga0207712_10145631 Ga0207712_101456312 299
49 3300044656 Ga0466969_0089355 Ga0466969_0089355_394_1293 299
50 3300045049 Ga0466959_0239807 Ga0466959_0239807_82_981 299
51 3300049569 Ga0501032_0042071 Ga0501032_0042071_133_1032 299
52 3300049576 Ga0501040_0007410 Ga0501040_0007410_4642_5541 299
53 3300049578 Ga0501042_0141793 Ga0501042_0141793_557_1456 299
54 3300049583 Ga0501067_0033962 Ga0501067_0033962_229_1128 299
55 3300049586 Ga0501070_0014889 Ga0501070_0014889_5436_6335 299
56 3300049586 Ga0501070_0115234 Ga0501070_0115234_1021_1920 299
57 3300049587 Ga0501071_0002581 Ga0501071_0002581_8727_9626 299
58 3300049589 Ga0501073_0041301 Ga0501073_0041301_1589_2488 299
59 3300049822 Ga0501035_0067298 Ga0501035_0067298_1618_2517 299
60 3300049823 Ga0501044_0038531 Ga0501044_0038531_3822_4721 299
61 3300050490 nmdc:mga03n38_21600_c1 nmdc:mga03n38_21600_c1_797_1696 299
62 iso_pu_bacteria 2643221616 2644094190 299
63 iso_pu_bacteria 2852677369 2852677436 299
64 iso_pu_bacteria 2862993130 2862994352 299
65 iso_pu_bacteria 2873314349 2873317371 299
66 iso_pu_bacteria 2884763398 2884763639 299
67 3300037853 Ga0436364_1280294 Ga0436364_1280294_1992_2918 300
68 3300039437 Ga0436365_1335857 Ga0436365_1335857_2190_3116 300
69 3300048923 Ga0496120_0062112 Ga0496120_0062112_886_1788 300
70 3300006038 Ga0075365_10036727 Ga0075365_100367273 301
71 3300006186 Ga0075369_10021908 Ga0075369_100219082 301
72 3300042007 Ga0439449_0016680 Ga0439449_0016680_263_1174 301
73 3300042435 Ga0439434_0032903 Ga0439434_0032903_133_1044 301
74 3300050492 nmdc:mga0yw44_5257_c1 nmdc:mga0yw44_5257_c1_438_1343 301
75 3300050508 nmdc:mga09592_399538_c1 nmdc:mga09592_399538_c1_62_973 301
76 iso_pu_bacteria 2738541305 2738869650 301
77 iso_pu_bacteria 2791354901 2791913940 301
78 iso_pu_bacteria 2857710386 2857713216 301
79 3300005339 Ga0070660_100111662 Ga0070660_1001116621 302
80 3300005406 Ga0070703_10011293 Ga0070703_100112933 302
81 3300005440 Ga0070705_100011886 Ga0070705_1000118862 302
82 3300005445 Ga0070708_100462401 Ga0070708_1004624011 302
83 3300005458 Ga0070681_10017281 Ga0070681_100172813 302
84 3300005458 Ga0070681_10042501 Ga0070681_100425014 302
85 3300005468 Ga0070707_100346558 Ga0070707_1003465582 302
86 3300005530 Ga0070679_100027226 Ga0070679_1000272262 302
87 3300005545 Ga0070695_100009722 Ga0070695_1000097225 302
88 3300006038 Ga0075365_10071013 Ga0075365_100710132 302
89 3300006042 Ga0075368_10090396 Ga0075368_100903961 302
90 3300006178 Ga0075367_10033920 Ga0075367_100339202 302
91 3300025912 Ga0207707_10218170 Ga0207707_102181702 302
92 3300025917 Ga0207660_10113877 Ga0207660_101138772 302
93 3300025919 Ga0207657_10096955 Ga0207657_100969552 302
94 3300025921 Ga0207652_10019272 Ga0207652_100192723 302
95 3300025944 Ga0207661_10252106 Ga0207661_102521061 302
96 3300031727 Ga0316576_10024488 Ga0316576_100244885 302
97 3300031911 Ga0307412_10160216 Ga0307412_101602161 302
98 3300032139 Ga0316580_10026812 Ga0316580_100268122 302
99 3300044684 Ga0466966_0187947 Ga0466966_0187947_106_1017 302
100 3300044693 Ga0466961_0001004 Ga0466961_0001004_87_998 302
101 3300044693 Ga0466961_0037830 Ga0466961_0037830_68_979 302
102 3300045836 Ga0466958_0064291 Ga0466958_0064291_925_1836 302
103 3300046461 Ga0495641_0028679 Ga0495641_0028679_1268_2176 302
104 3300046462 Ga0495651_0172250 Ga0495651_0172250_480_1406 302
105 3300046511 Ga0495608_0008243 Ga0495608_0008243_2612_3538 302
106 3300046675 Ga0495657_0017105 Ga0495657_0017105_1061_1987 302
107 3300046809 Ga0495600_0082274 Ga0495600_0082274_1136_2062 302
108 3300047317 Ga0495604_0215912 Ga0495604_0215912_62_988 302
109 3300047322 Ga0495680_0132124 Ga0495680_0132124_551_1477 302
110 3300047444 Ga0495675_0035512 Ga0495675_0035512_512_1438 302
111 3300048917 Ga0496114_0002602 Ga0496114_0002602_97_1035 302
112 3300048917 Ga0496114_0051471 Ga0496114_0051471_441_1379 302
113 3300049572 Ga0501036_0013083 Ga0501036_0013083_2436_3350 302
114 3300049573 Ga0501037_0028532 Ga0501037_0028532_65_979 302
115 3300049573 Ga0501037_0247450 Ga0501037_0247450_124_1080 302
116 3300049574 Ga0501038_0025503 Ga0501038_0025503_3586_4500 302
117 3300049577 Ga0501041_0181386 Ga0501041_0181386_180_1088 302
118 3300049579 Ga0501043_0011024 Ga0501043_0011024_2620_3534 302
119 3300049581 Ga0501047_0035758 Ga0501047_0035758_337_1251 302
120 3300049582 Ga0501048_0020871 Ga0501048_0020871_337_1251 302
121 3300049587 Ga0501071_0259245 Ga0501071_0259245_376_1284 302
122 3300049590 Ga0501074_0019773 Ga0501074_0019773_464_1378 302
123 3300049592 Ga0501076_0197951 Ga0501076_0197951_426_1334 302
124 3300049823 Ga0501044_0014401 Ga0501044_0014401_2932_3846 302
125 3300050490 nmdc:mga03n38_125037_c1 nmdc:mga03n38_125037_c1_272_1180 302
126 3300050492 nmdc:mga0yw44_199444_c1 nmdc:mga0yw44_199444_c1_249_1160 302
127 3300053084 Ga0495595_0001682 Ga0495595_0001682_4378_5304 302
128 3300053085 Ga0495619_0020307 Ga0495619_0020307_402_1328 302
129 3300053136 Ga0500559_0002433 Ga0500559_0002433_2607_3515 302
130 3300053136 Ga0500559_0006478 Ga0500559_0006478_4050_4958 302
131 3300059424 Ga0590075_029083 Ga0590075_029083_416_1357 302
132 iso_pu_bacteria 2582580736 2583148881 302
133 3300003214 JGI25165J46597_1000092 JGI25165J46597_10000925 303
134 3300003762 Ga0055542_1000055 Ga0055542_1000055154 303
135 3300003763 Ga0055529_1000066 Ga0055529_10000666 303
136 3300005337 Ga0070682_100225011 Ga0070682_1002250111 303
137 3300005843 Ga0068860_100000255 Ga0068860_10000025525 303
138 3300006038 Ga0075365_10014136 Ga0075365_100141364 303
139 3300009036 Ga0105244_10014722 Ga0105244_100147222 303
140 3300013105 Ga0157369_10002366 Ga0157369_1000236611 303
141 3300013105 Ga0157369_10068112 Ga0157369_100681121 303
142 3300013105 Ga0157369_10158393 Ga0157369_101583933 303
143 3300013307 Ga0157372_10569925 Ga0157372_105699251 303
144 3300013308 Ga0157375_10374362 Ga0157375_103743621 303
145 3300020081 Ga0206354_11586557 Ga0206354_115865572 303
146 3300025228 Ga0209672_100011 Ga0209672_100011155 303
147 3300025229 Ga0209147_100238 Ga0209147_10023812 303
148 3300025231 Ga0207427_100182 Ga0207427_10018254 303
149 3300025233 Ga0209437_107487 Ga0209437_1074872 303
150 3300025254 Ga0209148_1000132 Ga0209148_10001327 303
151 3300025261 Ga0209233_1000014 Ga0209233_1000014940 303
152 3300025272 Ga0209455_1000122 Ga0209455_1000122155 303
153 3300028381 Ga0268264_10003157 Ga0268264_100031577 303
154 3300037312 Ga0395899_0010314 Ga0395899_0010314_3203_4114 303
155 3300037418 Ga0395900_0014167 Ga0395900_0014167_2750_3661 303
156 3300037466 Ga0395898_0000158 Ga0395898_0000158_3923_4834 303
157 3300044656 Ga0466969_0049443 Ga0466969_0049443_37_948 303
158 3300044658 Ga0466972_0095237 Ga0466972_0095237_273_1184 303
159 3300044693 Ga0466961_0142394 Ga0466961_0142394_536_1447 303
160 3300044719 Ga0466971_0029323 Ga0466971_0029323_640_1551 303
161 3300044735 Ga0466968_0015279 Ga0466968_0015279_670_1581 303
162 3300044735 Ga0466968_0073111 Ga0466968_0073111_256_1167 303
163 3300044765 Ga0466970_0037114 Ga0466970_0037114_563_1474 303
164 3300044901 Ga0466960_0052245 Ga0466960_0052245_395_1306 303
165 3300044901 Ga0466960_0135323 Ga0466960_0135323_224_1135 303
166 3300045049 Ga0466959_0081229 Ga0466959_0081229_671_1582 303
167 3300048908 Ga0496105_0381437 Ga0496105_0381437_89_1000 303
168 3300048917 Ga0496114_0187010 Ga0496114_0187010_771_1682 303
169 3300048917 Ga0496114_0245400 Ga0496114_0245400_177_1088 303
170 3300048918 Ga0496115_0006942 Ga0496115_0006942_5136_6155 303
171 3300048918 Ga0496115_0060208 Ga0496115_0060208_576_1487 303
172 3300048929 Ga0496126_0001593 Ga0496126_0001593_12731_13642 303
173 3300049586 Ga0501070_0000823 Ga0501070_0000823_22855_23766 303
174 3300050492 nmdc:mga0yw44_51697_c1 nmdc:mga0yw44_51697_c1_376_1293 303
175 3300050492 nmdc:mga0yw44_95022_c1 nmdc:mga0yw44_95022_c1_74_985 303
176 3300050494 nmdc:mga06z11_26822_c1 nmdc:mga06z11_26822_c1_973_1890 303
177 3300053080 Ga0500635_0000059 Ga0500635_0000059_4404_5315 303
178 3300061719 Ga0466962_0020362 Ga0466962_0020362_1163_2074 303

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00378

ECH_1

Enoyl-CoA hydratase/isomerase

31

300

0.89

PF16113

ECH_2

Enoyl-CoA hydratase/isomerase

36

244

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3t8b-assembly1.cif.gz_B crystal structure of mycobacterium tuberculosis menb with altered hexameric assembly 0.9638 9 243
3t8a-assembly1.cif.gz_C-2 crystal structure of mycobacterium tuberculosis menb in complex with substrate analogue, osb-ncoa 0.9604 9 279
1rjm-assembly1.cif.gz_B crystal structure of menb (rv0548c) from mycobacterium tuberculosis 0.9604 9 273
1rjm-assembly1.cif.gz_C-2 crystal structure of menb (rv0548c) from mycobacterium tuberculosis 0.9602 9 272
1rjn-assembly1.cif.gz_C-2 the crystal structure of menb (rv0548c) from mycobacterium tuberculosis in complex with the coa portion of naphthoyl coa 0.9597 9 273
ID Description Score Start End Superfamily
1q52B01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9523 10 239 3.90.226.10
1q52B01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9436 10 239 3.90.226.10
2uzfB02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9366 242 290 1.10.12.10
3t8aA02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9352 242 283 1.10.12.10
2iexB02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9351 242 290 1.10.12.10
ID Description Score Start End GO Terms
AF-A0A358EGX5-F1-model_v4 1,4-dihydroxy-2-naphthoyl-CoA synthase (EC 4.1.3.36) 0.9435 5 102 GO:0008935
AF-A0A523EWN3-F1-model_v4 deleted 0.9424 5 110
AF-A0A256KIP0-F1-model_v4 deleted 0.9345 21 271
AF-A0A812WY39-F1-model_v4 deleted 0.9335 9 292
AF-A0A3M1VGY0-F1-model_v4 deleted 0.9313 14 303

Feature Viewer

pLDDT pTM Quality
82.66 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map