F271598

General Info

Members Datasets Scaffolds Average Seq Length
178 132 178 60

Family's Representative Sequence

Representative Sequence 3300005466|Ga0070685_10000010|Ga0070685_10000010119
Length 59
Sequence MRLNEAAVFKWVVIVGIALLTRPLVGSLLGLILVIAASVHGYRWMVQKRREVGTKDLPS

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
48 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
91 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
92 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
93 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
94 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
95 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
96 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
97 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
98 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
99 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
100 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
101 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
102 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
103 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
104 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
105 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
106 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
107 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
108 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
109 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
110 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
111 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
112 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
113 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
114 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
115 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
116 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
117 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
118 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
119 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
120 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
121 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
122 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
123 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
124 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
125 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
126 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
128 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
129 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
130 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
131 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
132 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.74
Rhizosphere 92.13
Stem 0
Stem Tuber 0
Unclassified 1.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10072858 3300005327 Bacteria 2816
2 Ga0070683_100006417 3300005329 Bacteria 9863
3 Ga0070683_100100924 3300005329 Bacteria 2717
4 Ga0070690_100453475 3300005330 Unclassified 951
5 Ga0070670_100715527 3300005331 Bacteria 901
6 Ga0070666_10426969 3300005335 Unclassified 955
7 Ga0070682_100000026 3300005337 Bacteria 191388
8 Ga0068868_100272199 3300005338 Bacteria 1431
9 Ga0070689_100143255 3300005340 Bacteria 1923
10 Ga0070691_11016085 3300005341 Unclassified 518
11 Ga0070661_100000004 3300005344 Bacteria 243876
12 Ga0070692_10041124 3300005345 Bacteria 2367
13 Ga0070668_100023112 3300005347 Bacteria 4700
14 Ga0070668_100449199 3300005347 Bacteria 1108
15 Ga0070688_100000010 3300005365 Bacteria 84103
16 Ga0070688_100000686 3300005365 Bacteria 16820
17 Ga0070688_100297729 3300005365 Bacteria 1165
18 Ga0070659_100133000 3300005366 Bacteria 2021
19 Ga0070667_100001110 3300005367 Bacteria 24556
20 Ga0070667_100110717 3300005367 Bacteria 2381
21 Ga0070714_100014187 3300005435 Bacteria 6397
22 Ga0070714_100743483 3300005435 Bacteria 948
23 Ga0070678_100050047 3300005456 Bacteria 3020
24 Ga0068867_100736224 3300005459 Bacteria 873
25 Ga0070685_10000010 3300005466 Bacteria 146946
26 Ga0070685_10001080 3300005466 Bacteria 14623
27 Ga0070685_10205063 3300005466 Bacteria 1284
28 Ga0070679_102205690 3300005530 Bacteria 500
29 Ga0070684_100022481 3300005535 Bacteria 5260
30 Ga0070684_100227394 3300005535 Bacteria 1703
31 Ga0068853_100200443 3300005539 Bacteria 1816
32 Ga0068853_100430109 3300005539 Bacteria 1239
33 Ga0070665_100002868 3300005548 Bacteria 18629
34 Ga0070665_100042444 3300005548 Bacteria 4572
35 Ga0070665_100230795 3300005548 Bacteria 1851
36 Ga0070665_100484506 3300005548 Bacteria 1248
37 Ga0070704_100209915 3300005549 Bacteria 1577
38 Ga0068855_100358035 3300005563 Bacteria 1606
39 Ga0070664_100024741 3300005564 Bacteria 4971
40 Ga0068857_100081167 3300005577 Bacteria 2896
41 Ga0068857_101788374 3300005577 Unclassified 601
42 Ga0068854_100000082 3300005578 Bacteria 68340
43 Ga0068856_100044112 3300005614 Bacteria 4387
44 Ga0068852_100217137 3300005616 Bacteria 1817
45 Ga0068859_101172213 3300005617 Bacteria 846
46 Ga0068851_10001071 3300005834 Bacteria 11849
47 Ga0068851_10003112 3300005834 Bacteria 7354
48 Ga0068860_100088957 3300005843 Bacteria 2939
49 Ga0068862_100017783 3300005844 Bacteria 5917
50 Ga0070715_10931982 3300006163 Bacteria 537
51 Ga0097621_100320854 3300006237 Bacteria 1372
52 Ga0068865_100001495 3300006881 Bacteria 13634
53 Ga0097620_101172228 3300006931 Bacteria 846
54 Ga0075435_100378551 3300007076 Bacteria 1216
55 Ga0105245_10068331 3300009098 Bacteria 3220
56 Ga0105247_10188716 3300009101 Bacteria 1379
57 Ga0105243_10007042 3300009148 Bacteria 8652
58 Ga0105241_10019996 3300009174 Bacteria 4943
59 Ga0105241_10329151 3300009174 Bacteria 1320
60 Ga0105248_10353713 3300009177 Bacteria 1654
61 Ga0105249_10017915 3300009553 Bacteria 6294
62 Ga0105239_10302874 3300010375 Bacteria 1800
63 Ga0105239_10414989 3300010375 Bacteria 1524
64 Ga0157373_10534809 3300013100 Bacteria 849
65 Ga0157371_10004888 3300013102 Bacteria 11513
66 Ga0157370_10014559 3300013104 Bacteria 8039
67 Ga0157370_10125853 3300013104 Unclassified 2392
68 Ga0157369_10001730 3300013105 Bacteria 26528
69 Ga0157369_11045562 3300013105 Bacteria 835
70 Ga0157378_10016178 3300013297 Bacteria 6532
71 Ga0157378_10183071 3300013297 Bacteria 1972
72 Ga0163162_11535588 3300013306 Bacteria 759
73 Ga0157372_10000146 3300013307 Bacteria 77952
74 Ga0157375_10568908 3300013308 Bacteria 1294
75 Ga0157375_12716379 3300013308 Unclassified 592
76 Ga0157380_10000007 3300014326 Bacteria 157634
77 Ga0157380_10556847 3300014326 Bacteria 1126
78 Ga0157380_12201851 3300014326 Unclassified 615
79 Ga0157379_10438373 3300014968 Bacteria 1204
80 Ga0157376_10044825 3300014969 Bacteria 3638
81 Ga0157376_12785140 3300014969 Bacteria 529
82 Ga0207656_10008769 3300025321 Bacteria 3737
83 Ga0207656_10051149 3300025321 Bacteria 1786
84 Ga0207710_10054520 3300025900 Bacteria 1800
85 Ga0207710_10234318 3300025900 Bacteria 914
86 Ga0207710_10466380 3300025900 Bacteria 653
87 Ga0207680_10395577 3300025903 Unclassified 976
88 Ga0207685_10373646 3300025905 Unclassified 724
89 Ga0207705_10079913 3300025909 Bacteria 2382
90 Ga0207654_10048157 3300025911 Bacteria 2438
91 Ga0207654_10254894 3300025911 Bacteria 1177
92 Ga0207671_10306790 3300025914 Unclassified 1254
93 Ga0207650_10638869 3300025925 Bacteria 897
94 Ga0207687_10035974 3300025927 Bacteria 3371
95 Ga0207664_10015535 3300025929 Bacteria 5529
96 Ga0207664_10600320 3300025929 Bacteria 988
97 Ga0207690_10076582 3300025932 Bacteria 2323
98 Ga0207709_10003313 3300025935 Bacteria 9648
99 Ga0207670_10112229 3300025936 Bacteria 1967
100 Ga0207704_10000104 3300025938 Bacteria 46614
101 Ga0207711_10000011 3300025941 Bacteria 518817
102 Ga0207711_10331675 3300025941 Bacteria 1407
103 Ga0207661_10002281 3300025944 Bacteria 13216
104 Ga0207661_10080964 3300025944 Bacteria 2681
105 Ga0207679_10018802 3300025945 Bacteria 4635
106 Ga0207667_10306661 3300025949 Bacteria 1622
107 Ga0207712_10022380 3300025961 Bacteria 4160
108 Ga0207668_10058962 3300025972 Bacteria 2686
109 Ga0207668_10204316 3300025972 Bacteria 1575
110 Ga0207668_10606704 3300025972 Bacteria 954
111 Ga0207640_10000054 3300025981 Bacteria 95136
112 Ga0207658_10001811 3300025986 Bacteria 15995
113 Ga0207658_10418493 3300025986 Bacteria 1181
114 Ga0207677_10470211 3300026023 Bacteria 1081
115 Ga0207639_10055564 3300026041 Bacteria 3031
116 Ga0207639_10388470 3300026041 Bacteria 1255
117 Ga0207708_10043826 3300026075 Bacteria 3410
118 Ga0207702_10068721 3300026078 Bacteria 3044
119 Ga0207674_10519729 3300026116 Bacteria 1150
120 Ga0207683_10071549 3300026121 Bacteria 3066
121 Ga0207698_10181723 3300026142 Bacteria 1864
122 Ga0268266_10000526 3300028379 Bacteria 53404
123 Ga0268266_10015588 3300028379 Bacteria 6515
124 Ga0268266_10024467 3300028379 Bacteria 5135
125 Ga0268266_10437826 3300028379 Bacteria 1241
126 Ga0268265_10001768 3300028380 Bacteria 17341
127 Ga0268264_10051195 3300028381 Bacteria 3440
128 Ga0268264_10766919 3300028381 Bacteria 962
129 Ga0326468_10066566 3300031889 Bacteria 588
130 Ga0307415_100011252 3300032126 Bacteria 5112
131 Ga0316582_0351601 3300036647 Bacteria 1014
132 Ga0451804_0848689 3300041463 Bacteria 733
133 Ga0466963_0253445 3300044694 Bacteria 1235
134 Ga0466957_0359629 3300044842 Bacteria 989
135 Ga0466967_0000002 3300045976 Bacteria 219994
136 Ga0495592_0229444 3300046454 Bacteria 1237
137 Ga0495629_0010954 3300046459 Bacteria 6593
138 Ga0495629_0043228 3300046459 Bacteria 3164
139 Ga0495662_0002052 3300046476 Bacteria 10100
140 Ga0495606_0000017 3300046507 Bacteria 284549
141 Ga0495610_0187494 3300046512 Bacteria 856
142 Ga0495610_0354508 3300046512 Unclassified 552
143 Ga0495628_0202912 3300046516 Bacteria 1493
144 Ga0495630_0000032 3300046517 Bacteria 134425
145 Ga0495587_0270197 3300046536 Bacteria 954
146 Ga0495588_0000073 3300046674 Bacteria 219005
147 Ga0495647_0005861 3300046681 Bacteria 4044
148 Ga0495658_0000947 3300046683 Bacteria 15486
149 Ga0495613_0000027 3300046689 Bacteria 146674
150 Ga0495624_0000691 3300046690 Bacteria 26457
151 Ga0495600_0037258 3300046809 Bacteria 3161
152 Ga0495604_0000723 3300047317 Bacteria 27948
153 Ga0495604_0476347 3300047317 Unclassified 812
154 Ga0495676_0034965 3300047321 Bacteria 4209
155 Ga0495676_0443245 3300047321 Bacteria 857
156 Ga0495593_0328399 3300047673 Bacteria 764
157 Ga0495602_0000034 3300048088 Bacteria 140722
158 Ga0496104_0000010 3300048907 Bacteria 475255
159 Ga0496105_0000005 3300048908 Bacteria 475797
160 Ga0496108_0039188 3300048911 Bacteria 3950
161 Ga0496109_0000221 3300048912 Bacteria 56054
162 Ga0496110_0691479 3300048913 Bacteria 921
163 Ga0496111_0316592 3300048914 Bacteria 1156
164 Ga0496111_0380253 3300048914 Bacteria 1044
165 Ga0496112_0021401 3300048915 Bacteria 6150
166 Ga0496113_0000005 3300048916 Bacteria 105956
167 Ga0496114_1439883 3300048917 Bacteria 576
168 Ga0496114_1664293 3300048917 Bacteria 526
169 Ga0496119_0040734 3300048922 Bacteria 2967
170 Ga0496120_0061681 3300048923 Bacteria 2091
171 Ga0501033_1051291 3300049570 Bacteria 543
172 Ga0501070_0018817 3300049586 Bacteria 5794
173 nmdc:mga0rr50_309764_c1 3300050513 Bacteria 1322
174 Ga0495601_0000017 3300053077 Bacteria 204209
175 Ga0495601_0279542 3300053077 Unclassified 1088
176 Ga0495612_0018670 3300053078 Bacteria 2777
177 Ga0495595_0007746 3300053084 Bacteria 4398
178 Ga0495619_0000088 3300053085 Bacteria 69615

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005365 Ga0070688_100000010 Ga0070688_1000000108 50
2 3300005466 Ga0070685_10000010 Ga0070685_10000010119 50
3 3300014969 Ga0157376_12785140 Ga0157376_127851401 56
4 3300005329 Ga0070683_100006417 Ga0070683_1000064171 58
5 3300005329 Ga0070683_100100924 Ga0070683_1001009245 58
6 3300005330 Ga0070690_100453475 Ga0070690_1004534752 58
7 3300005331 Ga0070670_100715527 Ga0070670_1007155272 58
8 3300005335 Ga0070666_10426969 Ga0070666_104269692 58
9 3300005337 Ga0070682_100000026 Ga0070682_100000026176 58
10 3300005338 Ga0068868_100272199 Ga0068868_1002721991 58
11 3300005340 Ga0070689_100143255 Ga0070689_1001432554 58
12 3300005341 Ga0070691_11016085 Ga0070691_110160852 58
13 3300005344 Ga0070661_100000004 Ga0070661_100000004238 58
14 3300005345 Ga0070692_10041124 Ga0070692_100411244 58
15 3300005347 Ga0070668_100023112 Ga0070668_1000231123 58
16 3300005347 Ga0070668_100449199 Ga0070668_1004491992 58
17 3300005365 Ga0070688_100000686 Ga0070688_1000006864 58
18 3300005365 Ga0070688_100297729 Ga0070688_1002977292 58
19 3300005366 Ga0070659_100133000 Ga0070659_1001330004 58
20 3300005367 Ga0070667_100001110 Ga0070667_10000111017 58
21 3300005367 Ga0070667_100110717 Ga0070667_1001107171 58
22 3300005435 Ga0070714_100014187 Ga0070714_1000141878 58
23 3300005435 Ga0070714_100743483 Ga0070714_1007434832 58
24 3300005456 Ga0070678_100050047 Ga0070678_1000500475 58
25 3300005459 Ga0068867_100736224 Ga0068867_1007362242 58
26 3300005466 Ga0070685_10001080 Ga0070685_1000108018 58
27 3300005466 Ga0070685_10205063 Ga0070685_102050632 58
28 3300005530 Ga0070679_102205690 Ga0070679_1022056902 58
29 3300005535 Ga0070684_100022481 Ga0070684_1000224814 58
30 3300005535 Ga0070684_100227394 Ga0070684_1002273942 58
31 3300005539 Ga0068853_100200443 Ga0068853_1002004432 58
32 3300005539 Ga0068853_100430109 Ga0068853_1004301091 58
33 3300005548 Ga0070665_100002868 Ga0070665_1000028684 58
34 3300005548 Ga0070665_100042444 Ga0070665_1000424442 58
35 3300005548 Ga0070665_100230795 Ga0070665_1002307954 58
36 3300005548 Ga0070665_100484506 Ga0070665_1004845062 58
37 3300005549 Ga0070704_100209915 Ga0070704_1002099153 58
38 3300005563 Ga0068855_100358035 Ga0068855_1003580353 58
39 3300005564 Ga0070664_100024741 Ga0070664_1000247416 58
40 3300005577 Ga0068857_100081167 Ga0068857_1000811672 58
41 3300005577 Ga0068857_101788374 Ga0068857_1017883742 58
42 3300005578 Ga0068854_100000082 Ga0068854_10000008252 58
43 3300005614 Ga0068856_100044112 Ga0068856_1000441122 58
44 3300005616 Ga0068852_100217137 Ga0068852_1002171373 58
45 3300005617 Ga0068859_101172213 Ga0068859_1011722132 58
46 3300005834 Ga0068851_10001071 Ga0068851_1000107114 58
47 3300005834 Ga0068851_10003112 Ga0068851_1000311211 58
48 3300005843 Ga0068860_100088957 Ga0068860_1000889573 58
49 3300005844 Ga0068862_100017783 Ga0068862_1000177834 58
50 3300006163 Ga0070715_10931982 Ga0070715_109319821 58
51 3300006237 Ga0097621_100320854 Ga0097621_1003208543 58
52 3300006881 Ga0068865_100001495 Ga0068865_10000149515 58
53 3300006931 Ga0097620_101172228 Ga0097620_1011722282 58
54 3300007076 Ga0075435_100378551 Ga0075435_1003785511 58
55 3300009098 Ga0105245_10068331 Ga0105245_100683312 58
56 3300009101 Ga0105247_10188716 Ga0105247_101887162 58
57 3300009148 Ga0105243_10007042 Ga0105243_100070424 58
58 3300009174 Ga0105241_10019996 Ga0105241_100199969 58
59 3300009174 Ga0105241_10329151 Ga0105241_103291512 58
60 3300009177 Ga0105248_10353713 Ga0105248_103537132 58
61 3300009553 Ga0105249_10017915 Ga0105249_100179158 58
62 3300010375 Ga0105239_10302874 Ga0105239_103028744 58
63 3300010375 Ga0105239_10414989 Ga0105239_104149892 58
64 3300013100 Ga0157373_10534809 Ga0157373_105348092 58
65 3300013102 Ga0157371_10004888 Ga0157371_100048888 58
66 3300013104 Ga0157370_10014559 Ga0157370_100145594 58
67 3300013104 Ga0157370_10125853 Ga0157370_101258532 58
68 3300013105 Ga0157369_10001730 Ga0157369_1000173019 58
69 3300013105 Ga0157369_11045562 Ga0157369_110455622 58
70 3300013297 Ga0157378_10016178 Ga0157378_100161789 58
71 3300013306 Ga0163162_11535588 Ga0163162_115355882 58
72 3300013307 Ga0157372_10000146 Ga0157372_100001465 58
73 3300013308 Ga0157375_10568908 Ga0157375_105689083 58
74 3300013308 Ga0157375_12716379 Ga0157375_127163792 58
75 3300014326 Ga0157380_10000007 Ga0157380_1000000730 58
76 3300014326 Ga0157380_10556847 Ga0157380_105568472 58
77 3300014326 Ga0157380_12201851 Ga0157380_122018511 58
78 3300014968 Ga0157379_10438373 Ga0157379_104383732 58
79 3300025321 Ga0207656_10008769 Ga0207656_100087694 58
80 3300025321 Ga0207656_10051149 Ga0207656_100511493 58
81 3300025900 Ga0207710_10054520 Ga0207710_100545203 58
82 3300025900 Ga0207710_10234318 Ga0207710_102343181 58
83 3300025900 Ga0207710_10466380 Ga0207710_104663801 58
84 3300025903 Ga0207680_10395577 Ga0207680_103955772 58
85 3300025905 Ga0207685_10373646 Ga0207685_103736462 58
86 3300025911 Ga0207654_10048157 Ga0207654_100481574 58
87 3300025911 Ga0207654_10254894 Ga0207654_102548943 58
88 3300025914 Ga0207671_10306790 Ga0207671_103067901 58
89 3300025925 Ga0207650_10638869 Ga0207650_106388692 58
90 3300025927 Ga0207687_10035974 Ga0207687_100359744 58
91 3300025929 Ga0207664_10015535 Ga0207664_100155353 58
92 3300025929 Ga0207664_10600320 Ga0207664_106003202 58
93 3300025932 Ga0207690_10076582 Ga0207690_100765824 58
94 3300025935 Ga0207709_10003313 Ga0207709_100033134 58
95 3300025936 Ga0207670_10112229 Ga0207670_101122292 58
96 3300025938 Ga0207704_10000104 Ga0207704_1000010414 58
97 3300025941 Ga0207711_10000011 Ga0207711_10000011382 58
98 3300025941 Ga0207711_10331675 Ga0207711_103316752 58
99 3300025944 Ga0207661_10002281 Ga0207661_100022814 58
100 3300025944 Ga0207661_10080964 Ga0207661_100809645 58
101 3300025945 Ga0207679_10018802 Ga0207679_100188023 58
102 3300025949 Ga0207667_10306661 Ga0207667_103066612 58
103 3300025961 Ga0207712_10022380 Ga0207712_100223801 58
104 3300025972 Ga0207668_10058962 Ga0207668_100589624 58
105 3300025972 Ga0207668_10204316 Ga0207668_102043162 58
106 3300025972 Ga0207668_10606704 Ga0207668_106067042 58
107 3300025981 Ga0207640_10000054 Ga0207640_1000005427 58
108 3300025986 Ga0207658_10001811 Ga0207658_1000181111 58
109 3300025986 Ga0207658_10418493 Ga0207658_104184933 58
110 3300026023 Ga0207677_10470211 Ga0207677_104702113 58
111 3300026041 Ga0207639_10055564 Ga0207639_100555642 58
112 3300026041 Ga0207639_10388470 Ga0207639_103884701 58
113 3300026078 Ga0207702_10068721 Ga0207702_100687212 58
114 3300026116 Ga0207674_10519729 Ga0207674_105197292 58
115 3300026121 Ga0207683_10071549 Ga0207683_100715492 58
116 3300026142 Ga0207698_10181723 Ga0207698_101817233 58
117 3300028379 Ga0268266_10000526 Ga0268266_1000052639 58
118 3300028379 Ga0268266_10015588 Ga0268266_1001558810 58
119 3300028379 Ga0268266_10024467 Ga0268266_100244673 58
120 3300028379 Ga0268266_10437826 Ga0268266_104378262 58
121 3300028380 Ga0268265_10001768 Ga0268265_100017688 58
122 3300028381 Ga0268264_10051195 Ga0268264_100511953 58
123 3300028381 Ga0268264_10766919 Ga0268264_107669192 58
124 3300031889 Ga0326468_10066566 Ga0326468_100665662 58
125 3300032126 Ga0307415_100011252 Ga0307415_1000112525 58
126 3300036647 Ga0316582_0351601 Ga0316582_0351601_663_845 58
127 3300041463 Ga0451804_0848689 Ga0451804_0848689_442_636 58
128 3300044694 Ga0466963_0253445 Ga0466963_0253445_521_700 58
129 3300044842 Ga0466957_0359629 Ga0466957_0359629_559_735 58
130 3300045976 Ga0466967_0000002 Ga0466967_0000002_27932_28108 58
131 3300046459 Ga0495629_0010954 Ga0495629_0010954_99_275 58
132 3300046459 Ga0495629_0043228 Ga0495629_0043228_710_892 58
133 3300046476 Ga0495662_0002052 Ga0495662_0002052_1588_1782 58
134 3300046507 Ga0495606_0000017 Ga0495606_0000017_53246_53422 58
135 3300046512 Ga0495610_0187494 Ga0495610_0187494_121_312 58
136 3300046512 Ga0495610_0354508 Ga0495610_0354508_211_387 58
137 3300046516 Ga0495628_0202912 Ga0495628_0202912_912_1088 58
138 3300046517 Ga0495630_0000032 Ga0495630_0000032_70776_70952 58
139 3300046674 Ga0495588_0000073 Ga0495588_0000073_177086_177262 58
140 3300046681 Ga0495647_0005861 Ga0495647_0005861_2794_2970 58
141 3300046683 Ga0495658_0000947 Ga0495658_0000947_15275_15454 58
142 3300046690 Ga0495624_0000691 Ga0495624_0000691_21011_21187 58
143 3300046809 Ga0495600_0037258 Ga0495600_0037258_857_1033 58
144 3300047317 Ga0495604_0000723 Ga0495604_0000723_25031_25207 58
145 3300047317 Ga0495604_0476347 Ga0495604_0476347_611_787 58
146 3300047321 Ga0495676_0034965 Ga0495676_0034965_3778_3960 58
147 3300047321 Ga0495676_0443245 Ga0495676_0443245_120_296 58
148 3300047673 Ga0495593_0328399 Ga0495593_0328399_203_382 58
149 3300048088 Ga0495602_0000034 Ga0495602_0000034_77309_77485 58
150 3300048911 Ga0496108_0039188 Ga0496108_0039188_582_758 58
151 3300048912 Ga0496109_0000221 Ga0496109_0000221_43597_43773 58
152 3300048913 Ga0496110_0691479 Ga0496110_0691479_285_473 58
153 3300048914 Ga0496111_0316592 Ga0496111_0316592_341_517 58
154 3300048914 Ga0496111_0380253 Ga0496111_0380253_531_707 58
155 3300048915 Ga0496112_0021401 Ga0496112_0021401_3984_4160 58
156 3300048916 Ga0496113_0000005 Ga0496113_0000005_92901_93077 58
157 3300048917 Ga0496114_1439883 Ga0496114_1439883_160_336 58
158 3300048917 Ga0496114_1664293 Ga0496114_1664293_120_296 58
159 3300049570 Ga0501033_1051291 Ga0501033_1051291_98_274 58
160 3300049586 Ga0501070_0018817 Ga0501070_0018817_3199_3393 58
161 3300050513 nmdc:mga0rr50_309764_c1 nmdc:mga0rr50_309764_c1_82_264 58
162 3300053077 Ga0495601_0000017 Ga0495601_0000017_6394_6570 58
163 3300053078 Ga0495612_0018670 Ga0495612_0018670_385_561 58
164 3300053084 Ga0495595_0007746 Ga0495595_0007746_702_878 58
165 3300053085 Ga0495619_0000088 Ga0495619_0000088_51702_51878 58
166 3300026075 Ga0207708_10043826 Ga0207708_100438262 60
167 3300046454 Ga0495592_0229444 Ga0495592_0229444_790_972 60
168 3300046536 Ga0495587_0270197 Ga0495587_0270197_97_303 61
169 3300048907 Ga0496104_0000010 Ga0496104_0000010_223174_223365 61
170 3300048908 Ga0496105_0000005 Ga0496105_0000005_223174_223365 61
171 3300048922 Ga0496119_0040734 Ga0496119_0040734_472_663 61
172 3300048923 Ga0496120_0061681 Ga0496120_0061681_1574_1765 61
173 3300053077 Ga0495601_0279542 Ga0495601_0279542_263_469 61
174 3300014969 Ga0157376_10044825 Ga0157376_100448254 62
175 3300046689 Ga0495613_0000027 Ga0495613_0000027_140263_140451 62
176 3300013297 Ga0157378_10183071 Ga0157378_101830712 66
177 3300005327 Ga0070658_10072858 Ga0070658_100728584 67
178 3300025909 Ga0207705_10079913 Ga0207705_100799131 67

Feature Viewer

pLDDT pTM Quality
73.71 0.44 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map