F270974

General Info

Members Datasets Scaffolds Average Seq Length
177 134 172 263

Family's Representative Sequence

Representative Sequence 3300049703|Ga0501219_000170|Ga0501219_000170_850_1812
Length 320
Sequence LQEDSSGIINHPLTLLLPLTQVRRLTQQANHPTFHSFIIPFSWLLLYFAGNLSMPIFTDQTGREVSIPSHPQRIISLVPSQTELLYDLGLEEQVVGITKFCVHPEKWFRSKARIGGTKNIKPDLIHQLQPDLIIANKEENVKEQVEALAANYPVWVSDIHDLETALDMIRRVGALTARVEQGNLLAGNIAEQFRKLNLQLPYHENMPVAYLIWRDPWMTIGQDTFIHDMLTRCGLTNVFGHTKRYPEITIDQLKASACKWLLLSSEPYPFKQQHIEELQQHLPGTKIVLVDGELFSWYGSRLQYAPSYFLSLFTSDISVI

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
3 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
4 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
5 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
6 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
7 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
8 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
9 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
10 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
41 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
53 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
95 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
96 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
97 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
98 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
99 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
100 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
101 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
102 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
103 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
104 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
105 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
106 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
107 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
108 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
109 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
110 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
111 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
112 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
113 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
114 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
115 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
116 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
117 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
118 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
119 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
120 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
123 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
124 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
125 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
126 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
127 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
128 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
129 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
130 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
131 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
132 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
133 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
134 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.18
Metatranscriptomes 0
Isolates 2.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.39
Nodule 0
Rhizoplane 0.56
Rhizosphere 89.27
Stem 0
Stem Tuber 0
Unclassified 6.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1663468 2162886007 Bacteria 272152
2 JGI24739J22299_10019245 3300001989 Bacteria 2447
3 JGI24739J22299_10038332 3300001989 Bacteria 1611
4 JGI24737J22298_10004011 3300001990 Bacteria 5151
5 JGI24735J21928_10000002 3300002067 Bacteria 624895
6 rootH1_10119413 3300003316 Bacteria 1103
7 rootH1_10129555 3300003316 Bacteria 2666
8 rootH2_10000149 3300003320 Bacteria 14845
9 rootH2_10079522 3300003320 Bacteria 5875
10 rootH2_10231895 3300003320 Bacteria 1314
11 rootL2_10059325 3300003322 Bacteria 1434
12 rootL2_10130937 3300003322 Bacteria 4078
13 rootL2_10342575 3300003322 Bacteria 1168
14 rootH1_10065146 3300003323 Bacteria 5961
15 Ga0065704_10070133 3300005289 Bacteria 1266035
16 Ga0065704_10072389 3300005289 Bacteria 8617
17 Ga0070676_10009134 3300005328 Bacteria 5363
18 Ga0070670_100062622 3300005331 Bacteria 3193
19 Ga0070670_100507398 3300005331 Bacteria 1073
20 Ga0068869_100008995 3300005334 Bacteria 6469
21 Ga0068868_100018210 3300005338 Bacteria 5247
22 Ga0070668_100034780 3300005347 Bacteria 3840
23 Ga0070669_100076672 3300005353 Bacteria 2482
24 Ga0070675_100093213 3300005354 Bacteria 2526
25 Ga0070671_100527162 3300005355 Bacteria 1017
26 Ga0070674_100032500 3300005356 Bacteria 3465
27 Ga0070674_100075386 3300005356 Unclassified 2396
28 Ga0070674_100101599 3300005356 Unclassified 2096
29 Ga0070673_100031990 3300005364 Bacteria 3955
30 Ga0070673_100115357 3300005364 Bacteria 2233
31 Ga0070688_100226859 3300005365 Bacteria 1319
32 Ga0070667_100546329 3300005367 Unclassified 1065
33 Ga0070678_100006148 3300005456 Bacteria 7013
34 Ga0070678_100506028 3300005456 Unclassified 1066
35 Ga0068867_100005040 3300005459 Bacteria 9320
36 Ga0068853_100037199 3300005539 Bacteria 4141
37 Ga0070672_100172837 3300005543 Bacteria 1797
38 Ga0070665_100012508 3300005548 Bacteria 8551
39 Ga0068855_100002853 3300005563 Bacteria 21245
40 Ga0068855_100019927 3300005563 Bacteria 8056
41 Ga0068854_100513396 3300005578 Unclassified 1011
42 Ga0068856_100009691 3300005614 Bacteria 9355
43 Ga0068852_100260305 3300005616 Bacteria 1666
44 Ga0068852_100447301 3300005616 Bacteria 1278
45 Ga0068859_100014583 3300005617 Bacteria 7894
46 Ga0068863_100038477 3300005841 Bacteria 4551
47 Ga0068863_100091549 3300005841 Bacteria 2884
48 Ga0068858_100286685 3300005842 Bacteria 1569
49 Ga0068860_100005552 3300005843 Bacteria 12767
50 Ga0068860_100363623 3300005843 Bacteria 1426
51 Ga0081540_1022137 3300005983 Bacteria 3757
52 Ga0075366_10023451 3300006195 Bacteria 3595
53 Ga0097621_100083891 3300006237 Unclassified 2655
54 Ga0068871_100179089 3300006358 Bacteria 1821
55 Ga0068865_100005344 3300006881 Bacteria 7779
56 Ga0068865_100613047 3300006881 Unclassified 921
57 Ga0097620_100014582 3300006931 Bacteria 7894
58 Ga0105240_10473788 3300009093 Bacteria 1397
59 Ga0105243_10280264 3300009148 Bacteria 1501
60 Ga0105242_10041681 3300009176 Bacteria 3704
61 Ga0105238_10064918 3300009551 Bacteria 3651
62 Ga0105238_10406429 3300009551 Bacteria 1355
63 Ga0105249_10051230 3300009553 Bacteria 3765
64 Ga0105239_10000010 3300010375 Bacteria 341545
65 Ga0105239_11029324 3300010375 Bacteria 947
66 Ga0105246_10037365 3300011119 Bacteria 3259
67 Ga0105246_10146991 3300011119 Bacteria 1780
68 Ga0157371_10019068 3300013102 Bacteria 5064
69 Ga0157371_10125314 3300013102 Bacteria 1827
70 Ga0157370_10428163 3300013104 Bacteria 1217
71 Ga0157369_10042376 3300013105 Bacteria 4966
72 Ga0157369_10067695 3300013105 Bacteria 3838
73 Ga0157374_10000001 3300013296 Bacteria 1077351
74 Ga0157374_10012628 3300013296 Bacteria 7354
75 Ga0157374_10839800 3300013296 Bacteria 935
76 Ga0157378_10027692 3300013297 Bacteria 4998
77 Ga0163162_10306402 3300013306 Bacteria 1720
78 Ga0163162_10717166 3300013306 Bacteria 1121
79 Ga0157372_10006159 3300013307 Bacteria 12752
80 Ga0157372_10013802 3300013307 Bacteria 8633
81 Ga0157372_10030568 3300013307 Bacteria 5892
82 Ga0157372_10108158 3300013307 Bacteria 3182
83 Ga0157375_10275239 3300013308 Bacteria 1846
84 Ga0157375_10316107 3300013308 Bacteria 1726
85 Ga0157380_10008215 3300014326 Bacteria 7438
86 Ga0157376_10004318 3300014969 Bacteria 9876
87 Ga0207697_10018029 3300025315 Bacteria 2898
88 Ga0207656_10025108 3300025321 Bacteria 2417
89 Ga0207645_10001750 3300025907 Bacteria 17617
90 Ga0207645_10053874 3300025907 Unclassified 2570
91 Ga0207643_10026904 3300025908 Bacteria 3188
92 Ga0207695_10316468 3300025913 Bacteria 1450
93 Ga0207671_10000036 3300025914 Bacteria 236133
94 Ga0207671_10004946 3300025914 Bacteria 12499
95 Ga0207660_10264299 3300025917 Bacteria 1362
96 Ga0207681_10051280 3300025923 Bacteria 2795
97 Ga0207681_10063102 3300025923 Bacteria 2554
98 Ga0207694_10285990 3300025924 Bacteria 1355
99 Ga0207694_10328337 3300025924 Bacteria 1263
100 Ga0207650_10493804 3300025925 Bacteria 1022
101 Ga0207686_10332789 3300025934 Bacteria 1138
102 Ga0207686_10360246 3300025934 Unclassified 1097
103 Ga0207709_10171281 3300025935 Unclassified 1524
104 Ga0207669_10052178 3300025937 Unclassified 2455
105 Ga0207669_10166316 3300025937 Bacteria 1564
106 Ga0207669_10294067 3300025937 Unclassified 1231
107 Ga0207691_10019498 3300025940 Bacteria 6417
108 Ga0207689_10010699 3300025942 Bacteria 7893
109 Ga0207667_10003555 3300025949 Bacteria 19273
110 Ga0207651_10217240 3300025960 Bacteria 1543
111 Ga0207712_10156191 3300025961 Bacteria 1767
112 Ga0207658_10036252 3300025986 Bacteria 3535
113 Ga0207677_10121129 3300026023 Bacteria 1968
114 Ga0207677_10264734 3300026023 Bacteria 1403
115 Ga0207703_10219025 3300026035 Bacteria 1701
116 Ga0207639_10106415 3300026041 Bacteria 2277
117 Ga0207702_10102531 3300026078 Bacteria 2529
118 Ga0207641_10010883 3300026088 Bacteria 7453
119 Ga0207641_10162554 3300026088 Bacteria 2031
120 Ga0207648_10010813 3300026089 Bacteria 8624
121 Ga0207674_10701016 3300026116 Unclassified 977
122 Ga0207675_100281410 3300026118 Bacteria 1616
123 Ga0207683_10024311 3300026121 Bacteria 5216
124 Ga0207698_10278049 3300026142 Bacteria 1547
125 Ga0207698_10976103 3300026142 Bacteria 857
126 Ga0268266_10043062 3300028379 Bacteria 3857
127 Ga0268264_10012858 3300028381 Bacteria 6887
128 Ga0268264_10084701 3300028381 Bacteria 2719
129 Ga0265327_10000022 3300031251 Bacteria 402724
130 Ga0265327_10008633 3300031251 Bacteria 7550
131 Ga0307408_100037748 3300031548 Bacteria 3404
132 Ga0307414_10405680 3300032004 Bacteria 1185
133 Ga0373939_0102845 3300035114 Bacteria 983
134 Ga0395900_0325222 3300037418 Unclassified 1517
135 Ga0395901_0021240 3300038443 Bacteria 6649
136 Ga0436365_1013745 3300039437 Bacteria 2079
137 Ga0439431_0003709 3300041997 Bacteria 3375
138 Ga0439445_0003121 3300042004 Bacteria 3715
139 Ga0439434_0066736 3300042435 Bacteria 1129
140 Ga0466972_0000020 3300044658 Bacteria 197336
141 Ga0495627_003278 3300046453 Bacteria 7244
142 Ga0495638_0256196 3300046460 Bacteria 962
143 Ga0495650_0000003 3300046471 Bacteria 900730
144 Ga0495580_0101670 3300046472 Bacteria 1999
145 Ga0495585_0000128 3300046492 Bacteria 82002
146 Ga0495583_0013641 3300046506 Bacteria 4521
147 Ga0495610_0001013 3300046512 Bacteria 25870
148 Ga0495616_0044945 3300046513 Bacteria 2238
149 Ga0495652_0397611 3300046529 Bacteria 976
150 Ga0495609_0040765 3300046538 Bacteria 2089
151 Ga0495633_0000103 3300046558 Bacteria 114769
152 Ga0495611_0142667 3300046648 Bacteria 1118
153 Ga0495625_0019964 3300046660 Bacteria 5183
154 Ga0495661_0002029 3300046665 Bacteria 15942
155 Ga0495661_0002463 3300046665 Bacteria 14245
156 Ga0495678_004235 3300049459 Bacteria 8416
157 Ga0501033_0491162 3300049570 Bacteria 850
158 Ga0501039_0335025 3300049575 Bacteria 1189
159 Ga0501217_003446 3300049661 Bacteria 3196
160 Ga0501256_001512 3300049685 Bacteria 1730
161 Ga0501219_000170 3300049703 Bacteria 12086
162 Ga0501241_014809 3300049758 Bacteria 1418
163 Ga0501264_000250 3300049761 Bacteria 8725
164 Ga0501270_012352 3300049767 Unclassified 1164
165 Ga0501044_0258837 3300049823 Bacteria 1679
166 Ga0501284_00021 3300050005 Bacteria 89729
167 nmdc:mga0k408_116440_c1 3300050493 Bacteria 1581
168 nmdc:mga0k408_317361_c1 3300050493 Unclassified 930
169 nmdc:mga05p37_3343_c1 3300050507 Bacteria 18701
170 Ga0500644_0126688 3300053088 Unclassified 1001
171 Ga0500646_0012483 3300053090 Unclassified 2193
172 Ga0500650_0034791 3300053098 Bacteria 2304

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009551 Ga0105238_10064918 Ga0105238_100649182 224
2 3300010375 Ga0105239_10000010 Ga0105239_10000010196 224
3 3300046460 Ga0495638_0256196 Ga0495638_0256196_33_749 238
4 3300046648 Ga0495611_0142667 Ga0495611_0142667_66_782 238
5 3300053090 Ga0500646_0012483 Ga0500646_0012483_1099_1878 254
6 3300025923 Ga0207681_10063102 Ga0207681_100631022 256
7 3300031251 Ga0265327_10000022 Ga0265327_10000022169 256
8 3300049575 Ga0501039_0335025 Ga0501039_0335025_222_1001 256
9 3300049823 Ga0501044_0258837 Ga0501044_0258837_888_1667 256
10 iso_pu_bacteria 2896109856 2896110706 256
11 3300003320 rootH2_10000149 rootH2_100001495 257
12 3300026088 Ga0207641_10162554 Ga0207641_101625542 257
13 3300003316 rootH1_10129555 rootH1_101295552 258
14 3300006195 Ga0075366_10023451 Ga0075366_100234515 258
15 3300041997 Ga0439431_0003709 Ga0439431_0003709_2417_3193 258
16 3300042004 Ga0439445_0003121 Ga0439445_0003121_49_825 258
17 3300046453 Ga0495627_003278 Ga0495627_003278_5307_6101 258
18 3300046558 Ga0495633_0000103 Ga0495633_0000103_30598_31392 258
19 3300050493 nmdc:mga0k408_116440_c1 nmdc:mga0k408_116440_c1_318_1094 258
20 iso_pu_bacteria 2599185184 2599478733 258
21 iso_pu_bacteria 2919437846 2919441169 258
22 iso_pu_bacteria 2928078545 2928080208 258
23 iso_pu_bacteria 2928147474 2928149621 258
24 3300003316 rootH1_10119413 rootH1_101194131 259
25 3300003323 rootH1_10065146 rootH1_100651465 259
26 3300005983 Ga0081540_1022137 Ga0081540_10221373 259
27 3300013296 Ga0157374_10000001 Ga0157374_10000001266 259
28 3300014969 Ga0157376_10004318 Ga0157376_100043187 259
29 3300035114 Ga0373939_0102845 Ga0373939_0102845_75_863 259
30 3300046471 Ga0495650_0000003 Ga0495650_0000003_6681_7460 259
31 3300046472 Ga0495580_0101670 Ga0495580_0101670_861_1658 259
32 3300046492 Ga0495585_0000128 Ga0495585_0000128_73753_74532 259
33 3300046506 Ga0495583_0013641 Ga0495583_0013641_3066_3845 259
34 3300046512 Ga0495610_0001013 Ga0495610_0001013_23143_23922 259
35 3300046529 Ga0495652_0397611 Ga0495652_0397611_96_875 259
36 3300046538 Ga0495609_0040765 Ga0495609_0040765_705_1484 259
37 3300046665 Ga0495661_0002463 Ga0495661_0002463_11401_12180 259
38 3300049570 Ga0501033_0491162 Ga0501033_0491162_55_834 259
39 3300053088 Ga0500644_0126688 Ga0500644_0126688_109_888 259
40 3300053098 Ga0500650_0034791 Ga0500650_0034791_18_797 259
41 3300003320 rootH2_10079522 rootH2_100795222 260
42 3300003322 rootL2_10130937 rootL2_101309373 260
43 3300003322 rootL2_10342575 rootL2_103425752 260
44 3300005289 Ga0065704_10072389 Ga0065704_100723898 260
45 3300009093 Ga0105240_10473788 Ga0105240_104737882 260
46 3300025321 Ga0207656_10025108 Ga0207656_100251082 260
47 3300025913 Ga0207695_10316468 Ga0207695_103164682 260
48 3300025914 Ga0207671_10004946 Ga0207671_1000494612 260
49 3300025924 Ga0207694_10328337 Ga0207694_103283372 260
50 3300046665 Ga0495661_0002029 Ga0495661_0002029_7621_8403 260
51 3300049761 Ga0501264_000250 Ga0501264_000250_1993_2775 260
52 3300050493 nmdc:mga0k408_317361_c1 nmdc:mga0k408_317361_c1_32_814 260
53 3300005331 Ga0070670_100062622 Ga0070670_1000626223 261
54 3300005331 Ga0070670_100507398 Ga0070670_1005073982 261
55 3300005338 Ga0068868_100018210 Ga0068868_1000182103 261
56 3300005355 Ga0070671_100527162 Ga0070671_1005271621 261
57 3300005364 Ga0070673_100115357 Ga0070673_1001153572 261
58 3300005367 Ga0070667_100546329 Ga0070667_1005463291 261
59 3300005456 Ga0070678_100506028 Ga0070678_1005060281 261
60 3300005841 Ga0068863_100038477 Ga0068863_1000384774 261
61 3300005841 Ga0068863_100091549 Ga0068863_1000915492 261
62 3300005843 Ga0068860_100005552 Ga0068860_1000055522 261
63 3300011119 Ga0105246_10146991 Ga0105246_101469912 261
64 3300013296 Ga0157374_10839800 Ga0157374_108398001 261
65 3300013297 Ga0157378_10027692 Ga0157378_100276924 261
66 3300013308 Ga0157375_10316107 Ga0157375_103161071 261
67 3300025914 Ga0207671_10000036 Ga0207671_10000036133 261
68 3300025925 Ga0207650_10493804 Ga0207650_104938041 261
69 3300025960 Ga0207651_10217240 Ga0207651_102172402 261
70 3300025986 Ga0207658_10036252 Ga0207658_100362522 261
71 3300026023 Ga0207677_10121129 Ga0207677_101211292 261
72 3300026088 Ga0207641_10010883 Ga0207641_100108832 261
73 3300028381 Ga0268264_10012858 Ga0268264_100128582 261
74 3300037418 Ga0395900_0325222 Ga0395900_0325222_286_1077 261
75 3300038443 Ga0395901_0021240 Ga0395901_0021240_553_1338 261
76 3300001989 JGI24739J22299_10019245 JGI24739J22299_100192451 262
77 3300001989 JGI24739J22299_10038332 JGI24739J22299_100383321 262
78 3300001990 JGI24737J22298_10004011 JGI24737J22298_100040112 262
79 3300002067 JGI24735J21928_10000002 JGI24735J21928_10000002202 262
80 3300003320 rootH2_10231895 rootH2_102318952 262
81 3300005356 Ga0070674_100075386 Ga0070674_1000753862 262
82 3300005356 Ga0070674_100101599 Ga0070674_1001015992 262
83 3300005459 Ga0068867_100005040 Ga0068867_1000050405 262
84 3300005563 Ga0068855_100002853 Ga0068855_10000285316 262
85 3300005563 Ga0068855_100019927 Ga0068855_1000199274 262
86 3300005578 Ga0068854_100513396 Ga0068854_1005133961 262
87 3300005616 Ga0068852_100260305 Ga0068852_1002603052 262
88 3300005842 Ga0068858_100286685 Ga0068858_1002866852 262
89 3300006881 Ga0068865_100613047 Ga0068865_1006130472 262
90 3300009148 Ga0105243_10280264 Ga0105243_102802642 262
91 3300009176 Ga0105242_10041681 Ga0105242_100416813 262
92 3300009551 Ga0105238_10406429 Ga0105238_104064292 262
93 3300010375 Ga0105239_11029324 Ga0105239_110293241 262
94 3300013102 Ga0157371_10019068 Ga0157371_100190683 262
95 3300013102 Ga0157371_10125314 Ga0157371_101253143 262
96 3300013104 Ga0157370_10428163 Ga0157370_104281632 262
97 3300013105 Ga0157369_10042376 Ga0157369_100423762 262
98 3300013105 Ga0157369_10067695 Ga0157369_100676953 262
99 3300013306 Ga0163162_10306402 Ga0163162_103064021 262
100 3300013307 Ga0157372_10006159 Ga0157372_1000615911 262
101 3300013307 Ga0157372_10030568 Ga0157372_100305682 262
102 3300014326 Ga0157380_10008215 Ga0157380_100082156 262
103 3300025907 Ga0207645_10053874 Ga0207645_100538742 262
104 3300025917 Ga0207660_10264299 Ga0207660_102642992 262
105 3300025924 Ga0207694_10285990 Ga0207694_102859902 262
106 3300025934 Ga0207686_10360246 Ga0207686_103602461 262
107 3300025935 Ga0207709_10171281 Ga0207709_101712812 262
108 3300025937 Ga0207669_10052178 Ga0207669_100521782 262
109 3300025937 Ga0207669_10294067 Ga0207669_102940671 262
110 3300025949 Ga0207667_10003555 Ga0207667_100035554 262
111 3300026035 Ga0207703_10219025 Ga0207703_102190252 262
112 3300026089 Ga0207648_10010813 Ga0207648_100108132 262
113 3300026142 Ga0207698_10278049 Ga0207698_102780491 262
114 3300044658 Ga0466972_0000020 Ga0466972_0000020_130322_131113 262
115 3300046513 Ga0495616_0044945 Ga0495616_0044945_1385_2173 262
116 3300049459 Ga0495678_004235 Ga0495678_004235_6019_6807 262
117 3300005614 Ga0068856_100009691 Ga0068856_1000096916 263
118 3300009553 Ga0105249_10051230 Ga0105249_100512303 263
119 3300025961 Ga0207712_10156191 Ga0207712_101561912 263
120 3300026078 Ga0207702_10102531 Ga0207702_101025312 263
121 3300031251 Ga0265327_10008633 Ga0265327_100086336 263
122 3300031548 Ga0307408_100037748 Ga0307408_1000377482 263
123 3300032004 Ga0307414_10405680 Ga0307414_104056801 263
124 3300046660 Ga0495625_0019964 Ga0495625_0019964_2119_2940 263
125 3300049661 Ga0501217_003446 Ga0501217_003446_201_1028 263
126 3300005289 Ga0065704_10070133 Ga0065704_10070133925 264
127 3300005328 Ga0070676_10009134 Ga0070676_100091343 264
128 3300005334 Ga0068869_100008995 Ga0068869_1000089953 264
129 3300005347 Ga0070668_100034780 Ga0070668_1000347803 264
130 3300005353 Ga0070669_100076672 Ga0070669_1000766723 264
131 3300005354 Ga0070675_100093213 Ga0070675_1000932132 264
132 3300005356 Ga0070674_100032500 Ga0070674_1000325003 264
133 3300005364 Ga0070673_100031990 Ga0070673_1000319904 264
134 3300005365 Ga0070688_100226859 Ga0070688_1002268593 264
135 3300005456 Ga0070678_100006148 Ga0070678_1000061482 264
136 3300005539 Ga0068853_100037199 Ga0068853_1000371994 264
137 3300005543 Ga0070672_100172837 Ga0070672_1001728372 264
138 3300005548 Ga0070665_100012508 Ga0070665_1000125088 264
139 3300005616 Ga0068852_100447301 Ga0068852_1004473012 264
140 3300005617 Ga0068859_100014583 Ga0068859_1000145837 264
141 3300005843 Ga0068860_100363623 Ga0068860_1003636231 264
142 3300006237 Ga0097621_100083891 Ga0097621_1000838912 264
143 3300006358 Ga0068871_100179089 Ga0068871_1001790892 264
144 3300006881 Ga0068865_100005344 Ga0068865_1000053447 264
145 3300006931 Ga0097620_100014582 Ga0097620_1000145827 264
146 3300011119 Ga0105246_10037365 Ga0105246_100373653 264
147 3300013296 Ga0157374_10012628 Ga0157374_100126286 264
148 3300013306 Ga0163162_10717166 Ga0163162_107171661 264
149 3300013307 Ga0157372_10013802 Ga0157372_100138023 264
150 3300013307 Ga0157372_10108158 Ga0157372_101081583 264
151 3300013308 Ga0157375_10275239 Ga0157375_102752391 264
152 3300025315 Ga0207697_10018029 Ga0207697_100180292 264
153 3300025907 Ga0207645_10001750 Ga0207645_100017506 264
154 3300025908 Ga0207643_10026904 Ga0207643_100269042 264
155 3300025923 Ga0207681_10051280 Ga0207681_100512802 264
156 3300025934 Ga0207686_10332789 Ga0207686_103327892 264
157 3300025937 Ga0207669_10166316 Ga0207669_101663161 264
158 3300025940 Ga0207691_10019498 Ga0207691_100194982 264
159 3300025942 Ga0207689_10010699 Ga0207689_100106993 264
160 3300026023 Ga0207677_10264734 Ga0207677_102647341 264
161 3300026041 Ga0207639_10106415 Ga0207639_101064151 264
162 3300026116 Ga0207674_10701016 Ga0207674_107010161 264
163 3300026118 Ga0207675_100281410 Ga0207675_1002814102 264
164 3300026121 Ga0207683_10024311 Ga0207683_100243113 264
165 3300026142 Ga0207698_10976103 Ga0207698_109761031 264
166 3300028379 Ga0268266_10043062 Ga0268266_100430623 264
167 3300028381 Ga0268264_10084701 Ga0268264_100847011 264
168 3300039437 Ga0436365_1013745 Ga0436365_1013745_574_1377 264
169 3300042435 Ga0439434_0066736 Ga0439434_0066736_34_849 264
170 3300049685 Ga0501256_001512 Ga0501256_001512_899_1699 264
171 3300049767 Ga0501270_012352 Ga0501270_012352_255_1055 264
172 3300050507 nmdc:mga05p37_3343_c1 nmdc:mga05p37_3343_c1_53_868 264
173 2162886007 SwRhRL2b_contig_1663468 SwRhRL2b_0819.00002010 265
174 3300003322 rootL2_10059325 rootL2_100593252 265
175 3300049703 Ga0501219_000170 Ga0501219_000170_850_1812 265
176 3300049758 Ga0501241_014809 Ga0501241_014809_184_1146 265
177 3300050005 Ga0501284_00021 Ga0501284_00021_80846_81808 265

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01497

Peripla_BP_2

Periplasmic binding protein

74

286

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5lwh-assembly1.cif.gz_A ceue (y288f variant) a periplasmic protein from campylobacter jejuni. 0.8732 1 259
3md9-assembly2.cif.gz_B structure of apo form of a periplasmic heme binding protein 0.8658 20 260
5mbu-assembly1.cif.gz_A ceue (h227a, y288f variant) a periplasmic protein from campylobacter jejuni 0.8654 1 259
2rg7-assembly1.cif.gz_C apo- crystal structure of a periplasmic heme binding protein from shigella dysenteriae 0.8631 20 261
4fi3-assembly1.cif.gz_F structure of vitamin b12 transporter btucd-f in a nucleotide-bound state 0.8623 19 259
ID Description Score Start End Superfamily
2r79A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.9144 19 134 3.40.50.1980
af_Q2G0F6_19_140_3.40.50.1980 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.9028 20 135 3.40.50.1980
3pshA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.8979 3 135 3.40.50.1980
3gfvB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.897 1 146 3.40.50.1980
2rg7D01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.8946 20 135 3.40.50.1980
ID Description Score Start End GO Terms
AF-A0A3C1ZZL0-F1-model_v4 Cobalamin-binding protein 0.995 1 135
AF-A0A3C0IQU3-F1-model_v4 Cobalamin-binding protein 0.9941 21 131
AF-A0A7Y7CIA5-F1-model_v4 ABC transporter substrate-binding protein 0.994 2 121
AF-A0A519MHR4-F1-model_v4 Cobalamin-binding protein 0.9909 1 149
AF-A0A520CHY8-F1-model_v4 Cobalamin-binding protein 0.9866 1 144

Feature Viewer

pLDDT pTM Quality
94.48 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map