F270706

General Info

Members Datasets Scaffolds Average Seq Length
177 41 354 162

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0674318|Ga0451576_0674318_336_821
Length 149
Sequence MDKSVTNVVIAGLGGQGVVKASDILADAAFRAGLDVKKSELHGMSQRGGSVYSDVRFGPKVFSPMVPPGAADYVVLLEPDQLEPNRHLLDGVKLPNRKSLNVALLGILSAQLAIAEEHWLAALRANLPEKIFEVNRQAFELGREQKKTS

Samples

Sample ID Description Type Environment
1 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
2 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
3 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
4 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
5 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
6 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
7 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
8 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
9 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
10 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
11 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
12 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
13 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
14 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
15 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
16 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
17 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
18 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
19 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
20 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
21 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
22 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
23 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
24 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
25 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
26 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
27 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
28 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
29 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
30 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
31 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
32 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
33 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
34 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
35 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
36 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
37 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
38 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
39 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
40 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
41 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.69
Rhizosphere 97.74
Stem 0
Stem Tuber 0
Unclassified 3.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451576_0674318 3300045051 Bacteria 1086
2 Ga0207711_10415970 3300025941 Bacteria 1250
3 Ga0265337_1006376 3300028556 Bacteria 4561
4 Ga0265337_1026799 3300028556 Bacteria 1742
5 Ga0265337_1135609 3300028556 Unclassified 667
6 Ga0265326_10016540 3300028558 Bacteria 2131
7 Ga0265326_10134179 3300028558 Bacteria 706
8 Ga0265334_10007864 3300028573 Bacteria 4560
9 Ga0265334_10011321 3300028573 Bacteria 3758
10 Ga0265334_10025665 3300028573 Bacteria 2384
11 Ga0265334_10123074 3300028573 Bacteria 926
12 Ga0265334_10151174 3300028573 Unclassified 819
13 Ga0265323_10003936 3300028653 Bacteria 6454
14 Ga0265323_10004344 3300028653 Bacteria 6112
15 Ga0265323_10006169 3300028653 Bacteria 5053
16 Ga0265323_10018967 3300028653 Bacteria 2657
17 Ga0265322_10004838 3300028654 Bacteria 3993
18 Ga0265322_10022229 3300028654 Bacteria 1815
19 Ga0265336_10001561 3300028666 Bacteria 10277
20 Ga0265338_10000032 3300028800 Bacteria 257580
21 Ga0265338_10003609 3300028800 Bacteria 21602
22 Ga0265338_10003749 3300028800 Bacteria 21110
23 Ga0265338_10005273 3300028800 Bacteria 16930
24 Ga0265338_10014820 3300028800 Bacteria 8627
25 Ga0265338_10046939 3300028800 Bacteria 3951
26 Ga0265338_10048562 3300028800 Bacteria 3859
27 Ga0265338_10083887 3300028800 Bacteria 2663
28 Ga0265338_10091135 3300028800 Bacteria 2520
29 Ga0265338_10095359 3300028800 Bacteria 2444
30 Ga0265338_10147587 3300028800 Bacteria 1832
31 Ga0265338_10165925 3300028800 Bacteria 1700
32 Ga0265338_10242922 3300028800 Bacteria 1333
33 Ga0265338_10272405 3300028800 Bacteria 1240
34 Ga0265324_10001195 3300029957 Bacteria 15451
35 Ga0265324_10007474 3300029957 Bacteria 4420
36 Ga0265324_10015619 3300029957 Bacteria 2789
37 Ga0265324_10015833 3300029957 Bacteria 2767
38 Ga0265324_10028784 3300029957 Bacteria 1957
39 Ga0265330_10002931 3300031235 Bacteria 9096
40 Ga0265330_10003356 3300031235 Bacteria 8394
41 Ga0265330_10024495 3300031235 Bacteria 2737
42 Ga0265330_10025443 3300031235 Bacteria 2682
43 Ga0265330_10040891 3300031235 Bacteria 2057
44 Ga0265330_10124909 3300031235 Bacteria 1096
45 Ga0265332_10071407 3300031238 Bacteria 1478
46 Ga0265332_10127142 3300031238 Bacteria 1070
47 Ga0265328_10012620 3300031239 Bacteria 3360
48 Ga0265328_10256817 3300031239 Bacteria 670
49 Ga0265320_10054509 3300031240 Bacteria 1929
50 Ga0265320_10110995 3300031240 Bacteria 1256
51 Ga0265320_10139175 3300031240 Bacteria 1100
52 Ga0265320_10144955 3300031240 Bacteria 1074
53 Ga0265325_10086075 3300031241 Bacteria 1556
54 Ga0265329_10000673 3300031242 Bacteria 17501
55 Ga0265329_10001379 3300031242 Bacteria 11784
56 Ga0265329_10062723 3300031242 Unclassified 1176
57 Ga0265340_10039262 3300031247 Bacteria 2337
58 Ga0265340_10049691 3300031247 Bacteria 2036
59 Ga0265340_10112713 3300031247 Bacteria 1256
60 Ga0265340_10365788 3300031247 Bacteria 637
61 Ga0265339_10005884 3300031249 Bacteria 8125
62 Ga0265331_10185488 3300031250 Bacteria 939
63 Ga0265327_10009005 3300031251 Bacteria 7305
64 Ga0265327_10015753 3300031251 Bacteria 4855
65 Ga0265327_10091142 3300031251 Bacteria 1486
66 Ga0265316_10000303 3300031344 Bacteria 55245
67 Ga0265316_10001563 3300031344 Bacteria 24530
68 Ga0265316_10005646 3300031344 Bacteria 12110
69 Ga0265316_10019840 3300031344 Bacteria 5739
70 Ga0265316_10026385 3300031344 Bacteria 4833
71 Ga0265316_10063593 3300031344 Bacteria 2861
72 Ga0265316_10089503 3300031344 Bacteria 2349
73 Ga0265316_10106864 3300031344 Bacteria 2122
74 Ga0265316_10111858 3300031344 Bacteria 2068
75 Ga0265316_10152039 3300031344 Bacteria 1733
76 Ga0265316_10167982 3300031344 Bacteria 1638
77 Ga0265316_10170957 3300031344 Bacteria 1621
78 Ga0265316_10211418 3300031344 Bacteria 1434
79 Ga0265316_10492064 3300031344 Bacteria 877
80 Ga0265316_10817706 3300031344 Unclassified 653
81 Ga0307508_10628998 3300031616 Bacteria 677
82 Ga0316575_10286270 3300031665 Bacteria 695
83 Ga0265314_10000206 3300031711 Bacteria 87046
84 Ga0265314_10199248 3300031711 Bacteria 1185
85 Ga0265314_10222217 3300031711 Bacteria 1101
86 Ga0265314_10350361 3300031711 Bacteria 813
87 Ga0265342_10002031 3300031712 Bacteria 17997
88 Ga0265342_10002717 3300031712 Bacteria 15061
89 Ga0265342_10039570 3300031712 Bacteria 2864
90 Ga0265342_10040485 3300031712 Bacteria 2825
91 Ga0265342_10120407 3300031712 Bacteria 1478
92 Ga0265342_10120866 3300031712 Bacteria 1475
93 Ga0451577_0031275 3300042876 Bacteria 4803
94 Ga0451577_0038354 3300042876 Bacteria 4310
95 Ga0451577_0049639 3300042876 Bacteria 3746
96 Ga0451577_0068593 3300042876 Bacteria 3162
97 Ga0451577_0110497 3300042876 Bacteria 2459
98 Ga0451577_0127008 3300042876 Bacteria 2285
99 Ga0451577_0158101 3300042876 Bacteria 2040
100 Ga0451577_0165862 3300042876 Bacteria 1990
101 Ga0451577_0174874 3300042876 Unclassified 1935
102 Ga0451577_0265714 3300042876 Bacteria 1553
103 Ga0451577_0283235 3300042876 Unclassified 1502
104 Ga0451577_0299737 3300042876 Bacteria 1456
105 Ga0451577_0338033 3300042876 Bacteria 1366
106 Ga0451577_0384425 3300042876 Bacteria 1274
107 Ga0451577_0581525 3300042876 Bacteria 1016
108 Ga0451577_0785426 3300042876 Bacteria 860
109 Ga0451577_0939319 3300042876 Bacteria 778
110 Ga0451577_1067979 3300042876 Bacteria 723
111 Ga0451577_1638124 3300042876 Bacteria 567
112 Ga0453683_0000391 3300044673 Bacteria 52370
113 Ga0453683_0003480 3300044673 Bacteria 11587
114 Ga0453683_0022600 3300044673 Bacteria 4011
115 Ga0453683_0098413 3300044673 Bacteria 1836
116 Ga0453683_0156483 3300044673 Bacteria 1441
117 Ga0453684_0000099 3300044712 Bacteria 375208
118 Ga0453684_0001316 3300044712 Bacteria 73394
119 Ga0453684_0002298 3300044712 Bacteria 46989
120 Ga0453684_0002753 3300044712 Bacteria 41641
121 Ga0453684_0002805 3300044712 Bacteria 41191
122 Ga0453684_0013646 3300044712 Bacteria 13162
123 Ga0453684_0015876 3300044712 Bacteria 11840
124 Ga0453684_0022703 3300044712 Bacteria 9297
125 Ga0453684_0033132 3300044712 Bacteria 7208
126 Ga0453684_0046414 3300044712 Bacteria 5777
127 Ga0453684_0052939 3300044712 Bacteria 5302
128 Ga0453684_0086678 3300044712 Bacteria 3884
129 Ga0453684_0087145 3300044712 Bacteria 3870
130 Ga0453684_0091306 3300044712 Bacteria 3759
131 Ga0453684_0125755 3300044712 Bacteria 3086
132 Ga0453684_0143406 3300044712 Bacteria 2848
133 Ga0453684_0159501 3300044712 Bacteria 2670
134 Ga0453684_0378495 3300044712 Bacteria 1590
135 Ga0453684_0402855 3300044712 Bacteria 1532
136 Ga0453684_0471915 3300044712 Bacteria 1393
137 Ga0453684_0475361 3300044712 Bacteria 1387
138 Ga0453684_0485838 3300044712 Bacteria 1369
139 Ga0453684_0505209 3300044712 Bacteria 1338
140 Ga0453684_0565026 3300044712 Bacteria 1251
141 Ga0453684_0605344 3300044712 Bacteria 1200
142 Ga0453684_1001975 3300044712 Bacteria 888
143 Ga0453684_1578029 3300044712 Bacteria 674
144 Ga0453684_1581625 3300044712 Bacteria 673
145 Ga0453684_1890576 3300044712 Bacteria 604
146 Ga0451576_0003445 3300045051 Bacteria 21712
147 Ga0451576_0022666 3300045051 Bacteria 6804
148 Ga0451576_0099613 3300045051 Bacteria 3023
149 Ga0451576_0111291 3300045051 Bacteria 2849
150 Ga0451576_0117003 3300045051 Bacteria 2775
151 Ga0451576_0130379 3300045051 Bacteria 2620
152 Ga0451576_0166442 3300045051 Bacteria 2301
153 Ga0451576_0235898 3300045051 Bacteria 1910
154 Ga0451576_0321029 3300045051 Bacteria 1620
155 Ga0451576_0335042 3300045051 Bacteria 1584
156 Ga0451576_0341273 3300045051 Bacteria 1568
157 Ga0451576_0387558 3300045051 Bacteria 1465
158 Ga0451576_0421570 3300045051 Bacteria 1400
159 Ga0451576_0533182 3300045051 Bacteria 1233
160 Ga0451576_0538207 3300045051 Bacteria 1227
161 Ga0451576_1010272 3300045051 Bacteria 872
162 Ga0451576_1567834 3300045051 Bacteria 683
163 Ga0496104_0170175 3300048907 Bacteria 2089
164 Ga0496108_1015548 3300048911 Bacteria 708
165 Ga0496111_0381834 3300048914 Bacteria 1042
166 Ga0501040_0222233 3300049576 Bacteria 1344
167 Ga0501042_0408871 3300049578 Bacteria 983
168 Ga0501046_0218297 3300049580 Bacteria 1413
169 Ga0501075_0173791 3300049591 Bacteria 1644
170 Ga0501035_0743209 3300049822 Bacteria 788
171 Ga0501045_0047283 3300049824 Bacteria 3134
172 nmdc:mga06r32_1537867_c1 3300050510 Bacteria 605
173 nmdc:mga06r32_1658224_c1 3300050510 Bacteria 577
174 Ga0501084_0140708 3300054114 Bacteria 2032
175 Ga0501082_0523360 3300060353 Bacteria 1037
176 Ga0530510_0057458 3300061734 Bacteria 2811
177 Ga0530510_0653554 3300061734 Bacteria 801
178 Ga0451576_0674318
179 Ga0207711_10415970
180 Ga0265337_1006376
181 Ga0265337_1026799
182 Ga0265337_1135609
183 Ga0265326_10016540
184 Ga0265326_10134179
185 Ga0265334_10007864
186 Ga0265334_10011321
187 Ga0265334_10025665
188 Ga0265334_10123074
189 Ga0265334_10151174
190 Ga0265323_10003936
191 Ga0265323_10004344
192 Ga0265323_10006169
193 Ga0265323_10018967
194 Ga0265322_10004838
195 Ga0265322_10022229
196 Ga0265336_10001561
197 Ga0265338_10000032
198 Ga0265338_10003609
199 Ga0265338_10003749
200 Ga0265338_10005273
201 Ga0265338_10014820
202 Ga0265338_10046939
203 Ga0265338_10048562
204 Ga0265338_10083887
205 Ga0265338_10091135
206 Ga0265338_10095359
207 Ga0265338_10147587
208 Ga0265338_10165925
209 Ga0265338_10242922
210 Ga0265338_10272405
211 Ga0265324_10001195
212 Ga0265324_10007474
213 Ga0265324_10015619
214 Ga0265324_10015833
215 Ga0265324_10028784
216 Ga0265330_10002931
217 Ga0265330_10003356
218 Ga0265330_10024495
219 Ga0265330_10025443
220 Ga0265330_10040891
221 Ga0265330_10124909
222 Ga0265332_10071407
223 Ga0265332_10127142
224 Ga0265328_10012620
225 Ga0265328_10256817
226 Ga0265320_10054509
227 Ga0265320_10110995
228 Ga0265320_10139175
229 Ga0265320_10144955
230 Ga0265325_10086075
231 Ga0265329_10000673
232 Ga0265329_10001379
233 Ga0265329_10062723
234 Ga0265340_10039262
235 Ga0265340_10049691
236 Ga0265340_10112713
237 Ga0265340_10365788
238 Ga0265339_10005884
239 Ga0265331_10185488
240 Ga0265327_10009005
241 Ga0265327_10015753
242 Ga0265327_10091142
243 Ga0265316_10000303
244 Ga0265316_10001563
245 Ga0265316_10005646
246 Ga0265316_10019840
247 Ga0265316_10026385
248 Ga0265316_10063593
249 Ga0265316_10089503
250 Ga0265316_10106864
251 Ga0265316_10111858
252 Ga0265316_10152039
253 Ga0265316_10167982
254 Ga0265316_10170957
255 Ga0265316_10211418
256 Ga0265316_10492064
257 Ga0265316_10817706
258 Ga0307508_10628998
259 Ga0316575_10286270
260 Ga0265314_10000206
261 Ga0265314_10199248
262 Ga0265314_10222217
263 Ga0265314_10350361
264 Ga0265342_10002031
265 Ga0265342_10002717
266 Ga0265342_10039570
267 Ga0265342_10040485
268 Ga0265342_10120407
269 Ga0265342_10120866
270 Ga0451577_0031275
271 Ga0451577_0038354
272 Ga0451577_0049639
273 Ga0451577_0068593
274 Ga0451577_0110497
275 Ga0451577_0127008
276 Ga0451577_0158101
277 Ga0451577_0165862
278 Ga0451577_0174874
279 Ga0451577_0265714
280 Ga0451577_0283235
281 Ga0451577_0299737
282 Ga0451577_0338033
283 Ga0451577_0384425
284 Ga0451577_0581525
285 Ga0451577_0785426
286 Ga0451577_0939319
287 Ga0451577_1067979
288 Ga0451577_1638124
289 Ga0453683_0000391
290 Ga0453683_0003480
291 Ga0453683_0022600
292 Ga0453683_0098413
293 Ga0453683_0156483
294 Ga0453684_0000099
295 Ga0453684_0001316
296 Ga0453684_0002298
297 Ga0453684_0002753
298 Ga0453684_0002805
299 Ga0453684_0013646
300 Ga0453684_0015876
301 Ga0453684_0022703
302 Ga0453684_0033132
303 Ga0453684_0046414
304 Ga0453684_0052939
305 Ga0453684_0086678
306 Ga0453684_0087145
307 Ga0453684_0091306
308 Ga0453684_0125755
309 Ga0453684_0143406
310 Ga0453684_0159501
311 Ga0453684_0378495
312 Ga0453684_0402855
313 Ga0453684_0471915
314 Ga0453684_0475361
315 Ga0453684_0485838
316 Ga0453684_0505209
317 Ga0453684_0565026
318 Ga0453684_0605344
319 Ga0453684_1001975
320 Ga0453684_1578029
321 Ga0453684_1581625
322 Ga0453684_1890576
323 Ga0451576_0003445
324 Ga0451576_0022666
325 Ga0451576_0099613
326 Ga0451576_0111291
327 Ga0451576_0117003
328 Ga0451576_0130379
329 Ga0451576_0166442
330 Ga0451576_0235898
331 Ga0451576_0321029
332 Ga0451576_0335042
333 Ga0451576_0341273
334 Ga0451576_0387558
335 Ga0451576_0421570
336 Ga0451576_0533182
337 Ga0451576_0538207
338 Ga0451576_1010272
339 Ga0451576_1567834
340 Ga0496104_0170175
341 Ga0496108_1015548
342 Ga0496111_0381834
343 Ga0501040_0222233
344 Ga0501042_0408871
345 Ga0501046_0218297
346 Ga0501075_0173791
347 Ga0501035_0743209
348 Ga0501045_0047283
349 nmdc:mga06r32_1537867_c1
350 nmdc:mga06r32_1658224_c1
351 Ga0501084_0140708
352 Ga0501082_0523360
353 Ga0530510_0057458
354 Ga0530510_0653554

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01558

POR

Pyruvate ferredoxin/flavodoxin oxidoreductase

91

144

0.93

PF01558

POR

Pyruvate ferredoxin/flavodoxin oxidoreductase

14

93

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3g2e-assembly1.cif.gz_D structure of putative oorc subunit of 2-oxoglutarate:acceptor oxidoreductase from campylobacter jejuni 0.8658 4 156
6n2o-assembly1.cif.gz_C 2-oxoglutarate:ferredoxin oxidoreductase from magnetococcus marinus with 2-oxoglutarate, coenzyme a and succinyl-coa bound 0.8534 4 155
3g2e-assembly1.cif.gz_C structure of putative oorc subunit of 2-oxoglutarate:acceptor oxidoreductase from campylobacter jejuni 0.8484 4 156
3on3-assembly2.cif.gz_A the crystal structure of keto/oxoacid ferredoxin oxidoreductase, gamma subunit from geobacter sulfurreducens pca 0.8385 6 154
3g2e-assembly1.cif.gz_A structure of putative oorc subunit of 2-oxoglutarate:acceptor oxidoreductase from campylobacter jejuni 0.8276 14 157
ID Description Score Start End Superfamily
3g2eC00 Alpha Beta;3-Layer(aba) Sandwich;Pyruvate-ferredoxin Oxidoreductase; domain 3;Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.8484 4 156 3.40.920.10
af_Q2FZ05_1_182_3.40.920.10 Alpha Beta;3-Layer(aba) Sandwich;Pyruvate-ferredoxin Oxidoreductase; domain 3;Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.8344 1 157 3.40.920.10
af_Q57717_1_177_3.40.920.10 Alpha Beta;3-Layer(aba) Sandwich;Pyruvate-ferredoxin Oxidoreductase; domain 3;Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.8107 6 154 3.40.920.10
3on3A00 Alpha Beta;3-Layer(aba) Sandwich;Pyruvate-ferredoxin Oxidoreductase; domain 3;Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.8079 6 157 3.40.920.10
af_Q2FZ05_1_182_3.40.920.10 Alpha Beta;3-Layer(aba) Sandwich;Pyruvate-ferredoxin Oxidoreductase; domain 3;Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.7927 1 157 3.40.920.10
ID Description Score Start End GO Terms
AF-A0A7C4C397-F1-model_v4 Pyruvate ferredoxin oxidoreductase 0.98 33 156 GO:0016903
AF-A0A660QTP4-F1-model_v4 Pyruvate ferredoxin oxidoreductase 0.9699 4 155 GO:0016903
AF-A0A1N6IIG9-F1-model_v4 Indolepyruvate ferredoxin oxidoreductase beta subunit 0.9645 4 157 GO:0016903
AF-A0A7C4C397-F1-model_v4 Pyruvate ferredoxin oxidoreductase 0.9572 33 156 GO:0016903
AF-A0A1M6EQR6-F1-model_v4 Indolepyruvate ferredoxin oxidoreductase beta subunit 0.9489 1 157 GO:0016903

Map