F270654

General Info

Members Datasets Scaffolds Average Seq Length
177 117 354 279

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0254271|Ga0451577_0254271_559_1527
Length 322
Sequence MARFMGGILAWAALDRPRARCQSDRLTRNEEIALSSQTVRPVRRIAVVGAGVMGRGIALVSALAGFETCAIETNAAAAESARGELEKILARGREKGEWDDAALSKARGGLAWSQSLDGANGADLVIEAVPENIALKAEIYRGVAPHLAPTAVIATNTSSLSITELAATSDRPDRFVGMHFFNPVHRMRLIELVRGLETSDPALAAVDAVSRAMGKETVLVRESPGFVTSRVNVLIGNEAFHMLESGVASARDIDKALKLGLNHPMGPFELVDLVGLDTRLSILEYLHRALGERFRPNPLLIQYVKAGRLGRKVGRGIYEYSR

Samples

Sample ID Description Type Environment
1 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
32 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
42 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
47 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
65 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
68 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
69 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
70 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
71 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
72 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
73 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
74 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
75 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
76 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
77 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
78 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
79 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
80 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
81 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
82 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
83 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
84 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
85 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
86 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
87 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
88 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
89 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
90 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
91 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
92 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
93 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
94 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
95 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
96 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
97 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
101 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
102 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
103 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
104 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
105 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
106 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
107 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
108 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
109 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
110 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
111 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
112 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
113 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
114 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
115 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
116 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
117 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.13
Nodule 0
Rhizoplane 1.69
Rhizosphere 97.18
Stem 0
Stem Tuber 0
Unclassified 2.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451577_0254271 3300042876 Bacteria 1590
2 JGI24751J29686_10018565 3300002459 Bacteria 1439
3 JGI25406J46586_10001787 3300003203 Bacteria 10106
4 Ga0065712_10022755 3300005290 Bacteria 1097
5 Ga0065712_10127089 3300005290 Bacteria 1594
6 Ga0065712_10147285 3300005290 Bacteria 1398
7 Ga0065715_10032738 3300005293 Bacteria 1635
8 Ga0070670_100070176 3300005331 Bacteria 3008
9 Ga0070670_100228424 3300005331 Bacteria 1619
10 Ga0068869_100544056 3300005334 Bacteria 975
11 Ga0068868_100466581 3300005338 Bacteria 1101
12 Ga0070689_100023625 3300005340 Bacteria 4604
13 Ga0070669_100372295 3300005353 Bacteria 1164
14 Ga0070711_100047191 3300005439 Bacteria 2939
15 Ga0070705_100007667 3300005440 Bacteria 5323
16 Ga0070705_100152265 3300005440 Bacteria 1536
17 Ga0070705_100286948 3300005440 Bacteria 1173
18 Ga0070694_100074181 3300005444 Bacteria 2351
19 Ga0070681_10115500 3300005458 Bacteria 2622
20 Ga0070681_10397030 3300005458 Bacteria 1290
21 Ga0070685_10029774 3300005466 Bacteria 3036
22 Ga0070685_10330500 3300005466 Bacteria 1036
23 Ga0070706_100041134 3300005467 Bacteria 4267
24 Ga0070707_100000327 3300005468 Bacteria 46790
25 Ga0070707_100000776 3300005468 Bacteria 31562
26 Ga0070707_100023422 3300005468 Bacteria 5842
27 Ga0070707_100130293 3300005468 Bacteria 2446
28 Ga0070707_100184875 3300005468 Bacteria 2032
29 Ga0070707_100308449 3300005468 Bacteria 1538
30 Ga0070698_100022290 3300005471 Bacteria 6627
31 Ga0070698_100234537 3300005471 Bacteria 1768
32 Ga0070699_100027624 3300005518 Bacteria 4893
33 Ga0070697_100081799 3300005536 Bacteria 2661
34 Ga0070697_100500905 3300005536 Unclassified 1062
35 Ga0070695_100188516 3300005545 Bacteria 1466
36 Ga0070695_100199931 3300005545 Bacteria 1428
37 Ga0070696_100000335 3300005546 Bacteria 28508
38 Ga0070696_100073910 3300005546 Bacteria 2403
39 Ga0070696_100141509 3300005546 Bacteria 1759
40 Ga0070665_100000192 3300005548 Bacteria 108722
41 Ga0070704_100283966 3300005549 Unclassified 1373
42 Ga0070702_100041578 3300005615 Bacteria 2579
43 Ga0068859_100262501 3300005617 Bacteria 1818
44 Ga0068864_100371108 3300005618 Bacteria 1354
45 Ga0068866_10364643 3300005718 Bacteria 922
46 Ga0068858_100145764 3300005842 Bacteria 2224
47 Ga0068862_100004331 3300005844 Bacteria 12015
48 Ga0081539_10001970 3300005985 Bacteria 31273
49 Ga0075367_10019156 3300006178 Bacteria 3791
50 Ga0097621_100511303 3300006237 Bacteria 1089
51 Ga0075430_100061249 3300006846 Bacteria 3163
52 Ga0075431_100174584 3300006847 Bacteria 2208
53 Ga0075431_100418181 3300006847 Bacteria 1340
54 Ga0075433_10001000 3300006852 Bacteria 20089
55 Ga0075433_10081301 3300006852 Bacteria 2856
56 Ga0075433_10118823 3300006852 Bacteria 2346
57 Ga0075433_10391310 3300006852 Bacteria 1227
58 Ga0075434_100089671 3300006871 Bacteria 3076
59 Ga0075434_100094825 3300006871 Bacteria 2989
60 Ga0075434_100128272 3300006871 Bacteria 2554
61 Ga0075429_100075239 3300006880 Bacteria 2941
62 Ga0075429_100398210 3300006880 Bacteria 1206
63 Ga0075436_100002573 3300006914 Bacteria 12474
64 Ga0075436_100023253 3300006914 Bacteria 4257
65 Ga0075436_100066765 3300006914 Bacteria 2486
66 Ga0097620_100262485 3300006931 Bacteria 1818
67 Ga0075435_100000509 3300007076 Bacteria 23720
68 Ga0075435_100096278 3300007076 Bacteria 2448
69 Ga0099794_10047411 3300007265 Bacteria 2060
70 Ga0111539_10012831 3300009094 Bacteria 10487
71 Ga0111539_10141206 3300009094 Bacteria 2819
72 Ga0105242_10194550 3300009176 Unclassified 1797
73 Ga0157370_10259877 3300013104 Bacteria 1605
74 Ga0182007_10008643 3300015262 Bacteria 4168
75 Ga0207699_10016891 3300025906 Bacteria 3828
76 Ga0207695_10373685 3300025913 Bacteria 1312
77 Ga0207662_10001183 3300025918 Bacteria 12407
78 Ga0207646_10000005 3300025922 Bacteria 523896
79 Ga0207650_10145666 3300025925 Bacteria 1865
80 Ga0207690_10023506 3300025932 Bacteria 3847
81 Ga0207686_10343847 3300025934 Bacteria 1121
82 Ga0207709_10462644 3300025935 Bacteria 983
83 Ga0207670_10027158 3300025936 Bacteria 3616
84 Ga0207669_10078617 3300025937 Bacteria 2103
85 Ga0207689_10103880 3300025942 Bacteria 2335
86 Ga0207658_10067295 3300025986 Bacteria 2698
87 Ga0207708_10006807 3300026075 Bacteria 8454
88 Ga0207648_10139387 3300026089 Bacteria 2137
89 Ga0207648_10339655 3300026089 Bacteria 1352
90 Ga0207676_10058370 3300026095 Bacteria 3044
91 Ga0207674_10388502 3300026116 Bacteria 1349
92 Ga0207674_10531467 3300026116 Bacteria 1136
93 Ga0207698_10736178 3300026142 Bacteria 984
94 Ga0207428_10000890 3300027907 Bacteria 33538
95 Ga0207428_10020394 3300027907 Bacteria 5633
96 Ga0268266_10000298 3300028379 Bacteria 79989
97 Ga0268265_10005091 3300028380 Bacteria 9013
98 Ga0268265_10686141 3300028380 Bacteria 988
99 Ga0307405_10273213 3300031731 Bacteria 1268
100 Ga0307413_10330273 3300031824 Bacteria 1169
101 Ga0307410_10104391 3300031852 Bacteria 2037
102 Ga0307406_10047206 3300031901 Bacteria 2713
103 Ga0307406_10233499 3300031901 Bacteria 1375
104 Ga0307407_10077725 3300031903 Bacteria 1997
105 Ga0307409_100036892 3300031995 Bacteria 3598
106 Ga0307409_100056990 3300031995 Bacteria 3024
107 Ga0307409_100387821 3300031995 Bacteria 1330
108 Ga0307416_100060191 3300032002 Bacteria 3091
109 Ga0307416_100427839 3300032002 Bacteria 1370
110 Ga0307411_10210022 3300032005 Bacteria 1502
111 Ga0307411_10287773 3300032005 Bacteria 1311
112 Ga0373939_0016618 3300035114 Bacteria 1943
113 Ga0373933_0073544 3300035724 Bacteria 2082
114 Ga0373937_0008143 3300036401 Bacteria 9102
115 Ga0373937_0529054 3300036401 Bacteria 1120
116 Ga0373925_0017835 3300037068 Bacteria 5151
117 Ga0395905_0645090 3300037471 Bacteria 961
118 Ga0439431_0004645 3300041997 Bacteria 3019
119 Ga0451577_0034581 3300042876 Bacteria 4555
120 Ga0451577_0047139 3300042876 Bacteria 3854
121 Ga0453683_0002884 3300044673 Bacteria 13004
122 Ga0453683_0022094 3300044673 Bacteria 4058
123 Ga0453683_0056013 3300044673 Bacteria 2467
124 Ga0453684_0083084 3300044712 Bacteria 3987
125 Ga0453684_0274221 3300044712 Unclassified 1926
126 Ga0453684_0440359 3300044712 Bacteria 1452
127 Ga0451576_0010279 3300045051 Bacteria 10749
128 Ga0451576_0294662 3300045051 Bacteria 1696
129 Ga0495629_0262876 3300046459 Bacteria 1186
130 Ga0495582_0019815 3300046473 Bacteria 3678
131 Ga0495659_0000671 3300046664 Bacteria 12419
132 Ga0495588_0011734 3300046674 Bacteria 4120
133 Ga0495647_0049031 3300046681 Bacteria 1635
134 Ga0495658_0115291 3300046683 Bacteria 1619
135 Ga0495613_0067320 3300046689 Bacteria 2614
136 Ga0495674_0070876 3300047319 Bacteria 3011
137 Ga0495674_0300932 3300047319 Bacteria 1310
138 Ga0495676_0061855 3300047321 Bacteria 2926
139 Ga0496104_0314934 3300048907 Bacteria 1478
140 Ga0496109_0189235 3300048912 Bacteria 1934
141 Ga0496109_0231871 3300048912 Bacteria 1737
142 Ga0501298_004453 3300049521 Bacteria 2209
143 Ga0501032_0359646 3300049569 Bacteria 937
144 Ga0501034_0094983 3300049571 Bacteria 2978
145 Ga0501040_0398562 3300049576 Bacteria 988
146 Ga0501042_0170335 3300049578 Bacteria 1571
147 Ga0501070_0460891 3300049586 Bacteria 1024
148 Ga0501073_0341972 3300049589 Bacteria 1033
149 Ga0501075_0154830 3300049591 Bacteria 1748
150 Ga0501075_0170230 3300049591 Bacteria 1662
151 Ga0501076_0003921 3300049592 Bacteria 10493
152 Ga0501079_0044082 3300049741 Bacteria 3443
153 Ga0501080_0647910 3300049742 Bacteria 935
154 nmdc:mga06z11_123276_c1 3300050494 Bacteria 1448
155 nmdc:mga09592_113591_c1 3300050508 Bacteria 2324
156 nmdc:mga0qj67_29691_c1 3300050509 Bacteria 4247
157 nmdc:mga06r32_13872_c1 3300050510 Bacteria 7311
158 nmdc:mga08y16_11632_c1 3300050511 Bacteria 9245
159 nmdc:mga08y16_2749_c1 3300050511 Bacteria 18030
160 nmdc:mga08y16_278445_c1 3300050511 Bacteria 1726
161 nmdc:mga08y16_609714_c1 3300050511 Bacteria 1099
162 nmdc:mga0n895_115350_c1 3300050512 Bacteria 2704
163 nmdc:mga0n895_124262_c1 3300050512 Bacteria 2603
164 nmdc:mga0n895_15315_c1 3300050512 Bacteria 6987
165 nmdc:mga0n895_1736_c1 3300050512 Bacteria 16485
166 nmdc:mga0n895_741068_c1 3300050512 Bacteria 976
167 nmdc:mga0rr50_234_c1 3300050513 Bacteria 30058
168 nmdc:mga08x19_128537_c1 3300050514 Bacteria 1703
169 nmdc:mga08x19_4586_c1 3300050514 Bacteria 8203
170 nmdc:mga0a205_1052_c1 3300050515 Bacteria 22961
171 nmdc:mga0a205_137990_c1 3300050515 Bacteria 2339
172 nmdc:mga0a205_201381_c1 3300050515 Bacteria 1881
173 nmdc:mga0a205_46017_c1 3300050515 Bacteria 4208
174 Ga0495595_0171522 3300053084 Bacteria 1074
175 Ga0495619_0222422 3300053085 Bacteria 1308
176 Ga0501082_0154883 3300060353 Bacteria 1991
177 Ga0501082_0588210 3300060353 Bacteria 974
178 Ga0451577_0254271
179 JGI24751J29686_10018565
180 JGI25406J46586_10001787
181 Ga0065712_10022755
182 Ga0065712_10127089
183 Ga0065712_10147285
184 Ga0065715_10032738
185 Ga0070670_100070176
186 Ga0070670_100228424
187 Ga0068869_100544056
188 Ga0068868_100466581
189 Ga0070689_100023625
190 Ga0070669_100372295
191 Ga0070711_100047191
192 Ga0070705_100007667
193 Ga0070705_100152265
194 Ga0070705_100286948
195 Ga0070694_100074181
196 Ga0070681_10115500
197 Ga0070681_10397030
198 Ga0070685_10029774
199 Ga0070685_10330500
200 Ga0070706_100041134
201 Ga0070707_100000327
202 Ga0070707_100000776
203 Ga0070707_100023422
204 Ga0070707_100130293
205 Ga0070707_100184875
206 Ga0070707_100308449
207 Ga0070698_100022290
208 Ga0070698_100234537
209 Ga0070699_100027624
210 Ga0070697_100081799
211 Ga0070697_100500905
212 Ga0070695_100188516
213 Ga0070695_100199931
214 Ga0070696_100000335
215 Ga0070696_100073910
216 Ga0070696_100141509
217 Ga0070665_100000192
218 Ga0070704_100283966
219 Ga0070702_100041578
220 Ga0068859_100262501
221 Ga0068864_100371108
222 Ga0068866_10364643
223 Ga0068858_100145764
224 Ga0068862_100004331
225 Ga0081539_10001970
226 Ga0075367_10019156
227 Ga0097621_100511303
228 Ga0075430_100061249
229 Ga0075431_100174584
230 Ga0075431_100418181
231 Ga0075433_10001000
232 Ga0075433_10081301
233 Ga0075433_10118823
234 Ga0075433_10391310
235 Ga0075434_100089671
236 Ga0075434_100094825
237 Ga0075434_100128272
238 Ga0075429_100075239
239 Ga0075429_100398210
240 Ga0075436_100002573
241 Ga0075436_100023253
242 Ga0075436_100066765
243 Ga0097620_100262485
244 Ga0075435_100000509
245 Ga0075435_100096278
246 Ga0099794_10047411
247 Ga0111539_10012831
248 Ga0111539_10141206
249 Ga0105242_10194550
250 Ga0157370_10259877
251 Ga0182007_10008643
252 Ga0207699_10016891
253 Ga0207695_10373685
254 Ga0207662_10001183
255 Ga0207646_10000005
256 Ga0207650_10145666
257 Ga0207690_10023506
258 Ga0207686_10343847
259 Ga0207709_10462644
260 Ga0207670_10027158
261 Ga0207669_10078617
262 Ga0207689_10103880
263 Ga0207658_10067295
264 Ga0207708_10006807
265 Ga0207648_10139387
266 Ga0207648_10339655
267 Ga0207676_10058370
268 Ga0207674_10388502
269 Ga0207674_10531467
270 Ga0207698_10736178
271 Ga0207428_10000890
272 Ga0207428_10020394
273 Ga0268266_10000298
274 Ga0268265_10005091
275 Ga0268265_10686141
276 Ga0307405_10273213
277 Ga0307413_10330273
278 Ga0307410_10104391
279 Ga0307406_10047206
280 Ga0307406_10233499
281 Ga0307407_10077725
282 Ga0307409_100036892
283 Ga0307409_100056990
284 Ga0307409_100387821
285 Ga0307416_100060191
286 Ga0307416_100427839
287 Ga0307411_10210022
288 Ga0307411_10287773
289 Ga0373939_0016618
290 Ga0373933_0073544
291 Ga0373937_0008143
292 Ga0373937_0529054
293 Ga0373925_0017835
294 Ga0395905_0645090
295 Ga0439431_0004645
296 Ga0451577_0034581
297 Ga0451577_0047139
298 Ga0453683_0002884
299 Ga0453683_0022094
300 Ga0453683_0056013
301 Ga0453684_0083084
302 Ga0453684_0274221
303 Ga0453684_0440359
304 Ga0451576_0010279
305 Ga0451576_0294662
306 Ga0495629_0262876
307 Ga0495582_0019815
308 Ga0495659_0000671
309 Ga0495588_0011734
310 Ga0495647_0049031
311 Ga0495658_0115291
312 Ga0495613_0067320
313 Ga0495674_0070876
314 Ga0495674_0300932
315 Ga0495676_0061855
316 Ga0496104_0314934
317 Ga0496109_0189235
318 Ga0496109_0231871
319 Ga0501298_004453
320 Ga0501032_0359646
321 Ga0501034_0094983
322 Ga0501040_0398562
323 Ga0501042_0170335
324 Ga0501070_0460891
325 Ga0501073_0341972
326 Ga0501075_0154830
327 Ga0501075_0170230
328 Ga0501076_0003921
329 Ga0501079_0044082
330 Ga0501080_0647910
331 nmdc:mga06z11_123276_c1
332 nmdc:mga09592_113591_c1
333 nmdc:mga0qj67_29691_c1
334 nmdc:mga06r32_13872_c1
335 nmdc:mga08y16_11632_c1
336 nmdc:mga08y16_2749_c1
337 nmdc:mga08y16_278445_c1
338 nmdc:mga08y16_609714_c1
339 nmdc:mga0n895_115350_c1
340 nmdc:mga0n895_124262_c1
341 nmdc:mga0n895_15315_c1
342 nmdc:mga0n895_1736_c1
343 nmdc:mga0n895_741068_c1
344 nmdc:mga0rr50_234_c1
345 nmdc:mga08x19_128537_c1
346 nmdc:mga08x19_4586_c1
347 nmdc:mga0a205_1052_c1
348 nmdc:mga0a205_137990_c1
349 nmdc:mga0a205_201381_c1
350 nmdc:mga0a205_46017_c1
351 Ga0495595_0171522
352 Ga0495619_0222422
353 Ga0501082_0154883
354 Ga0501082_0588210

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00725

3HCDH

3-hydroxyacyl-CoA dehydrogenase, C-terminal domain

225

320

0.99

PF02737

3HCDH_N

3-hydroxyacyl-CoA dehydrogenase, NAD binding domain

44

223

0.99

PF03446

NAD_binding_2

NAD binding domain of 6-phosphogluconate dehydrogenase

44

171

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
4j34-assembly1.cif.gz_A crystal structure of kynurenine 3-monooxygenase - truncated at position 394 plus his tag cleaved. 0.9937 4 36
5nmw-assembly2.cif.gz_D crystal structure of the pyrrolizidine alkaloid n-oxygenase from zonocerus variegatus in complex with fad 0.972 3 33
5nmw-assembly1.cif.gz_A-2 crystal structure of the pyrrolizidine alkaloid n-oxygenase from zonocerus variegatus in complex with fad 0.9693 3 36
6j0z-assembly1.cif.gz_C-2 crystal structure of alpk 0.9539 6 36
4bk1-assembly1.cif.gz_A-2 crystal structure of 3-hydroxybenzoate 6-hydroxylase uncovers lipid- assisted flavoprotein strategy for regioselective aromatic hydroxylation: h213s mutant in complex with 3-hydroxybenzoate 0.9491 4 35
ID Description Score Start End Superfamily
4j36B00 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9941 4 36 3.50.50.60
af_P9WNY9_4_366_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.988 6 35 3.50.50.60
6iumB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9634 1 182 3.40.50.720
af_Q8S1G9_1_195_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9629 3 188 3.40.50.720
2wtbA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9581 3 185 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2V8ID11-F1-model_v4 3-hydroxybutyryl-CoA dehydrogenase 0.985 1 110 GO:0006631
GO:0016491
GO:0070403
AF-D6PBH4-F1-model_v4 3-hydroxyacyl-CoA dehydrogenase NAD binding domain-containing protein 0.98 1 105 GO:0006072
GO:0006631
GO:0016491
GO:0070403
AF-A0A7V8WAW7-F1-model_v4 NAD(P)-binding domain-containing protein 0.9793 1 118 GO:0006631
GO:0016491
GO:0070403
AF-A0A536ZZL8-F1-model_v4 3-hydroxyacyl-CoA dehydrogenase 0.9765 1 103 GO:0003857
GO:0006631
GO:0016829
GO:0016853
GO:0046395
GO:0070403
AF-A0A2V9AUS6-F1-model_v4 3-hydroxyacyl-CoA dehydrogenase NAD binding domain-containing protein 0.9764 1 186 GO:0006631
GO:0016491
GO:0070403

Map