F270651

General Info

Members Datasets Scaffolds Average Seq Length
177 116 177 209

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0045568|Ga0451577_0045568_2594_3235
Length 213
Sequence MSTNLPSLLIGIPFSLVYLADGDARVNETRAAVDPLERRAVEAVRGGDSGGYDYLVSKYSRRALSIAWGIVRDAADAEDLVQEAFVRAYVKIGRFREGEPFGPWLYRIVTNLALDALKHRTKFPSTPVEPHDERGELRTAAPEWSDTASRIDRAIESLPDMQRVVARLFIVEEFEHAEIAAMTGLAEGTVRSHLSHARKRLQEALKDLKEESR

Samples

Sample ID Description Type Environment
1 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
2 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
46 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
47 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
66 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
67 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
95 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
96 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
97 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
98 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
99 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
100 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
101 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
102 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
103 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
104 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
105 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
106 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
107 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
108 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
109 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
110 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
111 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
112 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
113 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
114 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
115 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
116 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.56
Rhizosphere 96.05
Stem 0
Stem Tuber 0
Unclassified 3.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10034119 3300001991 Bacteria 1009
2 JGI24033J26618_1023642 3300002155 Bacteria 800
3 Ga0070658_10020221 3300005327 Bacteria 5334
4 Ga0070683_100000022 3300005329 Bacteria 180088
5 Ga0070683_100123838 3300005329 Unclassified 2443
6 Ga0070690_100193816 3300005330 Bacteria 1410
7 Ga0070690_100434650 3300005330 Bacteria 970
8 Ga0070670_100000059 3300005331 Bacteria 115840
9 Ga0070677_10059695 3300005333 Bacteria 1569
10 Ga0068869_100009648 3300005334 Bacteria 6268
11 Ga0070680_100009865 3300005336 Bacteria 7349
12 Ga0070682_100000004 3300005337 Bacteria 388780
13 Ga0068868_100000158 3300005338 Bacteria 44219
14 Ga0068868_100006469 3300005338 Bacteria 8292
15 Ga0070689_100006059 3300005340 Bacteria 8332
16 Ga0070689_100170871 3300005340 Bacteria 1761
17 Ga0070689_100681172 3300005340 Bacteria 896
18 Ga0070692_10008485 3300005345 Bacteria 4587
19 Ga0070675_100000003 3300005354 Bacteria 422595
20 Ga0070671_100186565 3300005355 Bacteria 1757
21 Ga0070673_100077531 3300005364 Bacteria 2686
22 Ga0070713_100050641 3300005436 Bacteria 3431
23 Ga0070705_100538607 3300005440 Bacteria 893
24 Ga0070700_100000017 3300005441 Bacteria 144824
25 Ga0070708_100243423 3300005445 Unclassified 1689
26 Ga0070708_100253678 3300005445 Bacteria 1653
27 Ga0070708_100260198 3300005445 Bacteria 1631
28 Ga0070678_100454542 3300005456 Bacteria 1122
29 Ga0068867_100725165 3300005459 Bacteria 879
30 Ga0068867_100948653 3300005459 Unclassified 777
31 Ga0070706_100047175 3300005467 Bacteria 3975
32 Ga0070706_100147072 3300005467 Bacteria 2200
33 Ga0070706_100211984 3300005467 Bacteria 1809
34 Ga0070706_100560310 3300005467 Bacteria 1063
35 Ga0070707_100231636 3300005468 Bacteria 1798
36 Ga0070707_100233510 3300005468 Bacteria 1790
37 Ga0070698_100068343 3300005471 Bacteria 3571
38 Ga0070698_100117970 3300005471 Bacteria 2616
39 Ga0070698_100193662 3300005471 Bacteria 1970
40 Ga0070698_100287863 3300005471 Bacteria 1574
41 Ga0070699_100012430 3300005518 Bacteria 7346
42 Ga0070699_100054069 3300005518 Bacteria 3475
43 Ga0070699_100114193 3300005518 Bacteria 2372
44 Ga0070699_100278315 3300005518 Unclassified 1498
45 Ga0070684_100000091 3300005535 Bacteria 58992
46 Ga0070697_100035814 3300005536 Bacteria 4006
47 Ga0070697_100107065 3300005536 Bacteria 2326
48 Ga0068853_100104962 3300005539 Unclassified 2502
49 Ga0070672_100001359 3300005543 Bacteria 15083
50 Ga0070686_100101564 3300005544 Bacteria 1944
51 Ga0070686_100142456 3300005544 Bacteria 1670
52 Ga0070693_100110765 3300005547 Unclassified 1688
53 Ga0070693_100741099 3300005547 Bacteria 723
54 Ga0068857_100292988 3300005577 Bacteria 1499
55 Ga0068854_100833465 3300005578 Unclassified 806
56 Ga0070702_100121808 3300005615 Bacteria 1634
57 Ga0070702_100164746 3300005615 Bacteria 1436
58 Ga0068864_100000025 3300005618 Bacteria 250062
59 Ga0068870_10009664 3300005840 Bacteria 4396
60 Ga0070717_10000158 3300006028 Bacteria 51255
61 Ga0070716_100148791 3300006173 Bacteria 1503
62 Ga0070716_100214352 3300006173 Bacteria 1289
63 Ga0097621_100094200 3300006237 Bacteria 2510
64 Ga0097621_100458536 3300006237 Bacteria 1149
65 Ga0068871_100365055 3300006358 Bacteria 1280
66 Ga0075431_100005331 3300006847 Bacteria 12684
67 Ga0075429_100103618 3300006880 Unclassified 2485
68 Ga0068865_100150276 3300006881 Bacteria 1766
69 Ga0075436_100003163 3300006914 Bacteria 11290
70 Ga0075436_100196568 3300006914 Bacteria 1428
71 Ga0075436_100649673 3300006914 Bacteria 779
72 Ga0075435_100024067 3300007076 Bacteria 4720
73 Ga0105244_10287088 3300009036 Bacteria 763
74 Ga0105240_10008611 3300009093 Bacteria 14578
75 Ga0111539_11030781 3300009094 Bacteria 956
76 Ga0105245_10000054 3300009098 Bacteria 124956
77 Ga0105245_10000206 3300009098 Bacteria 56107
78 Ga0105245_10016673 3300009098 Bacteria 6414
79 Ga0105245_10186564 3300009098 Bacteria 1984
80 Ga0105245_10890142 3300009098 Bacteria 931
81 Ga0114129_10021620 3300009147 Bacteria 9131
82 Ga0105242_10002772 3300009176 Bacteria 13715
83 Ga0105238_10000029 3300009551 Bacteria 182309
84 Ga0105239_10762916 3300010375 Bacteria 1107
85 Ga0105246_10463105 3300011119 Bacteria 1068
86 Ga0157369_10000163 3300013105 Bacteria 94265
87 Ga0157374_10000008 3300013296 Bacteria 588863
88 Ga0157374_11419089 3300013296 Unclassified 717
89 Ga0157378_10000891 3300013297 Bacteria 27532
90 Ga0157378_10001004 3300013297 Bacteria 25854
91 Ga0157378_10007035 3300013297 Bacteria 9819
92 Ga0163162_10012221 3300013306 Bacteria 8380
93 Ga0157372_10594454 3300013307 Bacteria 1290
94 Ga0157375_10000034 3300013308 Bacteria 184385
95 Ga0157375_10000066 3300013308 Bacteria 111876
96 Ga0157375_10000391 3300013308 Bacteria 39899
97 Ga0157375_10492963 3300013308 Bacteria 1390
98 Ga0157380_10004008 3300014326 Bacteria 10168
99 Ga0157377_10000012 3300014745 Bacteria 274497
100 Ga0157377_10000033 3300014745 Bacteria 118144
101 Ga0157376_10000002 3300014969 Bacteria 684532
102 Ga0213873_10000759 3300021358 Bacteria 5222
103 Ga0213876_10000067 3300021384 Bacteria 126770
104 Ga0207682_10063373 3300025893 Bacteria 1552
105 Ga0207643_10005996 3300025908 Bacteria 6494
106 Ga0207705_10115381 3300025909 Unclassified 1987
107 Ga0207684_10282781 3300025910 Bacteria 1430
108 Ga0207684_10566576 3300025910 Bacteria 971
109 Ga0207660_10202573 3300025917 Bacteria 1551
110 Ga0207646_10059281 3300025922 Bacteria 3419
111 Ga0207646_10106681 3300025922 Bacteria 2513
112 Ga0207646_10375501 3300025922 Bacteria 1284
113 Ga0207646_10417290 3300025922 Bacteria 1212
114 Ga0207694_10000002 3300025924 Bacteria 1165763
115 Ga0207694_10000003 3300025924 Bacteria 1165533
116 Ga0207650_10000195 3300025925 Bacteria 70093
117 Ga0207650_10022234 3300025925 Bacteria 4488
118 Ga0207659_10000006 3300025926 Bacteria 384976
119 Ga0207687_10000010 3300025927 Bacteria 403706
120 Ga0207687_10000098 3300025927 Bacteria 63866
121 Ga0207687_10022814 3300025927 Bacteria 4168
122 Ga0207687_10290826 3300025927 Bacteria 1313
123 Ga0207687_10731155 3300025927 Bacteria 841
124 Ga0207700_10075482 3300025928 Bacteria 2612
125 Ga0207686_10003133 3300025934 Bacteria 8892
126 Ga0207670_10092648 3300025936 Bacteria 2139
127 Ga0207670_10354663 3300025936 Bacteria 1162
128 Ga0207704_10094901 3300025938 Bacteria 1971
129 Ga0207665_10207387 3300025939 Bacteria 1430
130 Ga0207665_10258168 3300025939 Bacteria 1290
131 Ga0207691_10002132 3300025940 Bacteria 19357
132 Ga0207689_10007319 3300025942 Bacteria 9684
133 Ga0207689_10318317 3300025942 Bacteria 1291
134 Ga0207689_10408417 3300025942 Bacteria 1132
135 Ga0207661_10000009 3300025944 Bacteria 421876
136 Ga0207651_10129025 3300025960 Bacteria 1932
137 Ga0207640_10019183 3300025981 Bacteria 4035
138 Ga0207677_10000012 3300026023 Bacteria 194702
139 Ga0207677_10000073 3300026023 Bacteria 83861
140 Ga0207703_10001681 3300026035 Bacteria 19903
141 Ga0207639_10000073 3300026041 Bacteria 93577
142 Ga0207708_10000053 3300026075 Bacteria 104395
143 Ga0207648_10036970 3300026089 Bacteria 4301
144 Ga0207648_10316754 3300026089 Bacteria 1401
145 Ga0207676_10000002 3300026095 Bacteria 1198607
146 Ga0207674_10185224 3300026116 Bacteria 2033
147 Ga0307511_10000069 3300030521 Bacteria 85515
148 Ga0373932_0001076 3300035112 Bacteria 7874
149 Ga0436365_0056181 3300039437 Bacteria 7089
150 Ga0436365_0980736 3300039437 Bacteria 54026
151 Ga0436365_1060473 3300039437 Bacteria 1711
152 Ga0436362_0595984 3300039453 Bacteria 5265
153 Ga0451839_1212495 3300041496 Bacteria 2018
154 Ga0451577_0045568 3300042876 Bacteria 3925
155 Ga0451577_0078286 3300042876 Bacteria 2948
156 Ga0451577_0548282 3300042876 Bacteria 1050
157 Ga0453683_0062454 3300044673 Bacteria 2329
158 Ga0453683_0074150 3300044673 Unclassified 2130
159 Ga0453684_0050683 3300044712 Bacteria 5456
160 Ga0466957_0205940 3300044842 Bacteria 1294
161 Ga0451576_0897029 3300045051 Unclassified 930
162 Ga0495621_0178186 3300046539 Unclassified 847
163 Ga0495679_036228 3300047446 Bacteria 1559
164 Ga0496106_0098817 3300048909 Unclassified 2262
165 Ga0501073_0056833 3300049589 Unclassified 2736
166 nmdc:mga05p37_60740_c1 3300050507 Bacteria 4653
167 nmdc:mga09592_158494_c1 3300050508 Unclassified 1954
168 nmdc:mga06r32_4292_c1 3300050510 Bacteria 12768
169 nmdc:mga08y16_677570_c1 3300050511 Bacteria 1033
170 nmdc:mga0n895_1005453_c1 3300050512 Bacteria 815
171 nmdc:mga0n895_1034428_c1 3300050512 Bacteria 801
172 nmdc:mga0rr50_17_c2 3300050513 Bacteria 129969
173 nmdc:mga08x19_464881_c1 3300050514 Bacteria 891
174 nmdc:mga08x19_478_c1 3300050514 Bacteria 26932
175 nmdc:mga08x19_607511_c1 3300050514 Bacteria 775
176 nmdc:mga0a205_211866_c1 3300050515 Bacteria 1825
177 Ga0495655_0000659 3300053083 Bacteria 5562

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005441 Ga0070700_100000017 Ga0070700_100000017134 153
2 3300025934 Ga0207686_10003133 Ga0207686_100031337 153
3 3300026075 Ga0207708_10000053 Ga0207708_1000005311 153
4 3300006847 Ga0075431_100005331 Ga0075431_1000053313 182
5 3300006880 Ga0075429_100103618 Ga0075429_1001036183 182
6 3300009094 Ga0111539_11030781 Ga0111539_110307812 182
7 3300050508 nmdc:mga09592_158494_c1 nmdc:mga09592_158494_c1_796_1347 182
8 3300050510 nmdc:mga06r32_4292_c1 nmdc:mga06r32_4292_c1_1239_1790 182
9 3300050511 nmdc:mga08y16_677570_c1 nmdc:mga08y16_677570_c1_398_946 182
10 3300005336 Ga0070680_100009865 Ga0070680_1000098654 183
11 3300005340 Ga0070689_100681172 Ga0070689_1006811722 183
12 3300005354 Ga0070675_100000003 Ga0070675_10000000315 183
13 3300009036 Ga0105244_10287088 Ga0105244_102870882 183
14 3300009176 Ga0105242_10002772 Ga0105242_1000277210 183
15 3300025917 Ga0207660_10202573 Ga0207660_102025733 183
16 3300025926 Ga0207659_10000006 Ga0207659_10000006354 183
17 3300050512 nmdc:mga0n895_1005453_c1 nmdc:mga0n895_1005453_c1_219_770 183
18 3300050512 nmdc:mga0n895_1034428_c1 nmdc:mga0n895_1034428_c1_161_712 183
19 3300014326 Ga0157380_10004008 Ga0157380_100040086 187
20 3300025942 Ga0207689_10408417 Ga0207689_104084173 188
21 3300005615 Ga0070702_100164746 Ga0070702_1001647462 189
22 3300009098 Ga0105245_10000206 Ga0105245_1000020632 189
23 3300013306 Ga0163162_10012221 Ga0163162_100122216 189
24 3300025927 Ga0207687_10000098 Ga0207687_100000986 189
25 3300005330 Ga0070690_100193816 Ga0070690_1001938162 192
26 3300005456 Ga0070678_100454542 Ga0070678_1004545422 192
27 3300005459 Ga0068867_100948653 Ga0068867_1009486531 192
28 3300005539 Ga0068853_100104962 Ga0068853_1001049624 192
29 3300009093 Ga0105240_10008611 Ga0105240_1000861114 192
30 3300026041 Ga0207639_10000073 Ga0207639_1000007391 192
31 3300053083 Ga0495655_0000659 Ga0495655_0000659_19_606 194
32 3300025927 Ga0207687_10290826 Ga0207687_102908261 197
33 3300049589 Ga0501073_0056833 Ga0501073_0056833_1079_1672 197
34 3300005445 Ga0070708_100243423 Ga0070708_1002434232 198
35 3300005467 Ga0070706_100560310 Ga0070706_1005603102 198
36 3300005468 Ga0070707_100231636 Ga0070707_1002316362 198
37 3300009147 Ga0114129_10021620 Ga0114129_100216205 198
38 3300050507 nmdc:mga05p37_60740_c1 nmdc:mga05p37_60740_c1_115_711 198
39 3300010375 Ga0105239_10762916 Ga0105239_107629162 201
40 3300005544 Ga0070686_100101564 Ga0070686_1001015643 204
41 3300005340 Ga0070689_100006059 Ga0070689_1000060598 205
42 3300005364 Ga0070673_100077531 Ga0070673_1000775313 205
43 3300025927 Ga0207687_10022814 Ga0207687_100228142 205
44 3300025936 Ga0207670_10354663 Ga0207670_103546631 205
45 3300025960 Ga0207651_10129025 Ga0207651_101290252 205
46 3300026035 Ga0207703_10001681 Ga0207703_1000168116 205
47 3300042876 Ga0451577_0045568 Ga0451577_0045568_2594_3235 205
48 3300044673 Ga0453683_0062454 Ga0453683_0062454_792_1433 205
49 3300044712 Ga0453684_0050683 Ga0453684_0050683_2084_2725 205
50 3300045051 Ga0451576_0897029 Ga0451576_0897029_183_824 205
51 3300009098 Ga0105245_10186564 Ga0105245_101865643 206
52 3300009098 Ga0105245_10890142 Ga0105245_108901422 206
53 3300025927 Ga0207687_10731155 Ga0207687_107311552 206
54 3300005543 Ga0070672_100001359 Ga0070672_1000013596 207
55 3300006914 Ga0075436_100196568 Ga0075436_1001965683 207
56 3300013308 Ga0157375_10000034 Ga0157375_1000003416 207
57 3300025938 Ga0207704_10094901 Ga0207704_100949012 207
58 3300025940 Ga0207691_10002132 Ga0207691_100021328 207
59 3300050514 nmdc:mga08x19_464881_c1 nmdc:mga08x19_464881_c1_104_733 207
60 3300005329 Ga0070683_100123838 Ga0070683_1001238383 208
61 3300005333 Ga0070677_10059695 Ga0070677_100596952 208
62 3300005338 Ga0068868_100006469 Ga0068868_1000064699 208
63 3300005618 Ga0068864_100000025 Ga0068864_10000002568 208
64 3300006881 Ga0068865_100150276 Ga0068865_1001502764 208
65 3300009098 Ga0105245_10016673 Ga0105245_100166734 208
66 3300013296 Ga0157374_11419089 Ga0157374_114190892 208
67 3300013308 Ga0157375_10492963 Ga0157375_104929632 208
68 3300025893 Ga0207682_10063373 Ga0207682_100633733 208
69 3300026023 Ga0207677_10000012 Ga0207677_1000001212 208
70 3300026095 Ga0207676_10000002 Ga0207676_10000002898 208
71 3300039437 Ga0436365_1060473 Ga0436365_1060473_629_1258 208
72 3300044842 Ga0466957_0205940 Ga0466957_0205940_378_1004 208
73 3300046539 Ga0495621_0178186 Ga0495621_0178186_55_684 208
74 3300006173 Ga0070716_100148791 Ga0070716_1001487913 210
75 3300025939 Ga0207665_10207387 Ga0207665_102073873 210
76 3300005340 Ga0070689_100170871 Ga0070689_1001708712 211
77 3300005544 Ga0070686_100142456 Ga0070686_1001424563 211
78 3300005547 Ga0070693_100110765 Ga0070693_1001107652 211
79 3300035112 Ga0373932_0001076 Ga0373932_0001076_4551_5192 211
80 3300042876 Ga0451577_0078286 Ga0451577_0078286_1949_2590 211
81 3300013297 Ga0157378_10007035 Ga0157378_100070358 212
82 3300005440 Ga0070705_100538607 Ga0070705_1005386072 213
83 3300005459 Ga0068867_100725165 Ga0068867_1007251652 213
84 3300005577 Ga0068857_100292988 Ga0068857_1002929883 213
85 3300006914 Ga0075436_100649673 Ga0075436_1006496731 213
86 3300014745 Ga0157377_10000033 Ga0157377_1000003354 213
87 3300025942 Ga0207689_10318317 Ga0207689_103183173 213
88 3300026116 Ga0207674_10185224 Ga0207674_101852244 213
89 3300050514 nmdc:mga08x19_607511_c1 nmdc:mga08x19_607511_c1_73_717 213
90 3300050515 nmdc:mga0a205_211866_c1 nmdc:mga0a205_211866_c1_1116_1760 213
91 3300005471 Ga0070698_100117970 Ga0070698_1001179705 214
92 3300025922 Ga0207646_10417290 Ga0207646_104172901 214
93 3300005337 Ga0070682_100000004 Ga0070682_100000004182 216
94 3300005355 Ga0070671_100186565 Ga0070671_1001865653 216
95 3300005445 Ga0070708_100260198 Ga0070708_1002601982 216
96 3300005467 Ga0070706_100211984 Ga0070706_1002119842 216
97 3300005468 Ga0070707_100233510 Ga0070707_1002335103 216
98 3300005471 Ga0070698_100068343 Ga0070698_1000683434 216
99 3300005471 Ga0070698_100287863 Ga0070698_1002878633 216
100 3300005518 Ga0070699_100012430 Ga0070699_1000124305 216
101 3300005536 Ga0070697_100035814 Ga0070697_1000358142 216
102 3300005578 Ga0068854_100833465 Ga0068854_1008334651 216
103 3300005615 Ga0070702_100121808 Ga0070702_1001218083 216
104 3300006237 Ga0097621_100458536 Ga0097621_1004585362 216
105 3300025922 Ga0207646_10375501 Ga0207646_103755012 216
106 3300005330 Ga0070690_100434650 Ga0070690_1004346501 217
107 3300005436 Ga0070713_100050641 Ga0070713_1000506415 217
108 3300006028 Ga0070717_10000158 Ga0070717_1000015821 217
109 3300025928 Ga0207700_10075482 Ga0207700_100754824 217
110 3300025936 Ga0207670_10092648 Ga0207670_100926482 217
111 3300026089 Ga0207648_10036970 Ga0207648_100369702 217
112 3300026089 Ga0207648_10316754 Ga0207648_103167542 217
113 3300039437 Ga0436365_0056181 Ga0436365_0056181_5596_6261 217
114 3300001991 JGI24743J22301_10034119 JGI24743J22301_100341192 218
115 3300002155 JGI24033J26618_1023642 JGI24033J26618_10236422 218
116 3300005327 Ga0070658_10020221 Ga0070658_100202214 218
117 3300005329 Ga0070683_100000022 Ga0070683_10000002258 218
118 3300005331 Ga0070670_100000059 Ga0070670_10000005997 218
119 3300005334 Ga0068869_100009648 Ga0068869_1000096486 218
120 3300005338 Ga0068868_100000158 Ga0068868_10000015832 218
121 3300005345 Ga0070692_10008485 Ga0070692_100084854 218
122 3300005445 Ga0070708_100253678 Ga0070708_1002536782 218
123 3300005467 Ga0070706_100047175 Ga0070706_1000471753 218
124 3300005467 Ga0070706_100147072 Ga0070706_1001470723 218
125 3300005471 Ga0070698_100193662 Ga0070698_1001936623 218
126 3300005518 Ga0070699_100054069 Ga0070699_1000540694 218
127 3300005518 Ga0070699_100114193 Ga0070699_1001141933 218
128 3300005518 Ga0070699_100278315 Ga0070699_1002783152 218
129 3300005535 Ga0070684_100000091 Ga0070684_10000009113 218
130 3300005536 Ga0070697_100107065 Ga0070697_1001070653 218
131 3300005547 Ga0070693_100741099 Ga0070693_1007410991 218
132 3300005840 Ga0068870_10009664 Ga0068870_100096644 218
133 3300006173 Ga0070716_100214352 Ga0070716_1002143522 218
134 3300006237 Ga0097621_100094200 Ga0097621_1000942003 218
135 3300006358 Ga0068871_100365055 Ga0068871_1003650552 218
136 3300006914 Ga0075436_100003163 Ga0075436_1000031639 218
137 3300007076 Ga0075435_100024067 Ga0075435_1000240675 218
138 3300009098 Ga0105245_10000054 Ga0105245_1000005449 218
139 3300009551 Ga0105238_10000029 Ga0105238_10000029126 218
140 3300011119 Ga0105246_10463105 Ga0105246_104631052 218
141 3300013105 Ga0157369_10000163 Ga0157369_1000016358 218
142 3300013296 Ga0157374_10000008 Ga0157374_10000008223 218
143 3300013297 Ga0157378_10000891 Ga0157378_1000089112 218
144 3300013297 Ga0157378_10001004 Ga0157378_100010049 218
145 3300013307 Ga0157372_10594454 Ga0157372_105944542 218
146 3300013308 Ga0157375_10000066 Ga0157375_1000006661 218
147 3300013308 Ga0157375_10000391 Ga0157375_1000039116 218
148 3300014745 Ga0157377_10000012 Ga0157377_10000012110 218
149 3300014969 Ga0157376_10000002 Ga0157376_10000002299 218
150 3300021358 Ga0213873_10000759 Ga0213873_100007594 218
151 3300021384 Ga0213876_10000067 Ga0213876_10000067129 218
152 3300025908 Ga0207643_10005996 Ga0207643_100059964 218
153 3300025909 Ga0207705_10115381 Ga0207705_101153812 218
154 3300025910 Ga0207684_10282781 Ga0207684_102827812 218
155 3300025910 Ga0207684_10566576 Ga0207684_105665762 218
156 3300025922 Ga0207646_10059281 Ga0207646_100592815 218
157 3300025922 Ga0207646_10106681 Ga0207646_101066814 218
158 3300025924 Ga0207694_10000002 Ga0207694_1000000252 218
159 3300025924 Ga0207694_10000003 Ga0207694_100000031048 218
160 3300025925 Ga0207650_10000195 Ga0207650_1000019533 218
161 3300025925 Ga0207650_10022234 Ga0207650_100222343 218
162 3300025927 Ga0207687_10000010 Ga0207687_10000010343 218
163 3300025939 Ga0207665_10258168 Ga0207665_102581682 218
164 3300025942 Ga0207689_10007319 Ga0207689_100073194 218
165 3300025944 Ga0207661_10000009 Ga0207661_10000009233 218
166 3300025981 Ga0207640_10019183 Ga0207640_100191833 218
167 3300026023 Ga0207677_10000073 Ga0207677_1000007369 218
168 3300030521 Ga0307511_10000069 Ga0307511_1000006969 218
169 3300039437 Ga0436365_0980736 Ga0436365_0980736_3213_3872 218
170 3300039453 Ga0436362_0595984 Ga0436362_0595984_2730_3389 218
171 3300041496 Ga0451839_1212495 Ga0451839_1212495_824_1483 218
172 3300042876 Ga0451577_0548282 Ga0451577_0548282_99_764 218
173 3300044673 Ga0453683_0074150 Ga0453683_0074150_1418_2083 218
174 3300047446 Ga0495679_036228 Ga0495679_036228_512_1171 218
175 3300048909 Ga0496106_0098817 Ga0496106_0098817_1324_1983 218
176 3300050513 nmdc:mga0rr50_17_c2 nmdc:mga0rr50_17_c2_8000_8665 218
177 3300050514 nmdc:mga08x19_478_c1 nmdc:mga08x19_478_c1_16665_17330 218

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08281

Sigma70_r4_2

Sigma-70, region 4

148

201

0.98

PF04542

Sigma70_r2

Sigma-70 region 2

55

123

0.94

PF04545

Sigma70_r4

Sigma-70, region 4

154

203

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4go1-assembly1.cif.gz_A-2 crystal structure of full length transcription repressor lsrr from e. coli. 0.9677 164 199
4go1-assembly1.cif.gz_B-2 crystal structure of full length transcription repressor lsrr from e. coli. 0.9557 164 203
4lup-assembly2.cif.gz_C crystal structure of the complex formed by region of e. coli sigmae bound to its -10 element non template strand 0.95 39 124
2w48-assembly1.cif.gz_A crystal structure of the full-length sorbitol operon regulator sorc from klebsiella pneumoniae 0.9493 165 204
5fgm-assembly1.cif.gz_A streptomyces coelicolor sigr region 4 0.9437 153 212
ID Description Score Start End Superfamily
4go1B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9557 164 203 1.10.10.10
4go1A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9544 164 203 1.10.10.10
4lupC00 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.95 39 124 1.10.1740.10
4lupA00 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.9472 39 124 1.10.1740.10
5or5A00 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.9433 39 124 1.10.1740.10
ID Description Score Start End GO Terms
AF-S2D3Z6-F1-model_v4 RNA polymerase ECF-type sigma factor 0.8925 39 129 GO:0006352
GO:0016987
AF-A0A1B8TWN5-F1-model_v4 RNA polymerase 0.8722 38 211 GO:0003677
GO:0006352
GO:0016987
AF-R6JL83-F1-model_v4 Sigma-70 family RNA polymerase sigma factor 0.8649 37 211 GO:0003677
GO:0006352
GO:0016020
GO:0016987
AF-A0A1C6CH62-F1-model_v4 RNA polymerase sigma factor sigV 0.8648 35 211 GO:0003677
GO:0006352
GO:0016987
AF-A0A3D9QXY4-F1-model_v4 RNA polymerase sigma-70 factor (ECF subfamily) 0.8644 37 134 GO:0006352
GO:0016987

Feature Viewer

pLDDT pTM Quality
74.02 0.52 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map