F270249

General Info

Members Datasets Scaffolds Average Seq Length
177 132 354 154

Family's Representative Sequence

Representative Sequence 3300014325|Ga0163163_11637239|Ga0163163_116372391
Length 183
Sequence MPPGPRLFAGAIVTIGGLCDGGAVLSFPGPMTYAFEQISAADLPLMKQLLALFGEAFGEPDRYLRDPPSDAYLRTLLAKPHFIALVARDGEQVIGGLAAYELEKFEQQRSEIYIYDLAVRESHRRQGVATGLIRALQLIGELRGAYVIFVQADPGDEPAIRLYASLGTREDVHHFDIPVVPRG

Samples

Sample ID Description Type Environment
1 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
64 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
89 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
91 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
92 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
93 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
94 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
95 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
96 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
97 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
98 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
99 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
100 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
101 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
102 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
103 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
104 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
105 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
106 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
107 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
108 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
109 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
110 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
111 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
112 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
113 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
114 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
115 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
116 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
117 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
118 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
119 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
120 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
121 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
122 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
123 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
124 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
125 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
126 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
127 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
128 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
129 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
130 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
131 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
132 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.39
Rhizosphere 95.48
Stem 0
Stem Tuber 0
Unclassified 24.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163163_11637239 3300014325 Bacteria 704
2 rootH1_10003772 3300003323 Bacteria 9470
3 rootH1_10101962 3300003323 Unclassified 3007
4 Ga0065707_10598271 3300005295 Bacteria 691
5 Ga0070658_10276714 3300005327 Unclassified 1428
6 Ga0070670_100648729 3300005331 Archaea 947
7 Ga0068868_100158284 3300005338 Bacteria 1869
8 Ga0070660_100269557 3300005339 Bacteria 1391
9 Ga0070660_101127941 3300005339 Unclassified 664
10 Ga0070689_100041659 3300005340 Bacteria 3525
11 Ga0070687_100028145 3300005343 Bacteria 2723
12 Ga0070687_100042897 3300005343 Bacteria 2295
13 Ga0070692_10302904 3300005345 Bacteria 976
14 Ga0070668_100806781 3300005347 Bacteria 834
15 Ga0070668_100928310 3300005347 Archaea 779
16 Ga0070669_100412939 3300005353 Unclassified 1106
17 Ga0070669_100501957 3300005353 Unclassified 1006
18 Ga0070675_100885889 3300005354 Bacteria 818
19 Ga0070671_100364673 3300005355 Unclassified 1233
20 Ga0070673_100316974 3300005364 Bacteria 1376
21 Ga0070688_100015002 3300005365 Bacteria 4398
22 Ga0070688_100024705 3300005365 Bacteria 3550
23 Ga0070659_100045205 3300005366 Bacteria 3449
24 Ga0070667_100234830 3300005367 Bacteria 1636
25 Ga0070667_100581694 3300005367 Bacteria 1031
26 Ga0070667_100645136 3300005367 Bacteria 977
27 Ga0070713_100299157 3300005436 Bacteria 1481
28 Ga0070713_100561078 3300005436 Bacteria 1082
29 Ga0070710_11194257 3300005437 Bacteria 562
30 Ga0070701_10253792 3300005438 Unclassified 1063
31 Ga0070681_10260225 3300005458 Bacteria 1647
32 Ga0070679_100363506 3300005530 Bacteria 1394
33 Ga0068853_100132962 3300005539 Unclassified 2228
34 Ga0070672_100406799 3300005543 Bacteria 1167
35 Ga0070686_100044173 3300005544 Bacteria 2799
36 Ga0070665_100647022 3300005548 Unclassified 1070
37 Ga0070665_100913993 3300005548 Bacteria 890
38 Ga0068855_100338988 3300005563 Bacteria 1658
39 Ga0070664_100569792 3300005564 Unclassified 1048
40 Ga0068857_100032886 3300005577 Bacteria 4585
41 Ga0068856_100034137 3300005614 Unclassified 4983
42 Ga0068856_100279109 3300005614 Bacteria 1687
43 Ga0068856_100523239 3300005614 Bacteria 1207
44 Ga0070702_100138772 3300005615 Bacteria 1546
45 Ga0068852_100023263 3300005616 Bacteria 4985
46 Ga0068859_100043747 3300005617 Bacteria 4501
47 Ga0068864_100028283 3300005618 Bacteria 4737
48 Ga0068861_100133606 3300005719 Bacteria 2017
49 Ga0068861_100843979 3300005719 Bacteria 863
50 Ga0068863_100085658 3300005841 Bacteria 2986
51 Ga0068863_100142979 3300005841 Bacteria 2287
52 Ga0068858_100250240 3300005842 Bacteria 1683
53 Ga0068858_100795317 3300005842 Bacteria 923
54 Ga0068860_100190193 3300005843 Unclassified 1986
55 Ga0068862_100799262 3300005844 Bacteria 921
56 Ga0068871_101041221 3300006358 Unclassified 763
57 Ga0075431_100011463 3300006847 Bacteria 8934
58 Ga0075431_100083689 3300006847 Unclassified 3294
59 Ga0075433_10094359 3300006852 Unclassified 2648
60 Ga0075433_10829515 3300006852 Unclassified 807
61 Ga0068865_100498206 3300006881 Unclassified 1015
62 Ga0097620_100043744 3300006931 Bacteria 4501
63 Ga0075435_100115294 3300007076 Bacteria 2237
64 Ga0105240_10000514 3300009093 Bacteria 71226
65 Ga0111539_10033951 3300009094 Bacteria 6190
66 Ga0111539_10040245 3300009094 Bacteria 5628
67 Ga0111539_10056146 3300009094 Bacteria 4681
68 Ga0111539_10586328 3300009094 Unclassified 1298
69 Ga0114129_10005934 3300009147 Bacteria 17288
70 Ga0114129_10269828 3300009147 Bacteria 2277
71 Ga0105248_11187940 3300009177 Unclassified 862
72 Ga0105237_10000360 3300009545 Bacteria 64290
73 Ga0105249_10002625 3300009553 Bacteria 15563
74 Ga0157373_10130902 3300013100 Bacteria 1765
75 Ga0157371_10144501 3300013102 Unclassified 1695
76 Ga0157374_10006372 3300013296 Bacteria 10013
77 Ga0157378_10386182 3300013297 Bacteria 1376
78 Ga0163162_10361898 3300013306 Bacteria 1584
79 Ga0163162_10956798 3300013306 Bacteria 967
80 Ga0157372_10067639 3300013307 Bacteria 4015
81 Ga0157375_10348744 3300013308 Bacteria 1646
82 Ga0163163_10368264 3300014325 Bacteria 1494
83 Ga0157377_10301043 3300014745 Bacteria 1058
84 Ga0157379_10362734 3300014968 Unclassified 1328
85 Ga0157376_10881914 3300014969 Unclassified 912
86 Ga0207673_1003289 3300025290 Unclassified 1885
87 Ga0207688_10065034 3300025901 Unclassified 2060
88 Ga0207680_10492080 3300025903 Bacteria 873
89 Ga0207699_11128307 3300025906 Bacteria 581
90 Ga0207705_10014743 3300025909 Bacteria 5619
91 Ga0207705_11326738 3300025909 Unclassified 549
92 Ga0207695_10003658 3300025913 Bacteria 21457
93 Ga0207695_10609260 3300025913 Unclassified 973
94 Ga0207671_10000213 3300025914 Bacteria 87854
95 Ga0207662_10036676 3300025918 Bacteria 2867
96 Ga0207657_10248663 3300025919 Bacteria 1418
97 Ga0207652_10009153 3300025921 Bacteria 7970
98 Ga0207681_10245935 3300025923 Unclassified 1394
99 Ga0207681_10385432 3300025923 Bacteria 1129
100 Ga0207659_10280061 3300025926 Bacteria 1363
101 Ga0207700_10107473 3300025928 Bacteria 2239
102 Ga0207706_10338182 3300025933 Bacteria 1309
103 Ga0207670_10003532 3300025936 Bacteria 8293
104 Ga0207691_10109807 3300025940 Unclassified 2453
105 Ga0207679_10564478 3300025945 Unclassified 1022
106 Ga0207651_10058272 3300025960 Bacteria 2669
107 Ga0207651_10272301 3300025960 Bacteria 1395
108 Ga0207668_10622886 3300025972 Bacteria 942
109 Ga0207658_10782840 3300025986 Bacteria 865
110 Ga0207677_10114740 3300026023 Bacteria 2014
111 Ga0207702_10025909 3300026078 Unclassified 4868
112 Ga0207702_10446629 3300026078 Bacteria 1254
113 Ga0207641_10032522 3300026088 Bacteria 4331
114 Ga0207674_10077757 3300026116 Bacteria 3324
115 Ga0207674_10131844 3300026116 Bacteria 2462
116 Ga0207698_10417563 3300026142 Unclassified 1286
117 Ga0207428_10228431 3300027907 Bacteria 1393
118 Ga0207428_10711215 3300027907 Unclassified 718
119 Ga0268265_10753799 3300028380 Bacteria 945
120 Ga0265318_10077536 3300028577 Bacteria 1228
121 Ga0265338_10018514 3300028800 Bacteria 7452
122 Ga0265330_10159906 3300031235 Unclassified 957
123 Ga0265320_10009014 3300031240 Bacteria 6050
124 Ga0265340_10116609 3300031247 Bacteria 1230
125 Ga0265340_10166616 3300031247 Bacteria 999
126 Ga0265331_10002298 3300031250 Bacteria 13026
127 Ga0265316_10187180 3300031344 Bacteria 1540
128 Ga0265313_10220875 3300031595 Bacteria 781
129 Ga0307410_10054427 3300031852 Unclassified 2713
130 Ga0307407_10596365 3300031903 Bacteria 822
131 Ga0373940_0225006 3300035088 Unclassified 625
132 Ga0373954_0007698 3300035118 Bacteria 4715
133 Ga0373956_0004462 3300035119 Bacteria 5597
134 Ga0373957_0038616 3300035120 Bacteria 1788
135 Ga0373955_0006896 3300035172 Bacteria 5193
136 Ga0373933_0024409 3300035724 Bacteria 3462
137 Ga0373933_0081628 3300035724 Bacteria 1984
138 Ga0373933_0329068 3300035724 Bacteria 991
139 Ga0373937_0000947 3300036401 Bacteria 24696
140 Ga0373937_0058303 3300036401 Bacteria 3547
141 Ga0373937_0136339 3300036401 Bacteria 2295
142 Ga0373937_0190670 3300036401 Bacteria 1926
143 Ga0373937_1112382 3300036401 Bacteria 739
144 Ga0466965_0039354 3300044683 Bacteria 2324
145 Ga0453684_0486070 3300044712 Unclassified 1369
146 Ga0495603_0071742 3300046455 Bacteria 2035
147 Ga0495640_0288032 3300046533 Bacteria 1022
148 Ga0495586_0017787 3300046535 Bacteria 3783
149 Ga0495597_0271377 3300046542 Bacteria 662
150 Ga0495667_0801096 3300046559 Bacteria 581
151 Ga0495668_0253015 3300046616 Bacteria 964
152 Ga0495668_0427152 3300046616 Bacteria 729
153 Ga0495625_0000064 3300046660 Bacteria 174730
154 Ga0495647_0106868 3300046681 Bacteria 1164
155 Ga0495600_0297706 3300046809 Bacteria 1018
156 Ga0495684_0161702 3300047471 Bacteria 1669
157 Ga0496104_0486304 3300048907 Bacteria 1146
158 Ga0496108_0482330 3300048911 Unclassified 1083
159 Ga0496108_1461710 3300048911 Bacteria 570
160 Ga0496110_1673123 3300048913 Bacteria 546
161 Ga0496112_0023768 3300048915 Bacteria 5863
162 Ga0496115_0245236 3300048918 Bacteria 1476
163 Ga0501081_1049650 3300049743 Unclassified 616
164 nmdc:mga05p37_220171_c1 3300050507 Bacteria 2291
165 nmdc:mga05p37_44113_c1 3300050507 Bacteria 5486
166 nmdc:mga06r32_163513_c1 3300050510 Unclassified 2208
167 nmdc:mga06r32_564372_c1 3300050510 Unclassified 1111
168 nmdc:mga08y16_1161961_c1 3300050511 Archaea 744
169 nmdc:mga08y16_198359_c1 3300050511 Unclassified 2080
170 nmdc:mga08y16_58895_c1 3300050511 Bacteria 4013
171 nmdc:mga08y16_827537_c1 3300050511 Unclassified 917
172 nmdc:mga0n895_10152_c1 3300050512 Bacteria 8291
173 nmdc:mga0rr50_103194_c1 3300050513 Bacteria 2244
174 nmdc:mga0a205_72246_c1 3300050515 Unclassified 3333
175 nmdc:mga0a205_949866_c1 3300050515 Unclassified 706
176 Ga0495619_0236002 3300053085 Bacteria 1267
177 Ga0501082_0182955 3300060353 Bacteria 1823
178 Ga0163163_11637239
179 rootH1_10003772
180 rootH1_10101962
181 Ga0065707_10598271
182 Ga0070658_10276714
183 Ga0070670_100648729
184 Ga0068868_100158284
185 Ga0070660_100269557
186 Ga0070660_101127941
187 Ga0070689_100041659
188 Ga0070687_100028145
189 Ga0070687_100042897
190 Ga0070692_10302904
191 Ga0070668_100806781
192 Ga0070668_100928310
193 Ga0070669_100412939
194 Ga0070669_100501957
195 Ga0070675_100885889
196 Ga0070671_100364673
197 Ga0070673_100316974
198 Ga0070688_100015002
199 Ga0070688_100024705
200 Ga0070659_100045205
201 Ga0070667_100234830
202 Ga0070667_100581694
203 Ga0070667_100645136
204 Ga0070713_100299157
205 Ga0070713_100561078
206 Ga0070710_11194257
207 Ga0070701_10253792
208 Ga0070681_10260225
209 Ga0070679_100363506
210 Ga0068853_100132962
211 Ga0070672_100406799
212 Ga0070686_100044173
213 Ga0070665_100647022
214 Ga0070665_100913993
215 Ga0068855_100338988
216 Ga0070664_100569792
217 Ga0068857_100032886
218 Ga0068856_100034137
219 Ga0068856_100279109
220 Ga0068856_100523239
221 Ga0070702_100138772
222 Ga0068852_100023263
223 Ga0068859_100043747
224 Ga0068864_100028283
225 Ga0068861_100133606
226 Ga0068861_100843979
227 Ga0068863_100085658
228 Ga0068863_100142979
229 Ga0068858_100250240
230 Ga0068858_100795317
231 Ga0068860_100190193
232 Ga0068862_100799262
233 Ga0068871_101041221
234 Ga0075431_100011463
235 Ga0075431_100083689
236 Ga0075433_10094359
237 Ga0075433_10829515
238 Ga0068865_100498206
239 Ga0097620_100043744
240 Ga0075435_100115294
241 Ga0105240_10000514
242 Ga0111539_10033951
243 Ga0111539_10040245
244 Ga0111539_10056146
245 Ga0111539_10586328
246 Ga0114129_10005934
247 Ga0114129_10269828
248 Ga0105248_11187940
249 Ga0105237_10000360
250 Ga0105249_10002625
251 Ga0157373_10130902
252 Ga0157371_10144501
253 Ga0157374_10006372
254 Ga0157378_10386182
255 Ga0163162_10361898
256 Ga0163162_10956798
257 Ga0157372_10067639
258 Ga0157375_10348744
259 Ga0163163_10368264
260 Ga0157377_10301043
261 Ga0157379_10362734
262 Ga0157376_10881914
263 Ga0207673_1003289
264 Ga0207688_10065034
265 Ga0207680_10492080
266 Ga0207699_11128307
267 Ga0207705_10014743
268 Ga0207705_11326738
269 Ga0207695_10003658
270 Ga0207695_10609260
271 Ga0207671_10000213
272 Ga0207662_10036676
273 Ga0207657_10248663
274 Ga0207652_10009153
275 Ga0207681_10245935
276 Ga0207681_10385432
277 Ga0207659_10280061
278 Ga0207700_10107473
279 Ga0207706_10338182
280 Ga0207670_10003532
281 Ga0207691_10109807
282 Ga0207679_10564478
283 Ga0207651_10058272
284 Ga0207651_10272301
285 Ga0207668_10622886
286 Ga0207658_10782840
287 Ga0207677_10114740
288 Ga0207702_10025909
289 Ga0207702_10446629
290 Ga0207641_10032522
291 Ga0207674_10077757
292 Ga0207674_10131844
293 Ga0207698_10417563
294 Ga0207428_10228431
295 Ga0207428_10711215
296 Ga0268265_10753799
297 Ga0265318_10077536
298 Ga0265338_10018514
299 Ga0265330_10159906
300 Ga0265320_10009014
301 Ga0265340_10116609
302 Ga0265340_10166616
303 Ga0265331_10002298
304 Ga0265316_10187180
305 Ga0265313_10220875
306 Ga0307410_10054427
307 Ga0307407_10596365
308 Ga0373940_0225006
309 Ga0373954_0007698
310 Ga0373956_0004462
311 Ga0373957_0038616
312 Ga0373955_0006896
313 Ga0373933_0024409
314 Ga0373933_0081628
315 Ga0373933_0329068
316 Ga0373937_0000947
317 Ga0373937_0058303
318 Ga0373937_0136339
319 Ga0373937_0190670
320 Ga0373937_1112382
321 Ga0466965_0039354
322 Ga0453684_0486070
323 Ga0495603_0071742
324 Ga0495640_0288032
325 Ga0495586_0017787
326 Ga0495597_0271377
327 Ga0495667_0801096
328 Ga0495668_0253015
329 Ga0495668_0427152
330 Ga0495625_0000064
331 Ga0495647_0106868
332 Ga0495600_0297706
333 Ga0495684_0161702
334 Ga0496104_0486304
335 Ga0496108_0482330
336 Ga0496108_1461710
337 Ga0496110_1673123
338 Ga0496112_0023768
339 Ga0496115_0245236
340 Ga0501081_1049650
341 nmdc:mga05p37_220171_c1
342 nmdc:mga05p37_44113_c1
343 nmdc:mga06r32_163513_c1
344 nmdc:mga06r32_564372_c1
345 nmdc:mga08y16_1161961_c1
346 nmdc:mga08y16_198359_c1
347 nmdc:mga08y16_58895_c1
348 nmdc:mga08y16_827537_c1
349 nmdc:mga0n895_10152_c1
350 nmdc:mga0rr50_103194_c1
351 nmdc:mga0a205_72246_c1
352 nmdc:mga0a205_949866_c1
353 Ga0495619_0236002
354 Ga0501082_0182955

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08445

FR47

FR47-like protein

98

175

0.85

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

46

168

0.79

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

80

167

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
6bvc-assembly1.cif.gz_A-2 crystal structure of aac(3)-ia in complex with coenzyme a 0.9866 10 156
5hmn-assembly1.cif.gz_C crystal structure of an aminoglycoside acetyltransferase hmb0005 from an uncultured soil metagenomic sample, unknown active site density modeled as polyethylene glycol 0.9851 9 157
4yfj-assembly1.cif.gz_A crystal structure of aminoglycoside acetyltransferase aac(3)-ib 0.975 10 159
5hmn-assembly1.cif.gz_C crystal structure of an aminoglycoside acetyltransferase hmb0005 from an uncultured soil metagenomic sample, unknown active site density modeled as polyethylene glycol 0.9596 9 157
4yfj-assembly1.cif.gz_A crystal structure of aminoglycoside acetyltransferase aac(3)-ib 0.9504 10 159
ID Description Score Start End Superfamily
5hmnC00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9851 9 157 3.40.630.30
5hmnC00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9596 9 157 3.40.630.30
1bo4B00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9503 10 136 3.40.630.30
5f47B00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9281 10 157 3.40.630.30
5f47B00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8933 10 157 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A536XCX7-F1-model_v4 AAC(3)-I family aminoglycoside 3-N-acetyltransferase 0.993 10 94 GO:0016740
AF-A0A7Y5FGI5-F1-model_v4 AAC(3)-I family aminoglycoside N-acetyltransferase 0.9916 10 156 GO:0016747
AF-A0A841L2B8-F1-model_v4 Aminoglycoside 3-N-acetyltransferase I (EC 2.3.1.60) 0.9862 27 158 GO:0016747
AF-A0A6P1KYC8-F1-model_v4 AAC(3)-I family aminoglycoside 3-N-acetyltransferase 0.9754 43 163 GO:0016747
AF-E4WMD0-F1-model_v4 Gentamycin 3-N-acetyltransferase 0.9735 10 163 GO:0016747

Map