F270105

General Info

Members Datasets Scaffolds Average Seq Length
177 126 176 374

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10000033|Ga0111539_1000003346
Length 401
Sequence MKPPSSDTPVRRRFALLRSALRPLRSGVDLATRSLLHDKLRFFITVSGVAFAVTLVFVQVGLFIGLMSNASLTIDQIDADLWVTSRNTPNVDFAHAFPETYIKRVRSIPGVMRADNLIVWFMNVNLPTGAVEGTEVYALEDFSRWNFPRNVVDGNLDDLRRGPYMVLDDSAKKRWGAFAVNDHREVLGRRLKIIGRTVDAKSFTTTPLTFMDYRLAQSLNEGELRGQTTYILVKLAPSADIEAVRTELRRRLPYNDVFTRDEWARRSRSYWIDSTGLGLNMYITVFLGCLVGIVVVAQTLYTSTMEHIREFGTVKAIGGGNGDIYRILGKQALIAAVAGFALGALQAFALRPLMAGIDLKLIIPMQLYVAVLLGAIALCLSAAVISFRKVATIDPALVFRT

Samples

Sample ID Description Type Environment
1 2920107658 Aquisphaera insulae JC669 Isolate Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
40 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
59 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
60 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
89 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
92 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
93 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
94 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
95 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
96 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
97 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
98 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
99 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
100 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
101 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
102 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
103 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
104 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
105 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
106 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
107 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
108 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
109 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
110 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
111 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
112 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
116 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
117 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
118 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
119 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
120 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
121 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
122 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
123 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
124 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
125 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
126 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.44
Metatranscriptomes 0
Isolates 0.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.56
Nodule 0
Rhizoplane 0.56
Rhizosphere 94.35
Stem 0
Stem Tuber 0
Unclassified 4.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10008041 3300003323 Bacteria 3808
2 rootH1_10065997 3300003323 Bacteria 4618
3 rootH1_10158015 3300003323 Bacteria 5882
4 Ga0065715_10112446 3300005293 Bacteria 2529
5 Ga0065707_10095679 3300005295 Bacteria 3346
6 Ga0070676_10187725 3300005328 Bacteria 1347
7 Ga0068869_100014050 3300005334 Bacteria 5343
8 Ga0070666_10037551 3300005335 Bacteria 3221
9 Ga0070682_100000159 3300005337 Bacteria 51678
10 Ga0068868_100001101 3300005338 Bacteria 18485
11 Ga0070689_100002429 3300005340 Bacteria 12173
12 Ga0070689_100077778 3300005340 Bacteria 2600
13 Ga0070689_100185173 3300005340 Bacteria 1693
14 Ga0070691_10073771 3300005341 Bacteria 1659
15 Ga0070687_100000623 3300005343 Bacteria 11721
16 Ga0070675_100000004 3300005354 Bacteria 361974
17 Ga0070667_100080646 3300005367 Bacteria 2784
18 Ga0070703_10010365 3300005406 Bacteria 2627
19 Ga0070701_10000115 3300005438 Bacteria 23160
20 Ga0070700_100000086 3300005441 Bacteria 62330
21 Ga0070700_100027373 3300005441 Bacteria 3380
22 Ga0070694_100090417 3300005444 Bacteria 2147
23 Ga0070694_100102415 3300005444 Bacteria 2027
24 Ga0070708_100002475 3300005445 Bacteria 14264
25 Ga0070708_100265151 3300005445 Bacteria 1615
26 Ga0070662_100264576 3300005457 Bacteria 1386
27 Ga0070706_100000481 3300005467 Bacteria 47072
28 Ga0070706_100012133 3300005467 Bacteria 7991
29 Ga0070706_100356626 3300005467 Unclassified 1363
30 Ga0070707_100266558 3300005468 Bacteria 1666
31 Ga0070684_100039982 3300005535 Bacteria 4035
32 Ga0070697_100019740 3300005536 Bacteria 5325
33 Ga0070697_100193387 3300005536 Bacteria 1727
34 Ga0070672_100000062 3300005543 Bacteria 49596
35 Ga0068855_100000328 3300005563 Bacteria 59015
36 Ga0068857_100021500 3300005577 Bacteria 5677
37 Ga0068859_100000108 3300005617 Bacteria 77862
38 Ga0068864_100000007 3300005618 Bacteria 392187
39 Ga0068861_100002881 3300005719 Bacteria 11335
40 Ga0068861_100037223 3300005719 Bacteria 3617
41 Ga0068860_100198569 3300005843 Bacteria 1943
42 Ga0068862_100000997 3300005844 Bacteria 27086
43 Ga0068862_100037951 3300005844 Bacteria 4084
44 Ga0097621_100053457 3300006237 Bacteria 3292
45 Ga0075428_100106016 3300006844 Bacteria 3064
46 Ga0075428_100273096 3300006844 Bacteria 1819
47 Ga0075431_100019624 3300006847 Bacteria 6896
48 Ga0075431_100333127 3300006847 Bacteria 1528
49 Ga0075433_10011078 3300006852 Bacteria 7252
50 Ga0075433_10117999 3300006852 Bacteria 2355
51 Ga0075434_100002371 3300006871 Bacteria 16517
52 Ga0097620_100000108 3300006931 Bacteria 77862
53 Ga0075435_100001640 3300007076 Bacteria 14512
54 Ga0075435_100046089 3300007076 Bacteria 3496
55 Ga0099794_10023370 3300007265 Bacteria 2826
56 Ga0111539_10000033 3300009094 Bacteria 154510
57 Ga0111539_10077746 3300009094 Bacteria 3905
58 Ga0105245_10001376 3300009098 Bacteria 22013
59 Ga0105245_10065632 3300009098 Bacteria 3283
60 Ga0105247_10010142 3300009101 Bacteria 5707
61 Ga0114129_10012849 3300009147 Bacteria 11916
62 Ga0114129_10077767 3300009147 Bacteria 4615
63 Ga0114129_10096036 3300009147 Bacteria 4104
64 Ga0114129_10114619 3300009147 Bacteria 3716
65 Ga0114129_10591159 3300009147 Bacteria 1439
66 Ga0105242_10005659 3300009176 Bacteria 9645
67 Ga0105238_10148033 3300009551 Bacteria 2324
68 Ga0105239_10004191 3300010375 Bacteria 17319
69 Ga0105239_10403778 3300010375 Unclassified 1546
70 Ga0105239_10435168 3300010375 Unclassified 1487
71 Ga0157371_10085202 3300013102 Unclassified 2239
72 Ga0157370_10063639 3300013104 Bacteria 3494
73 Ga0157369_10147966 3300013105 Bacteria 2483
74 Ga0157378_10078494 3300013297 Bacteria 2978
75 Ga0163162_10038489 3300013306 Bacteria 4773
76 Ga0157372_10187546 3300013307 Bacteria 2395
77 Ga0157372_10220739 3300013307 Unclassified 2197
78 Ga0157372_10649679 3300013307 Unclassified 1228
79 Ga0157375_10000003 3300013308 Bacteria 476325
80 Ga0157380_10005951 3300014326 Bacteria 8536
81 Ga0157380_10006380 3300014326 Bacteria 8301
82 Ga0157377_10090152 3300014745 Bacteria 1809
83 Ga0157376_10051758 3300014969 Bacteria 3412
84 Ga0213873_10000001 3300021358 Bacteria 1657979
85 Ga0213876_10000002 3300021384 Bacteria 1168769
86 Ga0213876_10001023 3300021384 Bacteria 18098
87 Ga0207697_10006214 3300025315 Bacteria 5431
88 Ga0207688_10056288 3300025901 Bacteria 2209
89 Ga0207680_10005699 3300025903 Bacteria 5965
90 Ga0207645_10004642 3300025907 Bacteria 10116
91 Ga0207645_10106020 3300025907 Bacteria 1817
92 Ga0207684_10000239 3300025910 Bacteria 82378
93 Ga0207684_10091674 3300025910 Bacteria 2590
94 Ga0207684_10149285 3300025910 Unclassified 2011
95 Ga0207695_10000104 3300025913 Bacteria 257201
96 Ga0207660_10015660 3300025917 Bacteria 5007
97 Ga0207662_10001328 3300025918 Bacteria 11926
98 Ga0207646_10092413 3300025922 Bacteria 2708
99 Ga0207646_10103864 3300025922 Bacteria 2548
100 Ga0207681_10252922 3300025923 Bacteria 1376
101 Ga0207659_10000002 3300025926 Bacteria 619441
102 Ga0207687_10000235 3300025927 Bacteria 37735
103 Ga0207690_10177262 3300025932 Bacteria 1602
104 Ga0207706_10142382 3300025933 Bacteria 2109
105 Ga0207686_10016841 3300025934 Bacteria 4106
106 Ga0207670_10000624 3300025936 Bacteria 19038
107 Ga0207689_10029335 3300025942 Bacteria 4595
108 Ga0207661_10124152 3300025944 Bacteria 2203
109 Ga0207667_10002517 3300025949 Bacteria 22859
110 Ga0207651_10009600 3300025960 Bacteria 5310
111 Ga0207668_10062281 3300025972 Bacteria 2626
112 Ga0207677_10000001 3300026023 Bacteria 534789
113 Ga0207703_10000412 3300026035 Bacteria 45572
114 Ga0207708_10000035 3300026075 Bacteria 140227
115 Ga0207708_10036453 3300026075 Bacteria 3744
116 Ga0207641_10006428 3300026088 Bacteria 9904
117 Ga0207676_10000015 3300026095 Bacteria 329100
118 Ga0207674_10005193 3300026116 Bacteria 15507
119 Ga0207675_100006333 3300026118 Bacteria 11221
120 Ga0207675_100064020 3300026118 Bacteria 3436
121 Ga0207428_10000001 3300027907 Bacteria 1034622
122 Ga0207428_10008895 3300027907 Bacteria 9045
123 Ga0268265_10000712 3300028380 Bacteria 32721
124 Ga0268265_10085766 3300028380 Bacteria 2500
125 Ga0268264_10000421 3300028381 Bacteria 59726
126 Ga0268264_10116603 3300028381 Bacteria 2348
127 Ga0265339_10001493 3300031249 Bacteria 17289
128 Ga0265331_10002681 3300031250 Bacteria 11872
129 Ga0265316_10002085 3300031344 Bacteria 21022
130 Ga0265316_10154470 3300031344 Unclassified 1718
131 Ga0265314_10000001 3300031711 Bacteria 3792860
132 Ga0373932_0003279 3300035112 Bacteria 3911
133 Ga0373943_0010405 3300035170 Bacteria 4169
134 Ga0395905_0007362 3300037471 Bacteria 10959
135 Ga0436365_1097713 3300039437 Bacteria 23010
136 Ga0436365_1137746 3300039437 Bacteria 7619
137 Ga0436365_1426389 3300039437 Bacteria 62176
138 Ga0436362_0721240 3300039453 Bacteria 4182
139 Ga0436362_0887974 3300039453 Bacteria 104210
140 Ga0439445_0023975 3300042004 Bacteria 1548
141 Ga0451577_0000031 3300042876 Bacteria 388524
142 Ga0451577_0239863 3300042876 Bacteria 1640
143 Ga0451577_0392144 3300042876 Bacteria 1260
144 Ga0453684_0001482 3300044712 Bacteria 66202
145 Ga0453684_0083229 3300044712 Bacteria 3983
146 Ga0451576_0011554 3300045051 Bacteria 10019
147 Ga0451576_0115113 3300045051 Bacteria 2799
148 Ga0495580_0000984 3300046472 Bacteria 25013
149 Ga0495608_0132838 3300046511 Unclassified 1592
150 Ga0495620_0000769 3300046515 Bacteria 19669
151 Ga0495621_0039388 3300046539 Bacteria 1652
152 Ga0495613_0051545 3300046689 Bacteria 3033
153 Ga0495674_0007672 3300047319 Bacteria 10306
154 Ga0496114_0000024 3300048917 Bacteria 216712
155 Ga0501296_002104 3300049519 Unclassified 2050
156 Ga0501039_0077103 3300049575 Bacteria 2592
157 Ga0501042_0132721 3300049578 Bacteria 1795
158 Ga0501048_0030856 3300049582 Bacteria 3879
159 Ga0501073_0009146 3300049589 Bacteria 7309
160 Ga0501075_0000664 3300049591 Bacteria 21158
161 Ga0501076_0116041 3300049592 Bacteria 2167
162 Ga0501080_0009254 3300049742 Bacteria 8980
163 Ga0501080_0107887 3300049742 Bacteria 2581
164 nmdc:mga05p37_15729_c1 3300050507 Bacteria 9097
165 nmdc:mga06r32_183781_c1 3300050510 Bacteria 2077
166 nmdc:mga06r32_3245_c1 3300050510 Bacteria 14551
167 nmdc:mga08y16_1_c1 3300050511 Bacteria 1034622
168 nmdc:mga08y16_5896_c1 3300050511 Bacteria 12841
169 nmdc:mga0n895_9302_c1 3300050512 Bacteria 8585
170 nmdc:mga0rr50_23373_c1 3300050513 Bacteria 4261
171 nmdc:mga0rr50_2409_c2 3300050513 Bacteria 3681
172 nmdc:mga0rr50_5206_c1 3300050513 Bacteria 7734
173 nmdc:mga0a205_153249_c1 3300050515 Bacteria 2203
174 nmdc:mga0a205_2918_c1 3300050515 Bacteria 15138
175 Ga0500568_0001652 3300053139 Bacteria 13985
176 Ga0501082_0001620 3300060353 Bacteria 19816

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025907 Ga0207645_10106020 Ga0207645_101060202 340
2 3300049592 Ga0501076_0116041 Ga0501076_0116041_734_1780 348
3 3300009101 Ga0105247_10010142 Ga0105247_100101425 349
4 3300010375 Ga0105239_10403778 Ga0105239_104037782 357
5 3300049519 Ga0501296_002104 Ga0501296_002104_208_1332 358
6 3300042876 Ga0451577_0239863 Ga0451577_0239863_138_1265 360
7 3300005354 Ga0070675_100000004 Ga0070675_100000004257 362
8 3300005617 Ga0068859_100000108 Ga0068859_10000010870 362
9 3300006931 Ga0097620_100000108 Ga0097620_10000010870 362
10 3300025926 Ga0207659_10000002 Ga0207659_10000002215 362
11 3300031250 Ga0265331_10002681 Ga0265331_100026819 362
12 3300031344 Ga0265316_10154470 Ga0265316_101544701 362
13 3300006847 Ga0075431_100019624 Ga0075431_1000196243 364
14 3300050510 nmdc:mga06r32_3245_c1 nmdc:mga06r32_3245_c1_8518_9648 364
15 3300005618 Ga0068864_100000007 Ga0068864_100000007207 366
16 3300013297 Ga0157378_10078494 Ga0157378_100784943 366
17 3300026095 Ga0207676_10000015 Ga0207676_10000015123 366
18 3300006844 Ga0075428_100106016 Ga0075428_1001060163 367
19 3300006847 Ga0075431_100333127 Ga0075431_1003331272 367
20 3300009147 Ga0114129_10114619 Ga0114129_101146192 367
21 3300050510 nmdc:mga06r32_183781_c1 nmdc:mga06r32_183781_c1_780_1904 367
22 3300005444 Ga0070694_100102415 Ga0070694_1001024152 368
23 3300053139 Ga0500568_0001652 Ga0500568_0001652_7744_8868 368
24 3300005406 Ga0070703_10010365 Ga0070703_100103653 369
25 3300006852 Ga0075433_10117999 Ga0075433_101179993 369
26 3300007076 Ga0075435_100046089 Ga0075435_1000460893 369
27 3300009147 Ga0114129_10077767 Ga0114129_100777676 369
28 3300025910 Ga0207684_10091674 Ga0207684_100916742 369
29 3300050513 nmdc:mga0rr50_2409_c2 nmdc:mga0rr50_2409_c2_1133_2263 369
30 3300050515 nmdc:mga0a205_153249_c1 nmdc:mga0a205_153249_c1_227_1351 369
31 iso_pu_bacteria 2920107658 2920111363 371
32 3300005334 Ga0068869_100014050 Ga0068869_1000140504 374
33 3300005341 Ga0070691_10073771 Ga0070691_100737712 374
34 3300005441 Ga0070700_100027373 Ga0070700_1000273733 374
35 3300005444 Ga0070694_100090417 Ga0070694_1000904171 374
36 3300005577 Ga0068857_100021500 Ga0068857_1000215002 374
37 3300005719 Ga0068861_100037223 Ga0068861_1000372233 374
38 3300006844 Ga0075428_100273096 Ga0075428_1002730962 374
39 3300009094 Ga0111539_10077746 Ga0111539_100777463 374
40 3300009147 Ga0114129_10096036 Ga0114129_100960362 374
41 3300009551 Ga0105238_10148033 Ga0105238_101480332 374
42 3300010375 Ga0105239_10004191 Ga0105239_100041914 374
43 3300013102 Ga0157371_10085202 Ga0157371_100852022 374
44 3300013104 Ga0157370_10063639 Ga0157370_100636392 374
45 3300013105 Ga0157369_10147966 Ga0157369_101479662 374
46 3300013307 Ga0157372_10187546 Ga0157372_101875462 374
47 3300013307 Ga0157372_10220739 Ga0157372_102207392 374
48 3300013307 Ga0157372_10649679 Ga0157372_106496791 374
49 3300014326 Ga0157380_10006380 Ga0157380_100063805 374
50 3300025913 Ga0207695_10000104 Ga0207695_1000010475 374
51 3300025942 Ga0207689_10029335 Ga0207689_100293353 374
52 3300025944 Ga0207661_10124152 Ga0207661_101241522 374
53 3300026075 Ga0207708_10036453 Ga0207708_100364533 374
54 3300026116 Ga0207674_10005193 Ga0207674_100051932 374
55 3300026118 Ga0207675_100064020 Ga0207675_1000640203 374
56 3300027907 Ga0207428_10008895 Ga0207428_100088955 374
57 3300037471 Ga0395905_0007362 Ga0395905_0007362_2889_4013 374
58 3300046511 Ga0495608_0132838 Ga0495608_0132838_294_1418 374
59 3300047319 Ga0495674_0007672 Ga0495674_0007672_1758_2882 374
60 3300049575 Ga0501039_0077103 Ga0501039_0077103_898_2022 374
61 3300049578 Ga0501042_0132721 Ga0501042_0132721_211_1335 374
62 3300049582 Ga0501048_0030856 Ga0501048_0030856_2343_3467 374
63 3300050511 nmdc:mga08y16_5896_c1 nmdc:mga08y16_5896_c1_6219_7343 374
64 3300003323 rootH1_10008041 rootH1_100080411 375
65 3300003323 rootH1_10065997 rootH1_100659975 375
66 3300003323 rootH1_10158015 rootH1_101580156 375
67 3300005293 Ga0065715_10112446 Ga0065715_101124463 375
68 3300005295 Ga0065707_10095679 Ga0065707_100956792 375
69 3300005328 Ga0070676_10187725 Ga0070676_101877251 375
70 3300005335 Ga0070666_10037551 Ga0070666_100375512 375
71 3300005337 Ga0070682_100000159 Ga0070682_10000015926 375
72 3300005338 Ga0068868_100001101 Ga0068868_1000011016 375
73 3300005340 Ga0070689_100002429 Ga0070689_1000024294 375
74 3300005340 Ga0070689_100077778 Ga0070689_1000777782 375
75 3300005340 Ga0070689_100185173 Ga0070689_1001851732 375
76 3300005343 Ga0070687_100000623 Ga0070687_1000006235 375
77 3300005367 Ga0070667_100080646 Ga0070667_1000806462 375
78 3300005438 Ga0070701_10000115 Ga0070701_1000011513 375
79 3300005441 Ga0070700_100000086 Ga0070700_10000008628 375
80 3300005445 Ga0070708_100002475 Ga0070708_10000247512 375
81 3300005445 Ga0070708_100265151 Ga0070708_1002651512 375
82 3300005457 Ga0070662_100264576 Ga0070662_1002645762 375
83 3300005467 Ga0070706_100000481 Ga0070706_10000048115 375
84 3300005467 Ga0070706_100012133 Ga0070706_1000121337 375
85 3300005467 Ga0070706_100356626 Ga0070706_1003566261 375
86 3300005468 Ga0070707_100266558 Ga0070707_1002665582 375
87 3300005535 Ga0070684_100039982 Ga0070684_1000399823 375
88 3300005536 Ga0070697_100019740 Ga0070697_1000197406 375
89 3300005536 Ga0070697_100193387 Ga0070697_1001933872 375
90 3300005543 Ga0070672_100000062 Ga0070672_10000006239 375
91 3300005563 Ga0068855_100000328 Ga0068855_1000003286 375
92 3300005719 Ga0068861_100002881 Ga0068861_1000028819 375
93 3300005843 Ga0068860_100198569 Ga0068860_1001985692 375
94 3300005844 Ga0068862_100000997 Ga0068862_10000099710 375
95 3300005844 Ga0068862_100037951 Ga0068862_1000379514 375
96 3300006237 Ga0097621_100053457 Ga0097621_1000534572 375
97 3300006852 Ga0075433_10011078 Ga0075433_100110785 375
98 3300006871 Ga0075434_100002371 Ga0075434_10000237114 375
99 3300007076 Ga0075435_100001640 Ga0075435_10000164010 375
100 3300007265 Ga0099794_10023370 Ga0099794_100233703 375
101 3300009094 Ga0111539_10000033 Ga0111539_1000003346 375
102 3300009098 Ga0105245_10001376 Ga0105245_1000137610 375
103 3300009098 Ga0105245_10065632 Ga0105245_100656323 375
104 3300009147 Ga0114129_10012849 Ga0114129_100128492 375
105 3300009147 Ga0114129_10591159 Ga0114129_105911591 375
106 3300009176 Ga0105242_10005659 Ga0105242_100056595 375
107 3300010375 Ga0105239_10435168 Ga0105239_104351682 375
108 3300013306 Ga0163162_10038489 Ga0163162_100384893 375
109 3300013308 Ga0157375_10000003 Ga0157375_10000003176 375
110 3300014326 Ga0157380_10005951 Ga0157380_100059514 375
111 3300014745 Ga0157377_10090152 Ga0157377_100901522 375
112 3300014969 Ga0157376_10051758 Ga0157376_100517582 375
113 3300021358 Ga0213873_10000001 Ga0213873_100000011116 375
114 3300021384 Ga0213876_10000002 Ga0213876_10000002424 375
115 3300021384 Ga0213876_10001023 Ga0213876_1000102316 375
116 3300025315 Ga0207697_10006214 Ga0207697_100062142 375
117 3300025901 Ga0207688_10056288 Ga0207688_100562882 375
118 3300025903 Ga0207680_10005699 Ga0207680_100056994 375
119 3300025907 Ga0207645_10004642 Ga0207645_1000464210 375
120 3300025910 Ga0207684_10000239 Ga0207684_1000023950 375
121 3300025910 Ga0207684_10149285 Ga0207684_101492852 375
122 3300025917 Ga0207660_10015660 Ga0207660_100156605 375
123 3300025918 Ga0207662_10001328 Ga0207662_1000132810 375
124 3300025922 Ga0207646_10092413 Ga0207646_100924132 375
125 3300025922 Ga0207646_10103864 Ga0207646_101038642 375
126 3300025923 Ga0207681_10252922 Ga0207681_102529221 375
127 3300025927 Ga0207687_10000235 Ga0207687_1000023510 375
128 3300025932 Ga0207690_10177262 Ga0207690_101772622 375
129 3300025933 Ga0207706_10142382 Ga0207706_101423822 375
130 3300025934 Ga0207686_10016841 Ga0207686_100168414 375
131 3300025936 Ga0207670_10000624 Ga0207670_1000062410 375
132 3300025949 Ga0207667_10002517 Ga0207667_100025174 375
133 3300025960 Ga0207651_10009600 Ga0207651_100096003 375
134 3300025972 Ga0207668_10062281 Ga0207668_100622812 375
135 3300026023 Ga0207677_10000001 Ga0207677_10000001216 375
136 3300026035 Ga0207703_10000412 Ga0207703_100004122 375
137 3300026075 Ga0207708_10000035 Ga0207708_1000003527 375
138 3300026088 Ga0207641_10006428 Ga0207641_100064285 375
139 3300026118 Ga0207675_100006333 Ga0207675_1000063334 375
140 3300027907 Ga0207428_10000001 Ga0207428_10000001106 375
141 3300028380 Ga0268265_10000712 Ga0268265_1000071211 375
142 3300028380 Ga0268265_10085766 Ga0268265_100857662 375
143 3300028381 Ga0268264_10000421 Ga0268264_1000042116 375
144 3300028381 Ga0268264_10116603 Ga0268264_101166032 375
145 3300031249 Ga0265339_10001493 Ga0265339_100014938 375
146 3300031344 Ga0265316_10002085 Ga0265316_1000208516 375
147 3300031711 Ga0265314_10000001 Ga0265314_10000001748 375
148 3300035112 Ga0373932_0003279 Ga0373932_0003279_1821_2948 375
149 3300035170 Ga0373943_0010405 Ga0373943_0010405_290_1417 375
150 3300039437 Ga0436365_1097713 Ga0436365_1097713_16731_17861 375
151 3300039437 Ga0436365_1137746 Ga0436365_1137746_5243_6373 375
152 3300039437 Ga0436365_1426389 Ga0436365_1426389_27953_29083 375
153 3300039453 Ga0436362_0721240 Ga0436362_0721240_1801_2928 375
154 3300039453 Ga0436362_0887974 Ga0436362_0887974_53218_54348 375
155 3300042004 Ga0439445_0023975 Ga0439445_0023975_348_1475 375
156 3300042876 Ga0451577_0000031 Ga0451577_0000031_70994_72121 375
157 3300042876 Ga0451577_0392144 Ga0451577_0392144_18_1145 375
158 3300044712 Ga0453684_0001482 Ga0453684_0001482_39558_40685 375
159 3300044712 Ga0453684_0083229 Ga0453684_0083229_1655_2782 375
160 3300045051 Ga0451576_0011554 Ga0451576_0011554_5409_6536 375
161 3300045051 Ga0451576_0115113 Ga0451576_0115113_151_1278 375
162 3300046472 Ga0495580_0000984 Ga0495580_0000984_1822_2949 375
163 3300046515 Ga0495620_0000769 Ga0495620_0000769_15094_16224 375
164 3300046539 Ga0495621_0039388 Ga0495621_0039388_244_1371 375
165 3300046689 Ga0495613_0051545 Ga0495613_0051545_375_1502 375
166 3300048917 Ga0496114_0000024 Ga0496114_0000024_27451_28578 375
167 3300049589 Ga0501073_0009146 Ga0501073_0009146_4074_5204 375
168 3300049591 Ga0501075_0000664 Ga0501075_0000664_5751_6878 375
169 3300049742 Ga0501080_0009254 Ga0501080_0009254_7369_8496 375
170 3300049742 Ga0501080_0107887 Ga0501080_0107887_1390_2517 375
171 3300050507 nmdc:mga05p37_15729_c1 nmdc:mga05p37_15729_c1_7615_8742 375
172 3300050511 nmdc:mga08y16_1_c1 nmdc:mga08y16_1_c1_925803_927008 375
173 3300050512 nmdc:mga0n895_9302_c1 nmdc:mga0n895_9302_c1_1813_2940 375
174 3300050513 nmdc:mga0rr50_23373_c1 nmdc:mga0rr50_23373_c1_927_2054 375
175 3300050513 nmdc:mga0rr50_5206_c1 nmdc:mga0rr50_5206_c1_903_2030 375
176 3300050515 nmdc:mga0a205_2918_c1 nmdc:mga0a205_2918_c1_12137_13264 375
177 3300060353 Ga0501082_0001620 Ga0501082_0001620_12874_14001 375

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02687

FtsX

FtsX-like permease family

282

395

0.97

PF12704

MacB_PCD

MacB-like periplasmic core domain

42

251

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
7w7c-assembly1.cif.gz_B-2 heme exporter in the unliganded form 0.8562 246 375
7w78-assembly1.cif.gz_B heme exporter hrtba in complex with mg-amppnp 0.797 4 372
7w78-assembly1.cif.gz_B heme exporter hrtba in complex with mg-amppnp 0.7806 4 372
8i6q-assembly1.cif.gz_C cryo-em structure of pseudomonas aeruginosa ftse(wt)x complex in peptidisc 0.7733 237 367
8i6q-assembly1.cif.gz_A cryo-em structure of pseudomonas aeruginosa ftse(wt)x complex in peptidisc 0.7701 235 363
ID Description Score Start End Superfamily
1zyrM01 Mainly Beta;Beta Barrel;Dna-directed Rna Polymerase Ii 140kd Polypeptide; Chain: B; Domain 6;DNA-directed RNA polymerase, subunit 2, domain 6 0.5986 124 186 2.40.270.10
af_Q54FC6_9_94_1.10.340.70 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1; 0.5965 89 120 1.10.340.70
af_P9WPU1_16_80_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.5746 202 232 3.30.70.100
af_B4FWR8_33_161_2.40.40.10 Mainly Beta;Beta Barrel;Barwin-like endoglucanases;RlpA-like domain 0.4719 128 211 2.40.40.10
af_A4I7Z9_25_216_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.432 72 121 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A372DQ86-F1-model_v4 ABC transporter 0.9187 1 370 GO:0005886
AF-A0A480AKE0-F1-model_v4 DevC protein 0.9156 1 370 GO:0005886
AF-A0A1U7GPI2-F1-model_v4 ABC3 transporter permease C-terminal domain-containing protein 0.9147 1 375 GO:0005886
AF-A0A1C0V633-F1-model_v4 ABC transporter 0.9136 1 373 GO:0005886
AF-A0A2Z6D0L0-F1-model_v4 Heterocyst specific ABC-transporter, membrane spanning subunit DevC homolog 0.913 1 373 GO:0005886

Feature Viewer

pLDDT pTM Quality
88.61 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map