F269701

General Info

Members Datasets Scaffolds Average Seq Length
177 135 169 132

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100099628|Ga0070713_1000996282
Length 146
Sequence MQKWTILAGLLGWIMPLSDFHLRASIAVSDIQRAVVFYEGKLGLQALQSGPSAKIADGSRVYGSGGGPALNVYQSVTAGKSPATMATWYVDDIEQVVGQLTAAGVEFASYDEFDHDAKGITARAGGGRIAWFQDPDGNTFSIEADA

Samples

Sample ID Description Type Environment
1 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
2 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
3 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
4 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
84 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
87 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
88 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
89 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
90 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
91 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
92 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
93 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
94 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
95 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
96 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
97 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
98 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
99 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
100 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
101 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
102 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
103 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
104 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
105 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
106 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
107 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
108 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
109 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
110 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
111 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
112 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
113 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
114 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
115 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
116 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
117 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
118 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
119 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
120 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
122 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
123 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
124 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
125 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
126 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
127 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
128 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
129 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
130 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
131 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
132 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
133 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule
134 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
135 8054734606 Micromonospora hortensis NIE111 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.92
Metatranscriptomes 0.56
Isolates 4.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.13
Nodule 1.69
Rhizoplane 5.08
Rhizosphere 89.27
Stem 0
Stem Tuber 0
Unclassified 2.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100069654 3300005329 Bacteria 3280
2 Ga0070683_100111711 3300005329 Bacteria 2578
3 Ga0070683_102105997 3300005329 Bacteria 542
4 Ga0070670_100153675 3300005331 Bacteria 1992
5 Ga0070682_101020414 3300005337 Bacteria 688
6 Ga0068868_100000876 3300005338 Bacteria 20409
7 Ga0070691_10945593 3300005341 Bacteria 534
8 Ga0070668_100002825 3300005347 Bacteria 12786
9 Ga0070668_100121161 3300005347 Bacteria 2091
10 Ga0070669_101012461 3300005353 Bacteria 713
11 Ga0070669_101499671 3300005353 Bacteria 586
12 Ga0070675_100001247 3300005354 Bacteria 18559
13 Ga0070674_100470299 3300005356 Bacteria 1041
14 Ga0070673_100679357 3300005364 Bacteria 944
15 Ga0070659_100024122 3300005366 Bacteria 4661
16 Ga0070709_10333628 3300005434 Bacteria 1116
17 Ga0070714_100000110 3300005435 Bacteria 68074
18 Ga0070714_100010581 3300005435 Bacteria 7296
19 Ga0070713_100091198 3300005436 Bacteria 2621
20 Ga0070713_100099628 3300005436 Bacteria 2514
21 Ga0070713_100105041 3300005436 Bacteria 2453
22 Ga0070700_100019562 3300005441 Bacteria 3910
23 Ga0070663_101031864 3300005455 Bacteria 716
24 Ga0070678_100080789 3300005456 Bacteria 2463
25 Ga0070662_100024715 3300005457 Bacteria 4143
26 Ga0070681_11011936 3300005458 Bacteria 751
27 Ga0070684_100004627 3300005535 Bacteria 10495
28 Ga0070684_100136423 3300005535 Bacteria 2217
29 Ga0070684_101649176 3300005535 Bacteria 605
30 Ga0070672_100558918 3300005543 Bacteria 994
31 Ga0070665_100520705 3300005548 Bacteria 1201
32 Ga0068855_100314848 3300005563 Bacteria 1731
33 Ga0070664_100009980 3300005564 Bacteria 7696
34 Ga0070664_100070675 3300005564 Bacteria 2990
35 Ga0068857_100017052 3300005577 Bacteria 6362
36 Ga0068854_100089038 3300005578 Bacteria 2293
37 Ga0068856_100157045 3300005614 Bacteria 2285
38 Ga0070702_100368071 3300005615 Bacteria 1018
39 Ga0068852_100105042 3300005616 Bacteria 2558
40 Ga0068864_100116319 3300005618 Bacteria 2386
41 Ga0068861_100005540 3300005719 Bacteria 8552
42 Ga0068861_100033482 3300005719 Bacteria 3791
43 Ga0068851_10033720 3300005834 Bacteria 2553
44 Ga0068863_101494707 3300005841 Bacteria 684
45 Ga0068860_100356654 3300005843 Bacteria 1440
46 Ga0068862_100302944 3300005844 Bacteria 1471
47 Ga0081455_10245686 3300005937 Bacteria 1312
48 Ga0081455_10254347 3300005937 Unclassified 1283
49 Ga0070717_10454068 3300006028 Bacteria 1155
50 Ga0070717_10905254 3300006028 Bacteria 803
51 Ga0075432_10211113 3300006058 Bacteria 772
52 Ga0105240_10068199 3300009093 Bacteria 4406
53 Ga0105240_10411370 3300009093 Bacteria 1521
54 Ga0111539_10007943 3300009094 Bacteria 13528
55 Ga0105245_10097868 3300009098 Bacteria 2710
56 Ga0105245_11074450 3300009098 Bacteria 851
57 Ga0114129_10089523 3300009147 Bacteria 4267
58 Ga0105241_11397286 3300009174 Bacteria 670
59 Ga0105237_10144688 3300009545 Bacteria 2372
60 Ga0105237_11416890 3300009545 Bacteria 701
61 Ga0105238_10419453 3300009551 Bacteria 1333
62 Ga0105239_10307151 3300010375 Bacteria 1787
63 Ga0105246_10294413 3300011119 Bacteria 1307
64 Ga0157369_11858036 3300013105 Unclassified 612
65 Ga0157374_10258201 3300013296 Bacteria 1716
66 Ga0157372_10000031 3300013307 Bacteria 178827
67 Ga0157375_11198380 3300013308 Bacteria 891
68 Ga0157380_10162193 3300014326 Bacteria 1944
69 Ga0157379_10123334 3300014968 Bacteria 2332
70 Ga0206350_10324999 3300020080 Bacteria 677
71 Ga0207688_10328985 3300025901 Bacteria 939
72 Ga0207699_10476529 3300025906 Bacteria 898
73 Ga0207695_11565656 3300025913 Bacteria 540
74 Ga0207671_10569462 3300025914 Bacteria 903
75 Ga0207649_10144825 3300025920 Bacteria 1630
76 Ga0207681_11302131 3300025923 Bacteria 610
77 Ga0207694_10057364 3300025924 Bacteria 3027
78 Ga0207694_10442350 3300025924 Bacteria 1085
79 Ga0207687_10071121 3300025927 Bacteria 2485
80 Ga0207700_10066224 3300025928 Bacteria 2760
81 Ga0207700_10069834 3300025928 Bacteria 2698
82 Ga0207700_11678286 3300025928 Unclassified 561
83 Ga0207664_10140080 3300025929 Bacteria 2045
84 Ga0207664_11911009 3300025929 Bacteria 516
85 Ga0207690_11078545 3300025932 Bacteria 669
86 Ga0207706_10005634 3300025933 Bacteria 11666
87 Ga0207691_11515256 3300025940 Unclassified 548
88 Ga0207661_10014238 3300025944 Bacteria 5824
89 Ga0207661_10707977 3300025944 Bacteria 926
90 Ga0207661_11632082 3300025944 Unclassified 590
91 Ga0207679_10042664 3300025945 Bacteria 3261
92 Ga0207668_10002628 3300025972 Bacteria 10514
93 Ga0207668_10121443 3300025972 Bacteria 1979
94 Ga0207640_10062533 3300025981 Bacteria 2470
95 Ga0207678_10013239 3300026067 Bacteria 7238
96 Ga0207708_10026203 3300026075 Bacteria 4410
97 Ga0207676_10422221 3300026095 Bacteria 1251
98 Ga0207674_10005635 3300026116 Bacteria 14848
99 Ga0207674_11702303 3300026116 Bacteria 599
100 Ga0207675_100049465 3300026118 Bacteria 3924
101 Ga0207683_10151250 3300026121 Bacteria 2095
102 Ga0207698_10349282 3300026142 Bacteria 1396
103 Ga0207428_10048785 3300027907 Bacteria 3395
104 Ga0268265_10284350 3300028380 Bacteria 1481
105 Ga0268264_10329873 3300028381 Bacteria 1446
106 Ga0307509_10313358 3300031507 Bacteria 1310
107 Ga0307408_101039394 3300031548 Bacteria 757
108 Ga0307408_101744720 3300031548 Bacteria 594
109 Ga0307405_11866617 3300031731 Bacteria 535
110 Ga0307413_10180395 3300031824 Bacteria 1505
111 Ga0307413_11288761 3300031824 Bacteria 639
112 Ga0307413_11552338 3300031824 Bacteria 587
113 Ga0307406_10074515 3300031901 Bacteria 2235
114 Ga0307407_10754290 3300031903 Bacteria 737
115 Ga0307412_10544595 3300031911 Bacteria 974
116 Ga0307409_100909223 3300031995 Bacteria 894
117 Ga0307416_100388311 3300032002 Bacteria 1429
118 Ga0307416_101014605 3300032002 Bacteria 933
119 Ga0307415_100121811 3300032126 Bacteria 1957
120 Ga0307415_100141710 3300032126 Bacteria 1837
121 Ga0307415_100240181 3300032126 Bacteria 1465
122 Ga0307415_100349231 3300032126 Bacteria 1244
123 Ga0307415_100546872 3300032126 Bacteria 1021
124 Ga0373954_0516485 3300035118 Bacteria 592
125 Ga0436364_0231367 3300037853 Bacteria 1109
126 Ga0436363_0289499 3300039450 Bacteria 602
127 Ga0451853_2881582 3300041512 Bacteria 622
128 Ga0439431_0018449 3300041997 Bacteria 1651
129 Ga0439434_0034800 3300042435 Bacteria 1539
130 Ga0466972_0236517 3300044658 Bacteria 855
131 Ga0466972_0316713 3300044658 Bacteria 729
132 Ga0466966_0067867 3300044684 Unclassified 2239
133 Ga0466963_0061912 3300044694 Bacteria 2503
134 Ga0466964_0012025 3300044706 Bacteria 3273
135 Ga0466970_0303125 3300044765 Bacteria 901
136 Ga0466957_0287946 3300044842 Bacteria 1101
137 Ga0466959_0433533 3300045049 Bacteria 892
138 Ga0466958_0550710 3300045836 Unclassified 749
139 Ga0466967_0011238 3300045976 Bacteria 6766
140 Ga0466967_0011623 3300045976 Bacteria 6684
141 Ga0466967_0044900 3300045976 Bacteria 3837
142 Ga0466967_0501390 3300045976 Bacteria 1191
143 Ga0466967_1541384 3300045976 Bacteria 662
144 Ga0495638_0340132 3300046460 Bacteria 796
145 Ga0495672_0009948 3300047320 Bacteria 6827
146 Ga0496100_0315914 3300048903 Bacteria 1172
147 Ga0496102_0226474 3300048905 Bacteria 1763
148 Ga0496104_0024511 3300048907 Bacteria 5550
149 Ga0496110_0067481 3300048913 Bacteria 3165
150 Ga0496112_0895172 3300048915 Bacteria 810
151 Ga0496113_0006605 3300048916 Bacteria 7375
152 Ga0496113_0021076 3300048916 Bacteria 4594
153 Ga0496113_0975426 3300048916 Bacteria 668
154 Ga0496114_0655847 3300048917 Bacteria 923
155 Ga0501047_0012411 3300049581 Bacteria 8065
156 Ga0501047_0507518 3300049581 Bacteria 1032
157 Ga0501047_0882265 3300049581 Bacteria 708
158 Ga0501080_1484666 3300049742 Bacteria 576
159 Ga0501044_0318330 3300049823 Bacteria 1481
160 nmdc:mga05p37_68713_c1 3300050507 Bacteria 4357
161 nmdc:mga09592_1166936_c1 3300050508 Bacteria 638
162 nmdc:mga09592_1488569_c1 3300050508 Bacteria 551
163 nmdc:mga08y16_9049_c1 3300050511 Bacteria 10454
164 Ga0495601_0202209 3300053077 Bacteria 1298
165 Ga0500616_0000079 3300053153 Bacteria 200717
166 Ga0500645_010585 3300053730 Bacteria 3044
167 Ga0590075_021395 3300059424 Bacteria 1614
168 Ga0590077_016406 3300059426 Bacteria 1554
169 Ga0466962_0045395 3300061719 Bacteria 2100

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048903 Ga0496100_0315914 Ga0496100_0315914_803_1162 111
2 3300046460 Ga0495638_0340132 Ga0495638_0340132_368_727 119
3 3300059424 Ga0590075_021395 Ga0590075_021395_521_919 125
4 3300059426 Ga0590077_016406 Ga0590077_016406_306_704 125
5 3300005841 Ga0068863_101494707 Ga0068863_1014947072 127
6 3300014968 Ga0157379_10123334 Ga0157379_101233343 127
7 3300048907 Ga0496104_0024511 Ga0496104_0024511_3470_3877 127
8 iso_pu_bacteria 2675903059 2676479744 128
9 iso_pu_bacteria 2818991462 2819690103 128
10 iso_pu_bacteria 2818991469 2819726339 128
11 iso_pu_bacteria 2929219909 2929224132 128
12 iso_pu_bacteria 8003830390 8003836441 128
13 iso_pu_bacteria 8054609563 8054610970 128
14 iso_pu_bacteria 8054727385 8054731323 128
15 iso_pu_bacteria 8054734606 8054735713 128
16 3300005435 Ga0070714_100010581 Ga0070714_1000105817 130
17 3300005436 Ga0070713_100105041 Ga0070713_1001050412 130
18 3300025929 Ga0207664_11911009 Ga0207664_119110091 130
19 3300053077 Ga0495601_0202209 Ga0495601_0202209_758_1150 130
20 3300020080 Ga0206350_10324999 Ga0206350_103249992 131
21 3300048905 Ga0496102_0226474 Ga0496102_0226474_680_1075 131
22 3300048916 Ga0496113_0006605 Ga0496113_0006605_2266_2661 131
23 3300005329 Ga0070683_100069654 Ga0070683_1000696543 132
24 3300005329 Ga0070683_100111711 Ga0070683_1001117111 132
25 3300005329 Ga0070683_102105997 Ga0070683_1021059971 132
26 3300005331 Ga0070670_100153675 Ga0070670_1001536753 132
27 3300005337 Ga0070682_101020414 Ga0070682_1010204141 132
28 3300005338 Ga0068868_100000876 Ga0068868_1000008769 132
29 3300005341 Ga0070691_10945593 Ga0070691_109455931 132
30 3300005347 Ga0070668_100002825 Ga0070668_1000028254 132
31 3300005347 Ga0070668_100121161 Ga0070668_1001211612 132
32 3300005353 Ga0070669_101012461 Ga0070669_1010124611 132
33 3300005353 Ga0070669_101499671 Ga0070669_1014996712 132
34 3300005354 Ga0070675_100001247 Ga0070675_1000012472 132
35 3300005356 Ga0070674_100470299 Ga0070674_1004702992 132
36 3300005364 Ga0070673_100679357 Ga0070673_1006793571 132
37 3300005366 Ga0070659_100024122 Ga0070659_1000241224 132
38 3300005434 Ga0070709_10333628 Ga0070709_103336283 132
39 3300005435 Ga0070714_100000110 Ga0070714_10000011064 132
40 3300005436 Ga0070713_100091198 Ga0070713_1000911982 132
41 3300005436 Ga0070713_100099628 Ga0070713_1000996282 132
42 3300005441 Ga0070700_100019562 Ga0070700_1000195625 132
43 3300005455 Ga0070663_101031864 Ga0070663_1010318641 132
44 3300005456 Ga0070678_100080789 Ga0070678_1000807892 132
45 3300005457 Ga0070662_100024715 Ga0070662_1000247155 132
46 3300005458 Ga0070681_11011936 Ga0070681_110119361 132
47 3300005535 Ga0070684_100004627 Ga0070684_1000046276 132
48 3300005535 Ga0070684_100136423 Ga0070684_1001364231 132
49 3300005535 Ga0070684_101649176 Ga0070684_1016491761 132
50 3300005543 Ga0070672_100558918 Ga0070672_1005589182 132
51 3300005548 Ga0070665_100520705 Ga0070665_1005207051 132
52 3300005563 Ga0068855_100314848 Ga0068855_1003148482 132
53 3300005564 Ga0070664_100009980 Ga0070664_1000099803 132
54 3300005564 Ga0070664_100070675 Ga0070664_1000706753 132
55 3300005577 Ga0068857_100017052 Ga0068857_1000170525 132
56 3300005578 Ga0068854_100089038 Ga0068854_1000890382 132
57 3300005614 Ga0068856_100157045 Ga0068856_1001570451 132
58 3300005615 Ga0070702_100368071 Ga0070702_1003680712 132
59 3300005616 Ga0068852_100105042 Ga0068852_1001050424 132
60 3300005618 Ga0068864_100116319 Ga0068864_1001163194 132
61 3300005719 Ga0068861_100005540 Ga0068861_1000055402 132
62 3300005719 Ga0068861_100033482 Ga0068861_1000334823 132
63 3300005834 Ga0068851_10033720 Ga0068851_100337204 132
64 3300005843 Ga0068860_100356654 Ga0068860_1003566542 132
65 3300005844 Ga0068862_100302944 Ga0068862_1003029442 132
66 3300005937 Ga0081455_10245686 Ga0081455_102456862 132
67 3300005937 Ga0081455_10254347 Ga0081455_102543471 132
68 3300006028 Ga0070717_10454068 Ga0070717_104540681 132
69 3300006028 Ga0070717_10905254 Ga0070717_109052542 132
70 3300006058 Ga0075432_10211113 Ga0075432_102111132 132
71 3300009093 Ga0105240_10068199 Ga0105240_100681995 132
72 3300009093 Ga0105240_10411370 Ga0105240_104113702 132
73 3300009094 Ga0111539_10007943 Ga0111539_100079436 132
74 3300009098 Ga0105245_10097868 Ga0105245_100978683 132
75 3300009098 Ga0105245_11074450 Ga0105245_110744502 132
76 3300009147 Ga0114129_10089523 Ga0114129_100895235 132
77 3300009174 Ga0105241_11397286 Ga0105241_113972861 132
78 3300009545 Ga0105237_10144688 Ga0105237_101446883 132
79 3300009545 Ga0105237_11416890 Ga0105237_114168902 132
80 3300009551 Ga0105238_10419453 Ga0105238_104194532 132
81 3300010375 Ga0105239_10307151 Ga0105239_103071512 132
82 3300011119 Ga0105246_10294413 Ga0105246_102944132 132
83 3300013105 Ga0157369_11858036 Ga0157369_118580361 132
84 3300013296 Ga0157374_10258201 Ga0157374_102582013 132
85 3300013307 Ga0157372_10000031 Ga0157372_10000031117 132
86 3300013308 Ga0157375_11198380 Ga0157375_111983802 132
87 3300014326 Ga0157380_10162193 Ga0157380_101621933 132
88 3300025901 Ga0207688_10328985 Ga0207688_103289851 132
89 3300025906 Ga0207699_10476529 Ga0207699_104765291 132
90 3300025913 Ga0207695_11565656 Ga0207695_115656561 132
91 3300025914 Ga0207671_10569462 Ga0207671_105694622 132
92 3300025920 Ga0207649_10144825 Ga0207649_101448253 132
93 3300025923 Ga0207681_11302131 Ga0207681_113021311 132
94 3300025924 Ga0207694_10057364 Ga0207694_100573643 132
95 3300025924 Ga0207694_10442350 Ga0207694_104423502 132
96 3300025927 Ga0207687_10071121 Ga0207687_100711212 132
97 3300025928 Ga0207700_10066224 Ga0207700_100662242 132
98 3300025928 Ga0207700_10069834 Ga0207700_100698341 132
99 3300025928 Ga0207700_11678286 Ga0207700_116782861 132
100 3300025929 Ga0207664_10140080 Ga0207664_101400804 132
101 3300025932 Ga0207690_11078545 Ga0207690_110785451 132
102 3300025933 Ga0207706_10005634 Ga0207706_100056343 132
103 3300025940 Ga0207691_11515256 Ga0207691_115152561 132
104 3300025944 Ga0207661_10014238 Ga0207661_100142382 132
105 3300025944 Ga0207661_10707977 Ga0207661_107079771 132
106 3300025944 Ga0207661_11632082 Ga0207661_116320821 132
107 3300025945 Ga0207679_10042664 Ga0207679_100426641 132
108 3300025972 Ga0207668_10002628 Ga0207668_100026289 132
109 3300025972 Ga0207668_10121443 Ga0207668_101214433 132
110 3300025981 Ga0207640_10062533 Ga0207640_100625332 132
111 3300026067 Ga0207678_10013239 Ga0207678_100132391 132
112 3300026075 Ga0207708_10026203 Ga0207708_100262032 132
113 3300026095 Ga0207676_10422221 Ga0207676_104222212 132
114 3300026116 Ga0207674_10005635 Ga0207674_100056355 132
115 3300026116 Ga0207674_11702303 Ga0207674_117023031 132
116 3300026118 Ga0207675_100049465 Ga0207675_1000494652 132
117 3300026121 Ga0207683_10151250 Ga0207683_101512504 132
118 3300026142 Ga0207698_10349282 Ga0207698_103492822 132
119 3300027907 Ga0207428_10048785 Ga0207428_100487854 132
120 3300028380 Ga0268265_10284350 Ga0268265_102843502 132
121 3300028381 Ga0268264_10329873 Ga0268264_103298732 132
122 3300031507 Ga0307509_10313358 Ga0307509_103133581 132
123 3300031548 Ga0307408_101039394 Ga0307408_1010393941 132
124 3300031548 Ga0307408_101744720 Ga0307408_1017447201 132
125 3300031731 Ga0307405_11866617 Ga0307405_118666171 132
126 3300031824 Ga0307413_10180395 Ga0307413_101803951 132
127 3300031824 Ga0307413_11288761 Ga0307413_112887612 132
128 3300031824 Ga0307413_11552338 Ga0307413_115523381 132
129 3300031901 Ga0307406_10074515 Ga0307406_100745153 132
130 3300031903 Ga0307407_10754290 Ga0307407_107542902 132
131 3300031911 Ga0307412_10544595 Ga0307412_105445952 132
132 3300031995 Ga0307409_100909223 Ga0307409_1009092232 132
133 3300032002 Ga0307416_100388311 Ga0307416_1003883112 132
134 3300032002 Ga0307416_101014605 Ga0307416_1010146052 132
135 3300032126 Ga0307415_100121811 Ga0307415_1001218112 132
136 3300032126 Ga0307415_100141710 Ga0307415_1001417102 132
137 3300032126 Ga0307415_100240181 Ga0307415_1002401811 132
138 3300032126 Ga0307415_100349231 Ga0307415_1003492311 132
139 3300032126 Ga0307415_100546872 Ga0307415_1005468722 132
140 3300035118 Ga0373954_0516485 Ga0373954_0516485_121_519 132
141 3300037853 Ga0436364_0231367 Ga0436364_0231367_324_722 132
142 3300039450 Ga0436363_0289499 Ga0436363_0289499_152_550 132
143 3300041512 Ga0451853_2881582 Ga0451853_2881582_141_539 132
144 3300041997 Ga0439431_0018449 Ga0439431_0018449_22_420 132
145 3300042435 Ga0439434_0034800 Ga0439434_0034800_160_558 132
146 3300044658 Ga0466972_0236517 Ga0466972_0236517_345_743 132
147 3300044658 Ga0466972_0316713 Ga0466972_0316713_319_717 132
148 3300044684 Ga0466966_0067867 Ga0466966_0067867_502_900 132
149 3300044694 Ga0466963_0061912 Ga0466963_0061912_222_620 132
150 3300044706 Ga0466964_0012025 Ga0466964_0012025_2083_2481 132
151 3300044765 Ga0466970_0303125 Ga0466970_0303125_36_434 132
152 3300044842 Ga0466957_0287946 Ga0466957_0287946_99_500 132
153 3300045049 Ga0466959_0433533 Ga0466959_0433533_33_431 132
154 3300045836 Ga0466958_0550710 Ga0466958_0550710_101_499 132
155 3300045976 Ga0466967_0011238 Ga0466967_0011238_4755_5153 132
156 3300045976 Ga0466967_0011623 Ga0466967_0011623_5541_5939 132
157 3300045976 Ga0466967_0044900 Ga0466967_0044900_321_719 132
158 3300045976 Ga0466967_0501390 Ga0466967_0501390_598_996 132
159 3300045976 Ga0466967_1541384 Ga0466967_1541384_111_509 132
160 3300047320 Ga0495672_0009948 Ga0495672_0009948_6167_6565 132
161 3300048913 Ga0496110_0067481 Ga0496110_0067481_1446_1883 132
162 3300048915 Ga0496112_0895172 Ga0496112_0895172_242_640 132
163 3300048916 Ga0496113_0021076 Ga0496113_0021076_416_814 132
164 3300048916 Ga0496113_0975426 Ga0496113_0975426_65_502 132
165 3300048917 Ga0496114_0655847 Ga0496114_0655847_419_817 132
166 3300049581 Ga0501047_0012411 Ga0501047_0012411_3665_4063 132
167 3300049581 Ga0501047_0507518 Ga0501047_0507518_12_410 132
168 3300049581 Ga0501047_0882265 Ga0501047_0882265_14_412 132
169 3300049742 Ga0501080_1484666 Ga0501080_1484666_41_439 132
170 3300049823 Ga0501044_0318330 Ga0501044_0318330_214_612 132
171 3300050507 nmdc:mga05p37_68713_c1 nmdc:mga05p37_68713_c1_3167_3565 132
172 3300050508 nmdc:mga09592_1166936_c1 nmdc:mga09592_1166936_c1_32_430 132
173 3300050508 nmdc:mga09592_1488569_c1 nmdc:mga09592_1488569_c1_38_436 132
174 3300050511 nmdc:mga08y16_9049_c1 nmdc:mga08y16_9049_c1_3480_3878 132
175 3300053153 Ga0500616_0000079 Ga0500616_0000079_188785_189183 132
176 3300053730 Ga0500645_010585 Ga0500645_010585_78_476 132
177 3300061719 Ga0466962_0045395 Ga0466962_0045395_1094_1501 132

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

20

142

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ump-assembly1.cif.gz_B crystal structure of tnms3, an antibiotic binding protein from streptomyces sp. cb03234 0.7733 11 130
3ghj-assembly1.cif.gz_A-2 crystal structure from the mobile metagenome of halifax harbour sewage outfall: integron cassette protein hfx_cass4 0.7713 9 130
4n04-assembly1.cif.gz_A the crystal structure of glyoxalase / bleomycin resistance protein from catenulispora acidiphila dsm 44928 0.7682 7 130
5umq-assembly1.cif.gz_A crystal structure of tnms1, an antibiotic binding protein from streptomyces sp. cb03234 0.7661 11 129
2qqz-assembly1.cif.gz_B crystal structure of putative glyoxalase family protein from bacillus anthracis 0.7656 11 132
ID Description Score Start End Superfamily
3ghjA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8516 9 130 3.10.180.10
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8298 73 128 3.30.720.110
3itwB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8153 73 129 3.30.720.110
3ghjA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8043 9 130 3.10.180.10
3bt3B02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.794 75 132 3.30.720.110
ID Description Score Start End GO Terms
AF-T5KEW6-F1-model_v4 N-acetyltransferase domain-containing protein 0.9851 9 132 GO:0005737
GO:0008999
GO:1990189
AF-A0A7V9HS78-F1-model_v4 VOC domain-containing protein 0.9483 73 130
AF-A0A0K2YJW3-F1-model_v4 Glyoxalase family protein 0.9349 9 132
AF-G7GY27-F1-model_v4 VOC domain-containing protein 0.9334 7 130
AF-A0A2X0IK73-F1-model_v4 VOC family protein 0.9321 1 132

Feature Viewer

pLDDT pTM Quality
91.95 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map