F269417
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 177 | 150 | 354 | 313 |
Family's Representative Sequence
| Representative Sequence | 3300003791|Ga0055530_10000004|Ga0055530_1000000422 |
| Length | 346 |
| Sequence | MKRRFKNKKGALIMDITLNHGPEIRFARPLKVALVGECMIEMRGEPGAAIMQTFGGDTLNTAVYLARLNPRGAVALDYMTAVGSDAFSVAMRRSWLDEGIGDVHVRVIEDALPGLYFIQTDPRGERRFLYWRGEAAARRMFDGPEADTLLNGLADYDYVYLSGISLAILTPEGRQRLIQALHLARRGGTRIVFDNNYRPHLWPDPEAARQVYRELLRLTDLALITWEDDAILFGYRDTDALFSAYAQEGVGEVALKRGADSCLIQCPAGRFEVPAQHVAHVIDTTAAGDSFNAAYLACRLRGGDPEQAARWGHRLAAQVVQYRGALIPQAAMPKMGASSLSSVAQV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 4 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 5 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 6 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 9 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 10 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 11 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 14 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 16 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 17 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 20 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 21 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 22 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 23 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 24 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 25 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 26 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 27 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 28 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 29 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 30 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 31 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 32 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 33 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 34 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 35 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 36 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 37 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 45 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 46 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 47 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 48 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 49 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 50 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 51 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 52 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 53 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 54 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 55 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 56 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 57 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 58 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 59 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 60 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 61 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 62 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 63 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 64 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 65 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 66 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 67 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 68 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 69 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 70 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 71 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 72 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 73 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 74 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 75 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 76 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 77 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 78 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 79 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 80 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 81 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 82 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 83 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 84 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 85 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 86 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 87 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 88 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 89 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 90 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 91 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 92 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 94 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 95 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 96 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 97 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 98 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 99 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 100 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 101 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 102 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 103 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 104 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 105 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 106 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 107 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 108 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 109 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 110 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 111 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 112 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 113 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 114 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 115 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 116 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 117 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 118 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 119 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 120 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 121 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 122 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 123 | 2508501050 | Microvirga lupini Lut6 | Isolate | Nodule |
| 124 | 2508501114 | Microvirga lotononidis WSM3557 | Isolate | Nodule |
| 125 | 2510065058 | Pseudomonas oleovorans MOIL14HWK12 | Isolate | Rhizosphere |
| 126 | 2511231221 | Azospirillum lipoferum 4B | Isolate | Rhizosphere |
| 127 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 128 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 129 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 130 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 131 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 132 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 133 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 134 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 135 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 136 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 137 | 2775506901 | Microvirga ossetica V5/3m | Isolate | Unclassified |
| 138 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 139 | 2835312727 | Microvirga calopogonii CCBAU 65841 | Isolate | Nodule |
| 140 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 141 | 2894232714 | Microvirga tunisiensis Lmie10 | Isolate | Nodule |
| 142 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 143 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 144 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 145 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 146 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 147 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 148 | 8054002106 | Azospirillum lipoferum 59b | Isolate | Unclassified |
| 149 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 150 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 83.62 |
| Metatranscriptomes | 0 |
| Isolates | 16.38 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.34 |
| Nodule | 2.82 |
| Rhizoplane | 4.52 |
| Rhizosphere | 74.01 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.13 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0055530_10000004 | 3300003791 | Bacteria | 231465 |
| 2 | SwRhRL2b_contig_1773400 | 2162886007 | Bacteria | 24667 |
| 3 | rootH1_10300375 | 3300003323 | Bacteria | 1488 |
| 4 | JGI25404J52841_10001507 | 3300003659 | Bacteria | 4118 |
| 5 | Ga0055540_1000017 | 3300003792 | Bacteria | 231465 |
| 6 | Ga0065714_10002302 | 3300005288 | Bacteria | 45300 |
| 7 | Ga0065714_10066456 | 3300005288 | Bacteria | 6814 |
| 8 | Ga0065704_10000374 | 3300005289 | Bacteria | 26179 |
| 9 | Ga0070709_10005503 | 3300005434 | Bacteria | 6861 |
| 10 | Ga0070713_100039453 | 3300005436 | Bacteria | 3832 |
| 11 | Ga0070710_10001402 | 3300005437 | Bacteria | 11371 |
| 12 | Ga0070711_100000968 | 3300005439 | Bacteria | 15186 |
| 13 | Ga0070711_100030822 | 3300005439 | Bacteria | 3555 |
| 14 | Ga0070665_100424169 | 3300005548 | Bacteria | 1339 |
| 15 | Ga0081540_1004950 | 3300005983 | Bacteria | 10015 |
| 16 | Ga0081540_1011886 | 3300005983 | Bacteria | 5779 |
| 17 | Ga0070717_10212762 | 3300006028 | Bacteria | 1697 |
| 18 | Ga0075365_10001620 | 3300006038 | Bacteria | 10389 |
| 19 | Ga0075365_10212028 | 3300006038 | Bacteria | 1358 |
| 20 | Ga0075432_10000187 | 3300006058 | Bacteria | 15933 |
| 21 | Ga0070716_100042147 | 3300006173 | Bacteria | 2547 |
| 22 | Ga0070712_100041415 | 3300006175 | Bacteria | 3163 |
| 23 | Ga0075367_10041989 | 3300006178 | Bacteria | 2675 |
| 24 | Ga0075431_100008143 | 3300006847 | Bacteria | 10473 |
| 25 | Ga0105245_10335836 | 3300009098 | Bacteria | 1493 |
| 26 | Ga0105238_10251067 | 3300009551 | Unclassified | 1747 |
| 27 | Ga0105246_10023696 | 3300011119 | Bacteria | 3975 |
| 28 | Ga0157370_10059663 | 3300013104 | Bacteria | 3625 |
| 29 | Ga0157380_10067109 | 3300014326 | Bacteria | 2887 |
| 30 | Ga0182008_10002362 | 3300014497 | Bacteria | 11878 |
| 31 | Ga0213872_10000354 | 3300021361 | Bacteria | 38778 |
| 32 | Ga0213876_10001868 | 3300021384 | Bacteria | 12668 |
| 33 | Ga0213875_10069944 | 3300021388 | Bacteria | 1638 |
| 34 | Ga0209676_1001065 | 3300025292 | Bacteria | 31352 |
| 35 | Ga0209564_1005031 | 3300025295 | Bacteria | 7739 |
| 36 | Ga0209050_1000037 | 3300025298 | Bacteria | 415612 |
| 37 | Ga0209051_1000040 | 3300025303 | Bacteria | 315055 |
| 38 | Ga0207692_10000752 | 3300025898 | Bacteria | 11457 |
| 39 | Ga0207688_10033641 | 3300025901 | Bacteria | 2836 |
| 40 | Ga0207699_10001104 | 3300025906 | Bacteria | 12746 |
| 41 | Ga0207663_10001780 | 3300025916 | Bacteria | 10154 |
| 42 | Ga0207663_10386040 | 3300025916 | Bacteria | 1068 |
| 43 | Ga0207694_10146088 | 3300025924 | Bacteria | 1904 |
| 44 | Ga0207700_10026146 | 3300025928 | Bacteria | 4066 |
| 45 | Ga0207665_10054574 | 3300025939 | Bacteria | 2695 |
| 46 | Ga0207668_10145750 | 3300025972 | Bacteria | 1827 |
| 47 | Ga0207677_10215446 | 3300026023 | Bacteria | 1536 |
| 48 | Ga0207708_10090497 | 3300026075 | Bacteria | 2359 |
| 49 | Ga0207428_10003576 | 3300027907 | Bacteria | 15003 |
| 50 | Ga0316177_1183538 | 3300030731 | Bacteria | 2645 |
| 51 | Ga0307405_10017000 | 3300031731 | Bacteria | 3982 |
| 52 | Ga0307405_10038479 | 3300031731 | Bacteria | 2884 |
| 53 | Ga0307405_10039053 | 3300031731 | Bacteria | 2866 |
| 54 | Ga0307406_10022409 | 3300031901 | Bacteria | 3747 |
| 55 | Ga0307406_10075068 | 3300031901 | Bacteria | 2229 |
| 56 | Ga0307407_10037098 | 3300031903 | Bacteria | 2691 |
| 57 | Ga0307412_10003878 | 3300031911 | Bacteria | 8322 |
| 58 | Ga0307412_10015239 | 3300031911 | Bacteria | 4551 |
| 59 | Ga0307409_100098240 | 3300031995 | Bacteria | 2421 |
| 60 | Ga0307416_100187689 | 3300032002 | Bacteria | 1945 |
| 61 | Ga0307414_10166674 | 3300032004 | Bacteria | 1756 |
| 62 | Ga0307411_10017515 | 3300032005 | Bacteria | 4085 |
| 63 | Ga0373947_0182918 | 3300035725 | Unclassified | 1365 |
| 64 | Ga0316584_0115865 | 3300036712 | Bacteria | 2004 |
| 65 | Ga0316584_0225758 | 3300036712 | Bacteria | 1374 |
| 66 | Ga0436364_1123631 | 3300037853 | Bacteria | 1175 |
| 67 | Ga0436365_0074963 | 3300039437 | Bacteria | 7353 |
| 68 | Ga0436365_0367152 | 3300039437 | Bacteria | 1631 |
| 69 | Ga0436365_1885634 | 3300039437 | Bacteria | 6218 |
| 70 | Ga0436360_0070268 | 3300039438 | Bacteria | 2626 |
| 71 | Ga0436361_0875900 | 3300039447 | Bacteria | 32857 |
| 72 | Ga0436362_0823522 | 3300039453 | Bacteria | 3159 |
| 73 | Ga0439438_000029 | 3300041405 | Bacteria | 82129 |
| 74 | Ga0439438_000144 | 3300041405 | Bacteria | 32021 |
| 75 | Ga0439466_0007520 | 3300041411 | Bacteria | 4120 |
| 76 | Ga0439465_0099748 | 3300041413 | Bacteria | 1002 |
| 77 | Ga0439432_001569 | 3300042006 | Bacteria | 8577 |
| 78 | Ga0439451_000344 | 3300042009 | Bacteria | 9013 |
| 79 | Ga0439451_000409 | 3300042009 | Bacteria | 8376 |
| 80 | Ga0439452_003630 | 3300042010 | Bacteria | 5362 |
| 81 | Ga0439456_003820 | 3300042013 | Bacteria | 3061 |
| 82 | Ga0439456_017658 | 3300042013 | Bacteria | 1496 |
| 83 | Ga0439456_023348 | 3300042013 | Bacteria | 1311 |
| 84 | Ga0439463_001888 | 3300042016 | Bacteria | 5438 |
| 85 | Ga0450906_000852 | 3300042145 | Bacteria | 6726 |
| 86 | Ga0450906_006370 | 3300042145 | Bacteria | 2384 |
| 87 | Ga0450893_0002920 | 3300042532 | Bacteria | 2689 |
| 88 | Ga0495603_0016401 | 3300046455 | Bacteria | 4481 |
| 89 | Ga0495590_0000885 | 3300046457 | Bacteria | 13429 |
| 90 | Ga0495605_0040196 | 3300046474 | Bacteria | 2338 |
| 91 | Ga0495605_0051796 | 3300046474 | Bacteria | 1998 |
| 92 | Ga0495584_0001732 | 3300046491 | Bacteria | 12757 |
| 93 | Ga0495585_0173459 | 3300046492 | Bacteria | 1112 |
| 94 | Ga0495607_0091731 | 3300046501 | Bacteria | 1645 |
| 95 | Ga0495606_0008263 | 3300046507 | Bacteria | 9084 |
| 96 | Ga0495637_0001506 | 3300046520 | Bacteria | 13645 |
| 97 | Ga0495642_0171600 | 3300046528 | Bacteria | 942 |
| 98 | Ga0495654_0001956 | 3300046530 | Bacteria | 13608 |
| 99 | Ga0495597_0002838 | 3300046542 | Bacteria | 10614 |
| 100 | Ga0495633_0030931 | 3300046558 | Bacteria | 2599 |
| 101 | Ga0495667_0092109 | 3300046559 | Bacteria | 1963 |
| 102 | Ga0495656_0049636 | 3300046615 | Bacteria | 1788 |
| 103 | Ga0495656_0078086 | 3300046615 | Bacteria | 1487 |
| 104 | Ga0495668_0089933 | 3300046616 | Bacteria | 1682 |
| 105 | Ga0495668_0192127 | 3300046616 | Bacteria | 1118 |
| 106 | Ga0495625_0001757 | 3300046660 | Bacteria | 25057 |
| 107 | Ga0495625_0019842 | 3300046660 | Bacteria | 5202 |
| 108 | Ga0495661_0006714 | 3300046665 | Bacteria | 8077 |
| 109 | Ga0495649_0009169 | 3300046694 | Bacteria | 5900 |
| 110 | Ga0495660_0052681 | 3300046810 | Bacteria | 2210 |
| 111 | Ga0495581_0115016 | 3300047315 | Bacteria | 1565 |
| 112 | Ga0495684_0299183 | 3300047471 | Bacteria | 1156 |
| 113 | Ga0495686_0077893 | 3300047472 | Bacteria | 2030 |
| 114 | Ga0496116_0001285 | 3300048919 | Bacteria | 28897 |
| 115 | Ga0496123_0087612 | 3300048926 | Bacteria | 1862 |
| 116 | Ga0496125_0046435 | 3300048928 | Bacteria | 3643 |
| 117 | Ga0496126_0045524 | 3300048929 | Bacteria | 4032 |
| 118 | Ga0496126_0302828 | 3300048929 | Bacteria | 1318 |
| 119 | Ga0501031_0068365 | 3300049568 | Bacteria | 2314 |
| 120 | Ga0501039_0056005 | 3300049575 | Bacteria | 3054 |
| 121 | Ga0501039_0297923 | 3300049575 | Bacteria | 1268 |
| 122 | Ga0501040_0069133 | 3300049576 | Bacteria | 2436 |
| 123 | Ga0501042_0087535 | 3300049578 | Bacteria | 2235 |
| 124 | Ga0501043_0089812 | 3300049579 | Bacteria | 2415 |
| 125 | Ga0501046_0013990 | 3300049580 | Bacteria | 6777 |
| 126 | Ga0501048_0267608 | 3300049582 | Bacteria | 1214 |
| 127 | Ga0501068_0120274 | 3300049584 | Bacteria | 1637 |
| 128 | Ga0501072_0007510 | 3300049588 | Bacteria | 8274 |
| 129 | Ga0501072_0308537 | 3300049588 | Bacteria | 1258 |
| 130 | Ga0501075_0033715 | 3300049591 | Bacteria | 3809 |
| 131 | Ga0501076_0008854 | 3300049592 | Bacteria | 7401 |
| 132 | Ga0501077_0125616 | 3300049593 | Bacteria | 1626 |
| 133 | Ga0501079_0097277 | 3300049741 | Bacteria | 2282 |
| 134 | Ga0501080_0050728 | 3300049742 | Bacteria | 3862 |
| 135 | Ga0501081_0146710 | 3300049743 | Bacteria | 1693 |
| 136 | Ga0501269_005168 | 3300049766 | Bacteria | 1570 |
| 137 | Ga0501035_0020350 | 3300049822 | Bacteria | 6093 |
| 138 | Ga0501044_0183425 | 3300049823 | Bacteria | 2059 |
| 139 | Ga0501226_000582 | 3300049853 | Bacteria | 5036 |
| 140 | nmdc:mga0yw44_2088_c1 | 3300050492 | Bacteria | 8348 |
| 141 | nmdc:mga0yw44_93802_c1 | 3300050492 | Bacteria | 1901 |
| 142 | nmdc:mga06z11_121263_c1 | 3300050494 | Bacteria | 1459 |
| 143 | nmdc:mga06r32_115484_c1 | 3300050510 | Bacteria | 2644 |
| 144 | nmdc:mga0sz30_1668_c1 | 3300050516 | Bacteria | 7885 |
| 145 | Ga0501084_0035531 | 3300054114 | Bacteria | 4166 |
| 146 | Ga0501084_0288301 | 3300054114 | Bacteria | 1386 |
| 147 | Ga0501082_0039466 | 3300060353 | Bacteria | 4072 |
| 148 | Ga0530510_0270205 | 3300061734 | Bacteria | 1269 |
| 149 | 2508729348 | 2508501050 | Bacteria | 9633614 |
| 150 | 2509077842 | 2508501114 | Bacteria | 7082538 |
| 151 | 2510310008 | 2510065058 | Bacteria | 5005894 |
| 152 | 2512038168 | 2511231221 | Bacteria | 6846400 |
| 153 | 2599615698 | 2599185212 | Bacteria | 6765997 |
| 154 | 2599964000 | 2599185306 | Bacteria | 6637356 |
| 155 | 2599976723 | 2599185308 | Bacteria | 6621546 |
| 156 | 2599996685 | 2599185311 | Bacteria | 6354990 |
| 157 | 2600010892 | 2599185314 | Bacteria | 6621749 |
| 158 | 2600039161 | 2599185318 | Bacteria | 6961590 |
| 159 | 2600062053 | 2599185322 | Bacteria | 6763055 |
| 160 | 2603856842 | 2602042107 | Bacteria | 6226103 |
| 161 | 2678263519 | 2675903515 | Bacteria | 6580491 |
| 162 | 2745009850 | 2744054620 | Bacteria | 6551379 |
| 163 | 2776258703 | 2775506901 | Bacteria | 9631051 |
| 164 | 2776265120 | 2775506901 | Bacteria | 9631051 |
| 165 | 2825652289 | 2825651385 | Bacteria | 6715909 |
| 166 | 2835316289 | 2835312727 | Bacteria | 7413381 |
| 167 | 2842857927 | 2842854478 | Bacteria | 6143501 |
| 168 | 2894232903 | 2894232714 | Bacteria | 8834183 |
| 169 | 2913040294 | 2913036834 | Bacteria | 6704877 |
| 170 | 2919483329 | 2919481497 | Bacteria | 6907839 |
| 171 | 2929147735 | 2929144301 | Bacteria | 6622272 |
| 172 | 2931374872 | 2931369376 | Bacteria | 6847892 |
| 173 | 2945933371 | 2945928738 | Bacteria | 6053221 |
| 174 | 3007868871 | 3007866637 | Bacteria | 5899198 |
| 175 | 8054006916 | 8054002106 | Bacteria | 7987183 |
| 176 | 8054287938 | 8054285046 | Bacteria | 6919322 |
| 177 | 8056146478 | 8056143049 | Bacteria | 6307666 |
| 178 | Ga0055530_10000004 | |||
| 179 | SwRhRL2b_contig_1773400 | |||
| 180 | rootH1_10300375 | |||
| 181 | JGI25404J52841_10001507 | |||
| 182 | Ga0055540_1000017 | |||
| 183 | Ga0065714_10002302 | |||
| 184 | Ga0065714_10066456 | |||
| 185 | Ga0065704_10000374 | |||
| 186 | Ga0070709_10005503 | |||
| 187 | Ga0070713_100039453 | |||
| 188 | Ga0070710_10001402 | |||
| 189 | Ga0070711_100000968 | |||
| 190 | Ga0070711_100030822 | |||
| 191 | Ga0070665_100424169 | |||
| 192 | Ga0081540_1004950 | |||
| 193 | Ga0081540_1011886 | |||
| 194 | Ga0070717_10212762 | |||
| 195 | Ga0075365_10001620 | |||
| 196 | Ga0075365_10212028 | |||
| 197 | Ga0075432_10000187 | |||
| 198 | Ga0070716_100042147 | |||
| 199 | Ga0070712_100041415 | |||
| 200 | Ga0075367_10041989 | |||
| 201 | Ga0075431_100008143 | |||
| 202 | Ga0105245_10335836 | |||
| 203 | Ga0105238_10251067 | |||
| 204 | Ga0105246_10023696 | |||
| 205 | Ga0157370_10059663 | |||
| 206 | Ga0157380_10067109 | |||
| 207 | Ga0182008_10002362 | |||
| 208 | Ga0213872_10000354 | |||
| 209 | Ga0213876_10001868 | |||
| 210 | Ga0213875_10069944 | |||
| 211 | Ga0209676_1001065 | |||
| 212 | Ga0209564_1005031 | |||
| 213 | Ga0209050_1000037 | |||
| 214 | Ga0209051_1000040 | |||
| 215 | Ga0207692_10000752 | |||
| 216 | Ga0207688_10033641 | |||
| 217 | Ga0207699_10001104 | |||
| 218 | Ga0207663_10001780 | |||
| 219 | Ga0207663_10386040 | |||
| 220 | Ga0207694_10146088 | |||
| 221 | Ga0207700_10026146 | |||
| 222 | Ga0207665_10054574 | |||
| 223 | Ga0207668_10145750 | |||
| 224 | Ga0207677_10215446 | |||
| 225 | Ga0207708_10090497 | |||
| 226 | Ga0207428_10003576 | |||
| 227 | Ga0316177_1183538 | |||
| 228 | Ga0307405_10017000 | |||
| 229 | Ga0307405_10038479 | |||
| 230 | Ga0307405_10039053 | |||
| 231 | Ga0307406_10022409 | |||
| 232 | Ga0307406_10075068 | |||
| 233 | Ga0307407_10037098 | |||
| 234 | Ga0307412_10003878 | |||
| 235 | Ga0307412_10015239 | |||
| 236 | Ga0307409_100098240 | |||
| 237 | Ga0307416_100187689 | |||
| 238 | Ga0307414_10166674 | |||
| 239 | Ga0307411_10017515 | |||
| 240 | Ga0373947_0182918 | |||
| 241 | Ga0316584_0115865 | |||
| 242 | Ga0316584_0225758 | |||
| 243 | Ga0436364_1123631 | |||
| 244 | Ga0436365_0074963 | |||
| 245 | Ga0436365_0367152 | |||
| 246 | Ga0436365_1885634 | |||
| 247 | Ga0436360_0070268 | |||
| 248 | Ga0436361_0875900 | |||
| 249 | Ga0436362_0823522 | |||
| 250 | Ga0439438_000029 | |||
| 251 | Ga0439438_000144 | |||
| 252 | Ga0439466_0007520 | |||
| 253 | Ga0439465_0099748 | |||
| 254 | Ga0439432_001569 | |||
| 255 | Ga0439451_000344 | |||
| 256 | Ga0439451_000409 | |||
| 257 | Ga0439452_003630 | |||
| 258 | Ga0439456_003820 | |||
| 259 | Ga0439456_017658 | |||
| 260 | Ga0439456_023348 | |||
| 261 | Ga0439463_001888 | |||
| 262 | Ga0450906_000852 | |||
| 263 | Ga0450906_006370 | |||
| 264 | Ga0450893_0002920 | |||
| 265 | Ga0495603_0016401 | |||
| 266 | Ga0495590_0000885 | |||
| 267 | Ga0495605_0040196 | |||
| 268 | Ga0495605_0051796 | |||
| 269 | Ga0495584_0001732 | |||
| 270 | Ga0495585_0173459 | |||
| 271 | Ga0495607_0091731 | |||
| 272 | Ga0495606_0008263 | |||
| 273 | Ga0495637_0001506 | |||
| 274 | Ga0495642_0171600 | |||
| 275 | Ga0495654_0001956 | |||
| 276 | Ga0495597_0002838 | |||
| 277 | Ga0495633_0030931 | |||
| 278 | Ga0495667_0092109 | |||
| 279 | Ga0495656_0049636 | |||
| 280 | Ga0495656_0078086 | |||
| 281 | Ga0495668_0089933 | |||
| 282 | Ga0495668_0192127 | |||
| 283 | Ga0495625_0001757 | |||
| 284 | Ga0495625_0019842 | |||
| 285 | Ga0495661_0006714 | |||
| 286 | Ga0495649_0009169 | |||
| 287 | Ga0495660_0052681 | |||
| 288 | Ga0495581_0115016 | |||
| 289 | Ga0495684_0299183 | |||
| 290 | Ga0495686_0077893 | |||
| 291 | Ga0496116_0001285 | |||
| 292 | Ga0496123_0087612 | |||
| 293 | Ga0496125_0046435 | |||
| 294 | Ga0496126_0045524 | |||
| 295 | Ga0496126_0302828 | |||
| 296 | Ga0501031_0068365 | |||
| 297 | Ga0501039_0056005 | |||
| 298 | Ga0501039_0297923 | |||
| 299 | Ga0501040_0069133 | |||
| 300 | Ga0501042_0087535 | |||
| 301 | Ga0501043_0089812 | |||
| 302 | Ga0501046_0013990 | |||
| 303 | Ga0501048_0267608 | |||
| 304 | Ga0501068_0120274 | |||
| 305 | Ga0501072_0007510 | |||
| 306 | Ga0501072_0308537 | |||
| 307 | Ga0501075_0033715 | |||
| 308 | Ga0501076_0008854 | |||
| 309 | Ga0501077_0125616 | |||
| 310 | Ga0501079_0097277 | |||
| 311 | Ga0501080_0050728 | |||
| 312 | Ga0501081_0146710 | |||
| 313 | Ga0501269_005168 | |||
| 314 | Ga0501035_0020350 | |||
| 315 | Ga0501044_0183425 | |||
| 316 | Ga0501226_000582 | |||
| 317 | nmdc:mga0yw44_2088_c1 | |||
| 318 | nmdc:mga0yw44_93802_c1 | |||
| 319 | nmdc:mga06z11_121263_c1 | |||
| 320 | nmdc:mga06r32_115484_c1 | |||
| 321 | nmdc:mga0sz30_1668_c1 | |||
| 322 | Ga0501084_0035531 | |||
| 323 | Ga0501084_0288301 | |||
| 324 | Ga0501082_0039466 | |||
| 325 | Ga0530510_0270205 | |||
| 326 | 2508729348 | |||
| 327 | 2509077842 | |||
| 328 | 2510310008 | |||
| 329 | 2512038168 | |||
| 330 | 2599615698 | |||
| 331 | 2599964000 | |||
| 332 | 2599976723 | |||
| 333 | 2599996685 | |||
| 334 | 2600010892 | |||
| 335 | 2600039161 | |||
| 336 | 2600062053 | |||
| 337 | 2603856842 | |||
| 338 | 2678263519 | |||
| 339 | 2745009850 | |||
| 340 | 2776258703 | |||
| 341 | 2776265120 | |||
| 342 | 2825652289 | |||
| 343 | 2835316289 | |||
| 344 | 2842857927 | |||
| 345 | 2894232903 | |||
| 346 | 2913040294 | |||
| 347 | 2919483329 | |||
| 348 | 2929147735 | |||
| 349 | 2931374872 | |||
| 350 | 2945933371 | |||
| 351 | 3007868871 | |||
| 352 | 8054006916 | |||
| 353 | 8054287938 | |||
| 354 | 8056146478 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8iwl-assembly1.cif.gz_B | a.baumannii uncharacterized sugar kinase ydjh | 0.9699 | 30 | 327 |
| 8iwl-assembly1.cif.gz_A | a.baumannii uncharacterized sugar kinase ydjh | 0.9679 | 34 | 326 |
| 3lhx-assembly1.cif.gz_A | crystal structure of a ketodeoxygluconokinase (kdgk) from shigella flexneri | 0.9522 | 30 | 326 |
| 3lhx-assembly1.cif.gz_A | crystal structure of a ketodeoxygluconokinase (kdgk) from shigella flexneri | 0.9397 | 30 | 326 |
| 8iwl-assembly1.cif.gz_B | a.baumannii uncharacterized sugar kinase ydjh | 0.9389 | 30 | 327 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3lhxB00 | Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase | 0.9394 | 30 | 324 | 3.40.1190.20 |
| 3lhxB00 | Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase | 0.9299 | 30 | 324 | 3.40.1190.20 |
| 4eumA00 | Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase | 0.9118 | 22 | 314 | 3.40.1190.20 |
| 4eumA00 | Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase | 0.8907 | 22 | 314 | 3.40.1190.20 |
| 1v1aA00 | Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase | 0.8742 | 30 | 318 | 3.40.1190.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7J6ZNH2-F1-model_v4 | deleted | 0.9785 | 28 | 293 |
|
| AF-A0A352R0N7-F1-model_v4 | Ketodeoxygluconokinase | 0.9771 | 29 | 327 |
GO:0005829
GO:0006974 GO:0008673 GO:0019698 GO:0042840 |
| AF-Q3YVQ8-F1-model_v4 | Ketodeoxygluconokinase | 0.9741 | 28 | 327 |
GO:0005829
GO:0006974 GO:0008673 GO:0019698 GO:0042840 |
| AF-A0A659S5G4-F1-model_v4 | Ketodeoxygluconokinase | 0.974 | 29 | 234 |
GO:0005829
GO:0006974 GO:0008673 GO:0019698 GO:0042840 |
| AF-A0A545T415-F1-model_v4 | Sugar kinase | 0.9738 | 25 | 321 |
GO:0005829
GO:0006974 GO:0008673 GO:0019698 GO:0042840 |