F269417

General Info

Members Datasets Scaffolds Average Seq Length
177 150 354 313

Family's Representative Sequence

Representative Sequence 3300003791|Ga0055530_10000004|Ga0055530_1000000422
Length 346
Sequence MKRRFKNKKGALIMDITLNHGPEIRFARPLKVALVGECMIEMRGEPGAAIMQTFGGDTLNTAVYLARLNPRGAVALDYMTAVGSDAFSVAMRRSWLDEGIGDVHVRVIEDALPGLYFIQTDPRGERRFLYWRGEAAARRMFDGPEADTLLNGLADYDYVYLSGISLAILTPEGRQRLIQALHLARRGGTRIVFDNNYRPHLWPDPEAARQVYRELLRLTDLALITWEDDAILFGYRDTDALFSAYAQEGVGEVALKRGADSCLIQCPAGRFEVPAQHVAHVIDTTAAGDSFNAAYLACRLRGGDPEQAARWGHRLAAQVVQYRGALIPQAAMPKMGASSLSSVAQV

Samples

Sample ID Description Type Environment
1 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
13 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
14 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
15 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
16 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
17 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
18 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
19 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
20 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
21 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
22 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
23 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
24 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
25 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
26 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
27 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
28 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
29 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
30 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
31 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
32 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
33 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
34 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
45 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
46 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
47 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
48 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
49 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
50 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
51 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
52 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
53 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
54 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
55 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
56 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
57 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
58 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
59 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
60 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
61 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
62 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
63 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
64 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
65 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
66 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
67 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
68 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
69 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
70 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
71 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
72 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
73 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
74 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
75 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
76 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
77 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
78 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
79 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
80 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
81 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
82 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
83 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
84 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
85 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
86 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
87 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
88 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
89 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
90 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
91 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
92 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
93 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
94 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
95 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
96 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
97 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
105 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
106 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
107 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
108 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
109 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
110 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
111 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
112 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
113 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
116 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
117 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
118 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
119 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
120 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
121 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
122 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
123 2508501050 Microvirga lupini Lut6 Isolate Nodule
124 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
125 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
126 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
127 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
128 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
129 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
130 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
131 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
132 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
133 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
134 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
135 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
136 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
137 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
138 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
139 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
140 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
141 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
142 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
143 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
144 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
145 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
146 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
147 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
148 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
149 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
150 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.62
Metatranscriptomes 0
Isolates 16.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.34
Nodule 2.82
Rhizoplane 4.52
Rhizosphere 74.01
Stem 0
Stem Tuber 0
Unclassified 1.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055530_10000004 3300003791 Bacteria 231465
2 SwRhRL2b_contig_1773400 2162886007 Bacteria 24667
3 rootH1_10300375 3300003323 Bacteria 1488
4 JGI25404J52841_10001507 3300003659 Bacteria 4118
5 Ga0055540_1000017 3300003792 Bacteria 231465
6 Ga0065714_10002302 3300005288 Bacteria 45300
7 Ga0065714_10066456 3300005288 Bacteria 6814
8 Ga0065704_10000374 3300005289 Bacteria 26179
9 Ga0070709_10005503 3300005434 Bacteria 6861
10 Ga0070713_100039453 3300005436 Bacteria 3832
11 Ga0070710_10001402 3300005437 Bacteria 11371
12 Ga0070711_100000968 3300005439 Bacteria 15186
13 Ga0070711_100030822 3300005439 Bacteria 3555
14 Ga0070665_100424169 3300005548 Bacteria 1339
15 Ga0081540_1004950 3300005983 Bacteria 10015
16 Ga0081540_1011886 3300005983 Bacteria 5779
17 Ga0070717_10212762 3300006028 Bacteria 1697
18 Ga0075365_10001620 3300006038 Bacteria 10389
19 Ga0075365_10212028 3300006038 Bacteria 1358
20 Ga0075432_10000187 3300006058 Bacteria 15933
21 Ga0070716_100042147 3300006173 Bacteria 2547
22 Ga0070712_100041415 3300006175 Bacteria 3163
23 Ga0075367_10041989 3300006178 Bacteria 2675
24 Ga0075431_100008143 3300006847 Bacteria 10473
25 Ga0105245_10335836 3300009098 Bacteria 1493
26 Ga0105238_10251067 3300009551 Unclassified 1747
27 Ga0105246_10023696 3300011119 Bacteria 3975
28 Ga0157370_10059663 3300013104 Bacteria 3625
29 Ga0157380_10067109 3300014326 Bacteria 2887
30 Ga0182008_10002362 3300014497 Bacteria 11878
31 Ga0213872_10000354 3300021361 Bacteria 38778
32 Ga0213876_10001868 3300021384 Bacteria 12668
33 Ga0213875_10069944 3300021388 Bacteria 1638
34 Ga0209676_1001065 3300025292 Bacteria 31352
35 Ga0209564_1005031 3300025295 Bacteria 7739
36 Ga0209050_1000037 3300025298 Bacteria 415612
37 Ga0209051_1000040 3300025303 Bacteria 315055
38 Ga0207692_10000752 3300025898 Bacteria 11457
39 Ga0207688_10033641 3300025901 Bacteria 2836
40 Ga0207699_10001104 3300025906 Bacteria 12746
41 Ga0207663_10001780 3300025916 Bacteria 10154
42 Ga0207663_10386040 3300025916 Bacteria 1068
43 Ga0207694_10146088 3300025924 Bacteria 1904
44 Ga0207700_10026146 3300025928 Bacteria 4066
45 Ga0207665_10054574 3300025939 Bacteria 2695
46 Ga0207668_10145750 3300025972 Bacteria 1827
47 Ga0207677_10215446 3300026023 Bacteria 1536
48 Ga0207708_10090497 3300026075 Bacteria 2359
49 Ga0207428_10003576 3300027907 Bacteria 15003
50 Ga0316177_1183538 3300030731 Bacteria 2645
51 Ga0307405_10017000 3300031731 Bacteria 3982
52 Ga0307405_10038479 3300031731 Bacteria 2884
53 Ga0307405_10039053 3300031731 Bacteria 2866
54 Ga0307406_10022409 3300031901 Bacteria 3747
55 Ga0307406_10075068 3300031901 Bacteria 2229
56 Ga0307407_10037098 3300031903 Bacteria 2691
57 Ga0307412_10003878 3300031911 Bacteria 8322
58 Ga0307412_10015239 3300031911 Bacteria 4551
59 Ga0307409_100098240 3300031995 Bacteria 2421
60 Ga0307416_100187689 3300032002 Bacteria 1945
61 Ga0307414_10166674 3300032004 Bacteria 1756
62 Ga0307411_10017515 3300032005 Bacteria 4085
63 Ga0373947_0182918 3300035725 Unclassified 1365
64 Ga0316584_0115865 3300036712 Bacteria 2004
65 Ga0316584_0225758 3300036712 Bacteria 1374
66 Ga0436364_1123631 3300037853 Bacteria 1175
67 Ga0436365_0074963 3300039437 Bacteria 7353
68 Ga0436365_0367152 3300039437 Bacteria 1631
69 Ga0436365_1885634 3300039437 Bacteria 6218
70 Ga0436360_0070268 3300039438 Bacteria 2626
71 Ga0436361_0875900 3300039447 Bacteria 32857
72 Ga0436362_0823522 3300039453 Bacteria 3159
73 Ga0439438_000029 3300041405 Bacteria 82129
74 Ga0439438_000144 3300041405 Bacteria 32021
75 Ga0439466_0007520 3300041411 Bacteria 4120
76 Ga0439465_0099748 3300041413 Bacteria 1002
77 Ga0439432_001569 3300042006 Bacteria 8577
78 Ga0439451_000344 3300042009 Bacteria 9013
79 Ga0439451_000409 3300042009 Bacteria 8376
80 Ga0439452_003630 3300042010 Bacteria 5362
81 Ga0439456_003820 3300042013 Bacteria 3061
82 Ga0439456_017658 3300042013 Bacteria 1496
83 Ga0439456_023348 3300042013 Bacteria 1311
84 Ga0439463_001888 3300042016 Bacteria 5438
85 Ga0450906_000852 3300042145 Bacteria 6726
86 Ga0450906_006370 3300042145 Bacteria 2384
87 Ga0450893_0002920 3300042532 Bacteria 2689
88 Ga0495603_0016401 3300046455 Bacteria 4481
89 Ga0495590_0000885 3300046457 Bacteria 13429
90 Ga0495605_0040196 3300046474 Bacteria 2338
91 Ga0495605_0051796 3300046474 Bacteria 1998
92 Ga0495584_0001732 3300046491 Bacteria 12757
93 Ga0495585_0173459 3300046492 Bacteria 1112
94 Ga0495607_0091731 3300046501 Bacteria 1645
95 Ga0495606_0008263 3300046507 Bacteria 9084
96 Ga0495637_0001506 3300046520 Bacteria 13645
97 Ga0495642_0171600 3300046528 Bacteria 942
98 Ga0495654_0001956 3300046530 Bacteria 13608
99 Ga0495597_0002838 3300046542 Bacteria 10614
100 Ga0495633_0030931 3300046558 Bacteria 2599
101 Ga0495667_0092109 3300046559 Bacteria 1963
102 Ga0495656_0049636 3300046615 Bacteria 1788
103 Ga0495656_0078086 3300046615 Bacteria 1487
104 Ga0495668_0089933 3300046616 Bacteria 1682
105 Ga0495668_0192127 3300046616 Bacteria 1118
106 Ga0495625_0001757 3300046660 Bacteria 25057
107 Ga0495625_0019842 3300046660 Bacteria 5202
108 Ga0495661_0006714 3300046665 Bacteria 8077
109 Ga0495649_0009169 3300046694 Bacteria 5900
110 Ga0495660_0052681 3300046810 Bacteria 2210
111 Ga0495581_0115016 3300047315 Bacteria 1565
112 Ga0495684_0299183 3300047471 Bacteria 1156
113 Ga0495686_0077893 3300047472 Bacteria 2030
114 Ga0496116_0001285 3300048919 Bacteria 28897
115 Ga0496123_0087612 3300048926 Bacteria 1862
116 Ga0496125_0046435 3300048928 Bacteria 3643
117 Ga0496126_0045524 3300048929 Bacteria 4032
118 Ga0496126_0302828 3300048929 Bacteria 1318
119 Ga0501031_0068365 3300049568 Bacteria 2314
120 Ga0501039_0056005 3300049575 Bacteria 3054
121 Ga0501039_0297923 3300049575 Bacteria 1268
122 Ga0501040_0069133 3300049576 Bacteria 2436
123 Ga0501042_0087535 3300049578 Bacteria 2235
124 Ga0501043_0089812 3300049579 Bacteria 2415
125 Ga0501046_0013990 3300049580 Bacteria 6777
126 Ga0501048_0267608 3300049582 Bacteria 1214
127 Ga0501068_0120274 3300049584 Bacteria 1637
128 Ga0501072_0007510 3300049588 Bacteria 8274
129 Ga0501072_0308537 3300049588 Bacteria 1258
130 Ga0501075_0033715 3300049591 Bacteria 3809
131 Ga0501076_0008854 3300049592 Bacteria 7401
132 Ga0501077_0125616 3300049593 Bacteria 1626
133 Ga0501079_0097277 3300049741 Bacteria 2282
134 Ga0501080_0050728 3300049742 Bacteria 3862
135 Ga0501081_0146710 3300049743 Bacteria 1693
136 Ga0501269_005168 3300049766 Bacteria 1570
137 Ga0501035_0020350 3300049822 Bacteria 6093
138 Ga0501044_0183425 3300049823 Bacteria 2059
139 Ga0501226_000582 3300049853 Bacteria 5036
140 nmdc:mga0yw44_2088_c1 3300050492 Bacteria 8348
141 nmdc:mga0yw44_93802_c1 3300050492 Bacteria 1901
142 nmdc:mga06z11_121263_c1 3300050494 Bacteria 1459
143 nmdc:mga06r32_115484_c1 3300050510 Bacteria 2644
144 nmdc:mga0sz30_1668_c1 3300050516 Bacteria 7885
145 Ga0501084_0035531 3300054114 Bacteria 4166
146 Ga0501084_0288301 3300054114 Bacteria 1386
147 Ga0501082_0039466 3300060353 Bacteria 4072
148 Ga0530510_0270205 3300061734 Bacteria 1269
149 2508729348 2508501050 Bacteria 9633614
150 2509077842 2508501114 Bacteria 7082538
151 2510310008 2510065058 Bacteria 5005894
152 2512038168 2511231221 Bacteria 6846400
153 2599615698 2599185212 Bacteria 6765997
154 2599964000 2599185306 Bacteria 6637356
155 2599976723 2599185308 Bacteria 6621546
156 2599996685 2599185311 Bacteria 6354990
157 2600010892 2599185314 Bacteria 6621749
158 2600039161 2599185318 Bacteria 6961590
159 2600062053 2599185322 Bacteria 6763055
160 2603856842 2602042107 Bacteria 6226103
161 2678263519 2675903515 Bacteria 6580491
162 2745009850 2744054620 Bacteria 6551379
163 2776258703 2775506901 Bacteria 9631051
164 2776265120 2775506901 Bacteria 9631051
165 2825652289 2825651385 Bacteria 6715909
166 2835316289 2835312727 Bacteria 7413381
167 2842857927 2842854478 Bacteria 6143501
168 2894232903 2894232714 Bacteria 8834183
169 2913040294 2913036834 Bacteria 6704877
170 2919483329 2919481497 Bacteria 6907839
171 2929147735 2929144301 Bacteria 6622272
172 2931374872 2931369376 Bacteria 6847892
173 2945933371 2945928738 Bacteria 6053221
174 3007868871 3007866637 Bacteria 5899198
175 8054006916 8054002106 Bacteria 7987183
176 8054287938 8054285046 Bacteria 6919322
177 8056146478 8056143049 Bacteria 6307666
178 Ga0055530_10000004
179 SwRhRL2b_contig_1773400
180 rootH1_10300375
181 JGI25404J52841_10001507
182 Ga0055540_1000017
183 Ga0065714_10002302
184 Ga0065714_10066456
185 Ga0065704_10000374
186 Ga0070709_10005503
187 Ga0070713_100039453
188 Ga0070710_10001402
189 Ga0070711_100000968
190 Ga0070711_100030822
191 Ga0070665_100424169
192 Ga0081540_1004950
193 Ga0081540_1011886
194 Ga0070717_10212762
195 Ga0075365_10001620
196 Ga0075365_10212028
197 Ga0075432_10000187
198 Ga0070716_100042147
199 Ga0070712_100041415
200 Ga0075367_10041989
201 Ga0075431_100008143
202 Ga0105245_10335836
203 Ga0105238_10251067
204 Ga0105246_10023696
205 Ga0157370_10059663
206 Ga0157380_10067109
207 Ga0182008_10002362
208 Ga0213872_10000354
209 Ga0213876_10001868
210 Ga0213875_10069944
211 Ga0209676_1001065
212 Ga0209564_1005031
213 Ga0209050_1000037
214 Ga0209051_1000040
215 Ga0207692_10000752
216 Ga0207688_10033641
217 Ga0207699_10001104
218 Ga0207663_10001780
219 Ga0207663_10386040
220 Ga0207694_10146088
221 Ga0207700_10026146
222 Ga0207665_10054574
223 Ga0207668_10145750
224 Ga0207677_10215446
225 Ga0207708_10090497
226 Ga0207428_10003576
227 Ga0316177_1183538
228 Ga0307405_10017000
229 Ga0307405_10038479
230 Ga0307405_10039053
231 Ga0307406_10022409
232 Ga0307406_10075068
233 Ga0307407_10037098
234 Ga0307412_10003878
235 Ga0307412_10015239
236 Ga0307409_100098240
237 Ga0307416_100187689
238 Ga0307414_10166674
239 Ga0307411_10017515
240 Ga0373947_0182918
241 Ga0316584_0115865
242 Ga0316584_0225758
243 Ga0436364_1123631
244 Ga0436365_0074963
245 Ga0436365_0367152
246 Ga0436365_1885634
247 Ga0436360_0070268
248 Ga0436361_0875900
249 Ga0436362_0823522
250 Ga0439438_000029
251 Ga0439438_000144
252 Ga0439466_0007520
253 Ga0439465_0099748
254 Ga0439432_001569
255 Ga0439451_000344
256 Ga0439451_000409
257 Ga0439452_003630
258 Ga0439456_003820
259 Ga0439456_017658
260 Ga0439456_023348
261 Ga0439463_001888
262 Ga0450906_000852
263 Ga0450906_006370
264 Ga0450893_0002920
265 Ga0495603_0016401
266 Ga0495590_0000885
267 Ga0495605_0040196
268 Ga0495605_0051796
269 Ga0495584_0001732
270 Ga0495585_0173459
271 Ga0495607_0091731
272 Ga0495606_0008263
273 Ga0495637_0001506
274 Ga0495642_0171600
275 Ga0495654_0001956
276 Ga0495597_0002838
277 Ga0495633_0030931
278 Ga0495667_0092109
279 Ga0495656_0049636
280 Ga0495656_0078086
281 Ga0495668_0089933
282 Ga0495668_0192127
283 Ga0495625_0001757
284 Ga0495625_0019842
285 Ga0495661_0006714
286 Ga0495649_0009169
287 Ga0495660_0052681
288 Ga0495581_0115016
289 Ga0495684_0299183
290 Ga0495686_0077893
291 Ga0496116_0001285
292 Ga0496123_0087612
293 Ga0496125_0046435
294 Ga0496126_0045524
295 Ga0496126_0302828
296 Ga0501031_0068365
297 Ga0501039_0056005
298 Ga0501039_0297923
299 Ga0501040_0069133
300 Ga0501042_0087535
301 Ga0501043_0089812
302 Ga0501046_0013990
303 Ga0501048_0267608
304 Ga0501068_0120274
305 Ga0501072_0007510
306 Ga0501072_0308537
307 Ga0501075_0033715
308 Ga0501076_0008854
309 Ga0501077_0125616
310 Ga0501079_0097277
311 Ga0501080_0050728
312 Ga0501081_0146710
313 Ga0501269_005168
314 Ga0501035_0020350
315 Ga0501044_0183425
316 Ga0501226_000582
317 nmdc:mga0yw44_2088_c1
318 nmdc:mga0yw44_93802_c1
319 nmdc:mga06z11_121263_c1
320 nmdc:mga06r32_115484_c1
321 nmdc:mga0sz30_1668_c1
322 Ga0501084_0035531
323 Ga0501084_0288301
324 Ga0501082_0039466
325 Ga0530510_0270205
326 2508729348
327 2509077842
328 2510310008
329 2512038168
330 2599615698
331 2599964000
332 2599976723
333 2599996685
334 2600010892
335 2600039161
336 2600062053
337 2603856842
338 2678263519
339 2745009850
340 2776258703
341 2776265120
342 2825652289
343 2835316289
344 2842857927
345 2894232903
346 2913040294
347 2919483329
348 2929147735
349 2931374872
350 2945933371
351 3007868871
352 8054006916
353 8054287938
354 8056146478

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00294

PfkB

pfkB family carbohydrate kinase

29

332

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
8iwl-assembly1.cif.gz_B a.baumannii uncharacterized sugar kinase ydjh 0.9699 30 327
8iwl-assembly1.cif.gz_A a.baumannii uncharacterized sugar kinase ydjh 0.9679 34 326
3lhx-assembly1.cif.gz_A crystal structure of a ketodeoxygluconokinase (kdgk) from shigella flexneri 0.9522 30 326
3lhx-assembly1.cif.gz_A crystal structure of a ketodeoxygluconokinase (kdgk) from shigella flexneri 0.9397 30 326
8iwl-assembly1.cif.gz_B a.baumannii uncharacterized sugar kinase ydjh 0.9389 30 327
ID Description Score Start End Superfamily
3lhxB00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9394 30 324 3.40.1190.20
3lhxB00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9299 30 324 3.40.1190.20
4eumA00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9118 22 314 3.40.1190.20
4eumA00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.8907 22 314 3.40.1190.20
1v1aA00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.8742 30 318 3.40.1190.20
ID Description Score Start End GO Terms
AF-A0A7J6ZNH2-F1-model_v4 deleted 0.9785 28 293
AF-A0A352R0N7-F1-model_v4 Ketodeoxygluconokinase 0.9771 29 327 GO:0005829
GO:0006974
GO:0008673
GO:0019698
GO:0042840
AF-Q3YVQ8-F1-model_v4 Ketodeoxygluconokinase 0.9741 28 327 GO:0005829
GO:0006974
GO:0008673
GO:0019698
GO:0042840
AF-A0A659S5G4-F1-model_v4 Ketodeoxygluconokinase 0.974 29 234 GO:0005829
GO:0006974
GO:0008673
GO:0019698
GO:0042840
AF-A0A545T415-F1-model_v4 Sugar kinase 0.9738 25 321 GO:0005829
GO:0006974
GO:0008673
GO:0019698
GO:0042840

Map