F268971

General Info

Members Datasets Scaffolds Average Seq Length
176 134 145 256

Family's Representative Sequence

Representative Sequence 3300048914|Ga0496111_0184338|Ga0496111_0184338_243_1100
Length 285
Sequence VTVEYLDPVELPILGSVTDATTEQTADRTRPLALVTGGGTGIGAAIARRLSRDGFDVVVAGRRKDRLDEVVAGIEQSGGTARALVMDVTDPESVTTGTGSLGRCDVVVNNAGGALGVTRVEDGDPEEWERMYATNVVGTLRVTQAVLPLLRRSARATVVDISSIAGERVYEGGGGYVAAKHGTSVVSETLRLELNGENIRVVDIRPGMVRTEEFSLTRLHGDQAAADKVYDDVDRPLVADDVAECVGFVVGLPQHVNIDTMVIKPVAQAAPHKIHRGPIDWKDAR

Samples

Sample ID Description Type Environment
1 2626541554 Frankia sp. AvcI.1 Isolate Nodule
2 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
3 2643221616 Leifsonia sp. Root227 Isolate Unclassified
4 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
5 2643221679 Angustibacter sp. Root456 Isolate Unclassified
6 2643221711 Terrabacter sp. Root85 Isolate Unclassified
7 2808606700 Arthrobacter agilis UMCV2 Isolate Rhizosphere
8 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
9 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
10 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
11 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
12 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
13 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
14 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
15 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
16 2862574272 Streptomyces sp. AcE210 Isolate Nodule
17 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
18 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
19 2904501621 Curtobacterium sp. 1909 Isolate Unclassified
20 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
21 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
22 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
23 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
24 2928153084 Leifsonia sp. 563 Isolate Unclassified
25 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
26 2984592036 Aeromicrobium sp. SORGH_AS981 Isolate Aerial Root
27 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
28 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
29 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
30 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
31 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
32 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
33 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
34 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
35 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
36 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
37 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
38 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
39 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
40 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
41 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
42 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
56 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
57 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
60 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
68 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
69 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
70 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
71 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
72 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
73 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
74 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
75 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
76 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
77 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
78 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
79 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
80 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
81 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
82 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
83 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
84 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
85 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
86 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
87 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
88 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
89 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
90 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
91 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
92 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
93 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
94 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
95 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
96 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
97 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
98 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
99 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
100 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
101 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
102 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
103 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
104 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
105 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
106 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
107 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
108 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
109 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
110 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
111 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
112 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
113 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
114 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
115 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
116 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
120 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
121 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
123 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
124 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
125 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
126 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
127 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
128 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
129 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
130 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
131 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere
132 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
133 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
134 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 79.55
Metatranscriptomes 2.84
Isolates 17.61

Biome Distribution

Category Percentage (%)
Aerial Root 0.57
Bulb 0
Endosphere 17.05
Nodule 1.14
Rhizoplane 11.93
Rhizosphere 57.39
Stem 0
Stem Tuber 0.57
Unclassified 11.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10001102 3300002067 Bacteria 9670
2 JGI25162J39368_1008484 3300002737 Bacteria 1470
3 JGI25164J39214_1000917 3300002772 Bacteria 9799
4 JGI25165J46597_1000044 3300003214 Bacteria 263289
5 Ga0006562J51391_1014374 3300003578 Bacteria 18050
6 Ga0006562J51391_1014378 3300003578 Bacteria 9390
7 Ga0006562J51391_1102973 3300003578 Bacteria 2140
8 Ga0006562J51391_1102974 3300003578 Bacteria 2021
9 Ga0055539_1000027 3300003752 Bacteria 258020
10 Ga0055533_1000020 3300003756 Bacteria 353998
11 Ga0055525_1000296 3300003759 Bacteria 43199
12 Ga0055525_1003675 3300003759 Bacteria 1356
13 Ga0055527_1000005 3300003760 Bacteria 504776
14 Ga0055542_1000006 3300003762 Bacteria 504776
15 Ga0055529_1000013 3300003763 Bacteria 373267
16 Ga0055541_1002903 3300003841 Bacteria 3310
17 Ga0070658_10007450 3300005327 Bacteria 8835
18 Ga0070658_10305364 3300005327 Bacteria 1357
19 Ga0070660_100407286 3300005339 Bacteria 1125
20 Ga0070661_100091217 3300005344 Bacteria 2257
21 Ga0070664_100079362 3300005564 Bacteria 2825
22 Ga0068860_100324720 3300005843 Bacteria 1511
23 Ga0081455_10003571 3300005937 Bacteria 17853
24 Ga0105237_10488007 3300009545 Bacteria 1238
25 Ga0157369_10042139 3300013105 Bacteria 4981
26 Ga0157369_10473648 3300013105 Bacteria 1296
27 Ga0157375_10477389 3300013308 Bacteria 1412
28 Ga0206353_11269635 3300020082 Bacteria 2796
29 Ga0209566_100043 3300025225 Bacteria 266609
30 Ga0209674_100001 3300025226 Bacteria 4013750
31 Ga0209672_100003 3300025228 Bacteria 1560476
32 Ga0209147_100561 3300025229 Bacteria 20914
33 Ga0209563_100001 3300025230 Bacteria 4013775
34 Ga0209563_100497 3300025230 Bacteria 13325
35 Ga0207427_100126 3300025231 Bacteria 95170
36 Ga0209437_101068 3300025233 Bacteria 8913
37 Ga0209677_100001 3300025253 Bacteria 4013787
38 Ga0209148_1000004 3300025254 Bacteria 1844481
39 Ga0209233_1000014 3300025261 Bacteria 996641
40 Ga0209455_1000046 3300025272 Bacteria 382681
41 Ga0207705_10057962 3300025909 Bacteria 2794
42 Ga0207657_10119479 3300025919 Bacteria 2169
43 Ga0207649_10298594 3300025920 Bacteria 1177
44 Ga0207706_10035334 3300025933 Bacteria 4444
45 Ga0207679_10063085 3300025945 Bacteria 2764
46 Ga0207658_10258571 3300025986 Bacteria 1483
47 Ga0307407_10325167 3300031903 Bacteria 1081
48 Ga0307409_100170572 3300031995 Bacteria 1915
49 Ga0395899_0101689 3300037312 Bacteria 2074
50 Ga0395899_0199608 3300037312 Bacteria 1396
51 Ga0395899_0237411 3300037312 Bacteria 1256
52 Ga0395900_0008066 3300037418 Bacteria 10838
53 Ga0395900_0223855 3300037418 Bacteria 1895
54 Ga0395898_0000098 3300037466 Bacteria 229806
55 Ga0395898_0091433 3300037466 Bacteria 2928
56 Ga0395905_0290319 3300037471 Bacteria 1522
57 Ga0395905_0600025 3300037471 Bacteria 1003
58 Ga0395901_0071704 3300038443 Bacteria 3610
59 Ga0395901_0076573 3300038443 Bacteria 3490
60 Ga0395901_0167493 3300038443 Bacteria 2306
61 Ga0395901_0229049 3300038443 Bacteria 1940
62 Ga0395901_0363241 3300038443 Bacteria 1492
63 Ga0439465_0093897 3300041413 Bacteria 1030
64 Ga0451797_0853218 3300041453 Bacteria 896
65 Ga0451806_478366 3300041462 Bacteria 2468
66 Ga0466972_0002889 3300044658 Bacteria 8505
67 Ga0466972_0057927 3300044658 Bacteria 1860
68 Ga0466972_0062066 3300044658 Bacteria 1791
69 Ga0466972_0084354 3300044658 Bacteria 1510
70 Ga0466972_0107284 3300044658 Bacteria 1320
71 Ga0466965_0005401 3300044683 Bacteria 5759
72 Ga0466965_0023460 3300044683 Bacteria 2980
73 Ga0466965_0030277 3300044683 Bacteria 2637
74 Ga0466965_0054636 3300044683 Bacteria 1986
75 Ga0466966_0021373 3300044684 Bacteria 4249
76 Ga0466966_0022616 3300044684 Bacteria 4124
77 Ga0466966_0096424 3300044684 Bacteria 1832
78 Ga0466961_0010395 3300044693 Bacteria 5939
79 Ga0466961_0032645 3300044693 Bacteria 3346
80 Ga0466961_0032783 3300044693 Bacteria 3338
81 Ga0466961_0097447 3300044693 Bacteria 1854
82 Ga0466963_0000571 3300044694 Bacteria 17434
83 Ga0466963_0109166 3300044694 Bacteria 1898
84 Ga0466968_0009831 3300044735 Bacteria 3692
85 Ga0466970_0002080 3300044765 Bacteria 9679
86 Ga0466970_0021018 3300044765 Bacteria 3397
87 Ga0466970_0054902 3300044765 Bacteria 2127
88 Ga0466957_0044761 3300044842 Bacteria 2683
89 Ga0466960_0003931 3300044901 Bacteria 5768
90 Ga0466960_0405949 3300044901 Bacteria 785
91 Ga0466959_0033465 3300045049 Bacteria 3801
92 Ga0466959_0033760 3300045049 Bacteria 3784
93 Ga0466959_0248042 3300045049 Bacteria 1228
94 Ga0466959_0252554 3300045049 Bacteria 1216
95 Ga0466967_0000298 3300045976 Bacteria 22217
96 Ga0495605_0061363 3300046474 Bacteria 1799
97 Ga0495585_0009399 3300046492 Bacteria 5865
98 Ga0495607_0075552 3300046501 Bacteria 1867
99 Ga0495631_0131525 3300046518 Bacteria 1075
100 Ga0495611_0095019 3300046648 Bacteria 1379
101 Ga0495661_0148548 3300046665 Bacteria 1268
102 Ga0495599_0193085 3300046678 Bacteria 1252
103 Ga0495589_0003376 3300046794 Bacteria 8654
104 Ga0495589_0007755 3300046794 Bacteria 5619
105 Ga0495636_0080471 3300047318 Bacteria 1402
106 Ga0495685_001981 3300047447 Bacteria 6353
107 Ga0496100_0032570 3300048903 Bacteria 3253
108 Ga0496100_0152342 3300048903 Bacteria 1650
109 Ga0496101_0002462 3300048904 Bacteria 11371
110 Ga0496102_0021995 3300048905 Bacteria 5647
111 Ga0496102_0423307 3300048905 Bacteria 1251
112 Ga0496103_0020725 3300048906 Bacteria 3952
113 Ga0496104_0007992 3300048907 Bacteria 9379
114 Ga0496104_0028366 3300048907 Bacteria 5188
115 Ga0496105_0029860 3300048908 Bacteria 4463
116 Ga0496108_0255746 3300048911 Bacteria 1524
117 Ga0496108_0346180 3300048911 Bacteria 1297
118 Ga0496109_0356025 3300048912 Bacteria 1383
119 Ga0496111_0184338 3300048914 Bacteria 1552
120 Ga0496111_0408832 3300048914 Bacteria 1003
121 Ga0496112_0309709 3300048915 Bacteria 1524
122 Ga0496113_0258153 3300048916 Bacteria 1392
123 Ga0496114_0018350 3300048917 Bacteria 5657
124 Ga0496114_0081996 3300048917 Bacteria 2725
125 Ga0496115_0576503 3300048918 Bacteria 897
126 Ga0496116_0058606 3300048919 Bacteria 2510
127 Ga0496117_0000214 3300048920 Bacteria 111723
128 Ga0496118_0003500 3300048921 Bacteria 19693
129 Ga0496122_0006061 3300048925 Bacteria 14088
130 Ga0496123_0011537 3300048926 Bacteria 7647
131 Ga0501034_0051826 3300049571 Bacteria 4137
132 Ga0501046_0128469 3300049580 Bacteria 1923
133 Ga0501047_0006440 3300049581 Bacteria 11047
134 Ga0501070_0000044 3300049586 Bacteria 108859
135 Ga0501083_0007852 3300049744 Bacteria 7558
136 Ga0501035_0440019 3300049822 Bacteria 1080
137 Ga0501044_0014846 3300049823 Bacteria 8395
138 Ga0500635_0000004 3300053080 Bacteria 210675
139 Ga0500573_0152245 3300053140 Bacteria 1265
140 Ga0500577_0031328 3300053142 Bacteria 1859
141 Ga0500590_020603 3300053148 Bacteria 3423
142 Ga0500616_0000021 3300053153 Bacteria 484527
143 Ga0500620_000319 3300053155 Bacteria 9097
144 Ga0500645_069863 3300053730 Bacteria 1009
145 Ga0466962_0061785 3300061719 Bacteria 1788

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048911 Ga0496108_0346180 Ga0496108_0346180_19_621 198
2 3300020082 Ga0206353_11269635 Ga0206353_112696353 216
3 3300038443 Ga0395901_0071704 Ga0395901_0071704_561_1361 226
4 3300005327 Ga0070658_10305364 Ga0070658_103053641 228
5 3300041453 Ga0451797_0853218 Ga0451797_0853218_55_756 228
6 3300041462 Ga0451806_478366 Ga0451806_478366_42_743 228
7 3300044901 Ga0466960_0405949 Ga0466960_0405949_22_768 232
8 3300025986 Ga0207658_10258571 Ga0207658_102585712 233
9 3300049744 Ga0501083_0007852 Ga0501083_0007852_1927_2643 236
10 3300048911 Ga0496108_0255746 Ga0496108_0255746_479_1234 238
11 iso_pu_bacteria 2643221679 2644444773 238
12 3300009545 Ga0105237_10488007 Ga0105237_104880071 239
13 3300044693 Ga0466961_0032783 Ga0466961_0032783_755_1528 239
14 3300044765 Ga0466970_0054902 Ga0466970_0054902_91_864 239
15 3300053140 Ga0500573_0152245 Ga0500573_0152245_82_801 239
16 3300053730 Ga0500645_069863 Ga0500645_069863_256_987 239
17 3300005843 Ga0068860_100324720 Ga0068860_1003247201 241
18 iso_pu_bacteria 8056667051 8056672750 241
19 iso_pu_bacteria 2626541554 2626637962 242
20 iso_pu_bacteria 2643221567 2643852440 243
21 iso_pu_bacteria 2643221624 2644136963 243
22 3300005937 Ga0081455_10003571 Ga0081455_100035712 245
23 3300037312 Ga0395899_0199608 Ga0395899_0199608_182_943 245
24 3300037471 Ga0395905_0600025 Ga0395905_0600025_217_978 245
25 3300038443 Ga0395901_0167493 Ga0395901_0167493_776_1537 245
26 3300044658 Ga0466972_0002889 Ga0466972_0002889_6835_7611 245
27 3300044658 Ga0466972_0084354 Ga0466972_0084354_219_995 245
28 3300044683 Ga0466965_0005401 Ga0466965_0005401_3785_4561 245
29 3300044683 Ga0466965_0023460 Ga0466965_0023460_1569_2345 245
30 3300044684 Ga0466966_0021373 Ga0466966_0021373_2424_3200 245
31 3300044693 Ga0466961_0010395 Ga0466961_0010395_4149_4925 245
32 3300044693 Ga0466961_0097447 Ga0466961_0097447_100_876 245
33 3300044694 Ga0466963_0000571 Ga0466963_0000571_5245_6009 245
34 3300044735 Ga0466968_0009831 Ga0466968_0009831_2038_2814 245
35 3300044901 Ga0466960_0003931 Ga0466960_0003931_2371_3147 245
36 3300045049 Ga0466959_0033465 Ga0466959_0033465_2526_3302 245
37 3300046474 Ga0495605_0061363 Ga0495605_0061363_254_1030 245
38 3300046492 Ga0495585_0009399 Ga0495585_0009399_3608_4384 245
39 3300046501 Ga0495607_0075552 Ga0495607_0075552_417_1193 245
40 3300046518 Ga0495631_0131525 Ga0495631_0131525_13_789 245
41 3300046648 Ga0495611_0095019 Ga0495611_0095019_496_1272 245
42 3300046665 Ga0495661_0148548 Ga0495661_0148548_309_1085 245
43 3300046794 Ga0495589_0003376 Ga0495589_0003376_5618_6394 245
44 3300046794 Ga0495589_0007755 Ga0495589_0007755_3518_4294 245
45 3300047318 Ga0495636_0080471 Ga0495636_0080471_138_914 245
46 3300047447 Ga0495685_001981 Ga0495685_001981_3369_4145 245
47 3300049571 Ga0501034_0051826 Ga0501034_0051826_1432_2208 245
48 3300049580 Ga0501046_0128469 Ga0501046_0128469_1105_1869 245
49 3300049581 Ga0501047_0006440 Ga0501047_0006440_10078_10842 245
50 3300049822 Ga0501035_0440019 Ga0501035_0440019_92_868 245
51 3300061719 Ga0466962_0061785 Ga0466962_0061785_15_791 245
52 iso_pu_bacteria 2862507626 2862514513 245
53 iso_pu_bacteria 2862574272 2862578346 245
54 iso_pu_bacteria 2887443736 2887443873 245
55 iso_pu_bacteria 2912723979 2912730951 245
56 iso_pu_bacteria 2919446982 2919448129 245
57 iso_pu_bacteria 2984592036 2984593461 245
58 iso_pu_bacteria 3006493962 3006494404 245
59 3300003578 Ga0006562J51391_1102973 Ga0006562J51391_11029732 246
60 3300003578 Ga0006562J51391_1102974 Ga0006562J51391_11029743 246
61 3300044694 Ga0466963_0109166 Ga0466963_0109166_626_1381 246
62 3300045976 Ga0466967_0000298 Ga0466967_0000298_393_1172 246
63 3300049823 Ga0501044_0014846 Ga0501044_0014846_4702_5466 246
64 3300046678 Ga0495599_0193085 Ga0495599_0193085_391_1137 247
65 iso_pu_bacteria 8056447290 8056454389 247
66 3300005339 Ga0070660_100407286 Ga0070660_1004072862 248
67 3300005344 Ga0070661_100091217 Ga0070661_1000912172 248
68 3300005564 Ga0070664_100079362 Ga0070664_1000793622 248
69 3300025919 Ga0207657_10119479 Ga0207657_101194792 248
70 3300025920 Ga0207649_10298594 Ga0207649_102985941 248
71 3300025933 Ga0207706_10035334 Ga0207706_100353345 248
72 3300025945 Ga0207679_10063085 Ga0207679_100630852 248
73 iso_pu_bacteria 2808606700 2810363931 249
74 3300013308 Ga0157375_10477389 Ga0157375_104773891 250
75 3300031903 Ga0307407_10325167 Ga0307407_103251671 250
76 3300031995 Ga0307409_100170572 Ga0307409_1001705722 250
77 3300037312 Ga0395899_0237411 Ga0395899_0237411_318_1106 250
78 3300037418 Ga0395900_0223855 Ga0395900_0223855_60_827 250
79 3300037466 Ga0395898_0091433 Ga0395898_0091433_622_1389 250
80 3300037471 Ga0395905_0290319 Ga0395905_0290319_454_1242 250
81 3300038443 Ga0395901_0076573 Ga0395901_0076573_2144_2932 250
82 3300038443 Ga0395901_0229049 Ga0395901_0229049_791_1558 250
83 3300038443 Ga0395901_0363241 Ga0395901_0363241_331_1098 250
84 3300044684 Ga0466966_0096424 Ga0466966_0096424_346_1113 250
85 3300044693 Ga0466961_0032645 Ga0466961_0032645_1440_2210 250
86 3300048903 Ga0496100_0032570 Ga0496100_0032570_15_830 250
87 3300048903 Ga0496100_0152342 Ga0496100_0152342_482_1297 250
88 3300048904 Ga0496101_0002462 Ga0496101_0002462_318_1133 250
89 3300048905 Ga0496102_0021995 Ga0496102_0021995_489_1304 250
90 3300048905 Ga0496102_0423307 Ga0496102_0423307_429_1229 250
91 3300048906 Ga0496103_0020725 Ga0496103_0020725_133_948 250
92 3300048907 Ga0496104_0007992 Ga0496104_0007992_8446_9261 250
93 3300048907 Ga0496104_0028366 Ga0496104_0028366_588_1364 250
94 3300048908 Ga0496105_0029860 Ga0496105_0029860_3282_4097 250
95 3300048912 Ga0496109_0356025 Ga0496109_0356025_207_1022 250
96 3300048914 Ga0496111_0184338 Ga0496111_0184338_243_1100 250
97 3300048914 Ga0496111_0408832 Ga0496111_0408832_134_910 250
98 3300048915 Ga0496112_0309709 Ga0496112_0309709_473_1321 250
99 3300048916 Ga0496113_0258153 Ga0496113_0258153_193_1002 250
100 3300048917 Ga0496114_0018350 Ga0496114_0018350_1066_1929 250
101 3300048917 Ga0496114_0081996 Ga0496114_0081996_1535_2350 250
102 3300048918 Ga0496115_0576503 Ga0496115_0576503_49_849 250
103 iso_pu_bacteria 2643221711 2644607744 250
104 iso_pu_bacteria 2811994882 2812373253 250
105 iso_pu_bacteria 2818991318 2819426053 250
106 iso_pu_bacteria 2818991458 2819665111 250
107 iso_pu_bacteria 2818991462 2819692826 250
108 iso_pu_bacteria 2818991469 2819727225 250
109 3300025231 Ga0207427_100126 Ga0207427_10012616 251
110 3300025233 Ga0209437_101068 Ga0209437_1010682 251
111 3300025261 Ga0209233_1000014 Ga0209233_100001482 251
112 3300053142 Ga0500577_0031328 Ga0500577_0031328_908_1663 251
113 iso_pu_bacteria 2844852863 2844855739 252
114 iso_pu_bacteria 8056037122 8056039607 252
115 3300053080 Ga0500635_0000004 Ga0500635_0000004_208396_209160 253
116 iso_pu_bacteria 2844841374 2844841595 253
117 iso_pu_bacteria 2919055335 2919057251 253
118 iso_pu_bacteria 2919523602 2919523603 253
119 iso_pu_bacteria 2928153084 2928155029 253
120 iso_pu_bacteria 2643221616 2644095116 254
121 iso_pu_bacteria 2884763398 2884764516 254
122 iso_pu_bacteria 2964326757 2964329087 255
123 3300002067 JGI24735J21928_10001102 JGI24735J21928_100011025 257
124 3300002737 JGI25162J39368_1008484 JGI25162J39368_10084842 257
125 3300002772 JGI25164J39214_1000917 JGI25164J39214_10009177 257
126 3300003214 JGI25165J46597_1000044 JGI25165J46597_100004483 257
127 3300003578 Ga0006562J51391_1014374 Ga0006562J51391_101437410 257
128 3300003578 Ga0006562J51391_1014378 Ga0006562J51391_10143782 257
129 3300003752 Ga0055539_1000027 Ga0055539_100002794 257
130 3300003756 Ga0055533_1000020 Ga0055533_100002094 257
131 3300003759 Ga0055525_1000296 Ga0055525_100029623 257
132 3300003759 Ga0055525_1003675 Ga0055525_10036752 257
133 3300003760 Ga0055527_1000005 Ga0055527_1000005363 257
134 3300003762 Ga0055542_1000006 Ga0055542_1000006363 257
135 3300003763 Ga0055529_1000013 Ga0055529_1000013272 257
136 3300003841 Ga0055541_1002903 Ga0055541_10029032 257
137 3300005327 Ga0070658_10007450 Ga0070658_100074502 257
138 3300013105 Ga0157369_10042139 Ga0157369_100421394 257
139 3300013105 Ga0157369_10473648 Ga0157369_104736482 257
140 3300025225 Ga0209566_100043 Ga0209566_1000437 257
141 3300025226 Ga0209674_100001 Ga0209674_1000013803 257
142 3300025228 Ga0209672_100003 Ga0209672_100003706 257
143 3300025229 Ga0209147_100561 Ga0209147_1005612 257
144 3300025230 Ga0209563_100001 Ga0209563_1000013803 257
145 3300025230 Ga0209563_100497 Ga0209563_10049716 257
146 3300025253 Ga0209677_100001 Ga0209677_1000013803 257
147 3300025254 Ga0209148_1000004 Ga0209148_10000041001 257
148 3300025272 Ga0209455_1000046 Ga0209455_100004620 257
149 3300025909 Ga0207705_10057962 Ga0207705_100579623 257
150 3300037312 Ga0395899_0101689 Ga0395899_0101689_65_841 257
151 3300037418 Ga0395900_0008066 Ga0395900_0008066_1490_2266 257
152 3300037466 Ga0395898_0000098 Ga0395898_0000098_161362_162138 257
153 3300041413 Ga0439465_0093897 Ga0439465_0093897_10_852 257
154 3300044658 Ga0466972_0057927 Ga0466972_0057927_640_1419 257
155 3300044658 Ga0466972_0062066 Ga0466972_0062066_221_1000 257
156 3300044658 Ga0466972_0107284 Ga0466972_0107284_302_1075 257
157 3300044683 Ga0466965_0030277 Ga0466965_0030277_1386_2168 257
158 3300044683 Ga0466965_0054636 Ga0466965_0054636_539_1318 257
159 3300044684 Ga0466966_0022616 Ga0466966_0022616_949_1728 257
160 3300044765 Ga0466970_0002080 Ga0466970_0002080_6036_6815 257
161 3300044765 Ga0466970_0021018 Ga0466970_0021018_1539_2318 257
162 3300044842 Ga0466957_0044761 Ga0466957_0044761_1343_2122 257
163 3300045049 Ga0466959_0033760 Ga0466959_0033760_2236_3015 257
164 3300045049 Ga0466959_0248042 Ga0466959_0248042_248_1027 257
165 3300045049 Ga0466959_0252554 Ga0466959_0252554_260_1033 257
166 3300048919 Ga0496116_0058606 Ga0496116_0058606_305_1078 257
167 3300048920 Ga0496117_0000214 Ga0496117_0000214_59819_60613 257
168 3300048921 Ga0496118_0003500 Ga0496118_0003500_9208_9981 257
169 3300048925 Ga0496122_0006061 Ga0496122_0006061_713_1495 257
170 3300048926 Ga0496123_0011537 Ga0496123_0011537_4683_5465 257
171 3300049586 Ga0501070_0000044 Ga0501070_0000044_47632_48405 257
172 3300053148 Ga0500590_020603 Ga0500590_020603_1897_2670 257
173 3300053153 Ga0500616_0000021 Ga0500616_0000021_96241_97023 257
174 3300053155 Ga0500620_000319 Ga0500620_000319_1236_2009 257
175 iso_pu_bacteria 2904501621 2904503278 257
176 iso_pu_bacteria 8057345674 8057348500 257

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

31

219

0.97

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

37

251

0.92

PF08659

KR

KR domain

32

204

0.87

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

33

175

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
3asu-assembly1.cif.gz_A-2 crystal structure of serine dehydrogenase from escherichia coli 0.9253 4 244
3asu-assembly1.cif.gz_B-2 crystal structure of serine dehydrogenase from escherichia coli 0.9215 4 244
3p19-assembly1.cif.gz_B improved nadph-dependent blue fluorescent protein 0.9181 3 242
3asu-assembly1.cif.gz_A-2 crystal structure of serine dehydrogenase from escherichia coli 0.9171 4 244
1xg5-assembly1.cif.gz_C structure of human putative dehydrogenase mgc4172 in complex with nadp 0.9152 2 242
ID Description Score Start End Superfamily
af_P9WGR5_6_248_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9773 2 250 3.40.50.720
af_P9WGR5_6_248_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9615 2 250 3.40.50.720
af_A0A0P0WC51_15_133_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.951 3 77 3.40.50.720
af_A0A0R0HUJ2_8_65_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9227 4 47 3.40.50.720
af_A0A0P0Y501_3_211_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9216 3 186 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7C8BTM6-F1-model_v4 SDR family oxidoreductase 0.9892 1 256 GO:0016491
AF-A0A0Q5MPN0-F1-model_v4 Oxidoreductase 0.9865 1 256 GO:0016491
AF-A0A169C1S1-F1-model_v4 Oxidoreductase 0.9865 7 257 GO:0016491
AF-A0A5P9Q8R2-F1-model_v4 Putative oxidoreductase 0.9837 2 252 GO:0016491
AF-A0A2T6LFU9-F1-model_v4 NADP-dependent 3-hydroxy acid dehydrogenase YdfG 0.9836 2 253 GO:0016491

Feature Viewer

pLDDT pTM Quality
93.24 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map