F268768

General Info

Members Datasets Scaffolds Average Seq Length
176 137 95 151

Family's Representative Sequence

Representative Sequence 3300044656|Ga0466969_0008335|Ga0466969_0008335_2561_3064
Length 167
Sequence MEENDFDALITIIRRCAMKAEYINPFLESARIVIEQVACIRPTTGQLGIKDVQFVENYIWIKIGMTGQMQGDILFGLHEAVALKVVSAMMGGFVLTEMDDIGRSAISELGNMISGNASTMLYNQGVRVDITPPKLFANGERIEAKKALTIPLIMDGIGELDIQVLIA

Samples

Sample ID Description Type Environment
1 2510917027 Brevibacillus sp. CF112 Isolate Rhizosphere
2 2512564013 Brevibacillus sp. BC25 Isolate Rhizosphere
3 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
4 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
5 2548877040 Paenibacillus sonchi X19-5 Isolate Rhizosphere
6 2563366752 Paenibacillus pini JCM 16418 Isolate Rhizosphere
7 2571042143 Paenibacillus graminis RSA19 Isolate Unclassified
8 2571042588 Paenibacillus zanthoxyli JH29 Isolate Unclassified
9 2576861424 Paenibacillus sabinae T27 Isolate Rhizosphere
10 2579778775 Paenibacillus durus P3L-5 Isolate Unclassified
11 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
12 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
13 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
14 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
15 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
16 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
17 2728368933 Paenibacillus jilunlii DSM 23019 Isolate Rhizosphere
18 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
19 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
20 2791355222 Paenibacillus oryzae 1DrF-4 Isolate Unclassified
21 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
22 2818991459 Paenibacillus sp. 597 Isolate Unclassified
23 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
24 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
25 2857460504 Brevibacillus sp. R-74223 Isolate Unclassified
26 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
27 2857472729 Cohnella sp. R-74144 Isolate Unclassified
28 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
29 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
30 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
31 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
32 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
33 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
34 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
35 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
36 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
37 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
38 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
39 2898907183 Brevibacillus sp. SYP-B805 Isolate Rhizosphere
40 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
41 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
42 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
43 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
44 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
45 2915597211 Brevibacillus brevis Ag35 Isolate Nodule
46 2915606848 Brevibacillus sp. HD1.4A Isolate Rhizosphere
47 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
48 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
49 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
50 2929183550 Brevibacillus sp. R-71971 Hybrid assembly Isolate Unclassified
51 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
52 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
53 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
54 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
55 2939702853 Paenibacillus sp. PvR008 Isolate Rhizosphere
56 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
57 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
58 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
59 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
60 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
61 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
62 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
63 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
64 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
65 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
66 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
67 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
68 2984527788 Paenibacillus sp. SORGH_AS306 Isolate Aerial Root
69 2984532647 Paenibacillus sp. SORGH_AS338 Isolate Aerial Root
70 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
71 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
72 2996706504 Paenibacillus sp. OT2-17 Isolate Rhizosphere
73 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
74 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
75 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
76 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
77 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
78 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
88 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
93 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
94 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
95 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
96 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
97 3300041508 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaT Metatranscriptome Unclassified
98 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
99 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
100 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
101 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
102 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
103 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
104 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
105 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
106 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
107 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
108 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
109 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
110 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
111 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
112 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
113 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
114 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
115 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
116 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
117 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
118 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
119 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
120 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
121 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
122 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
123 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
124 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
125 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
127 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
128 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
129 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
130 8002317523 Cohnella sp. GbtcB17 Isolate Unclassified
131 8007371054 Clostridium sp. YIM B02515 Isolate Unclassified
132 8046991243 Cohnella rhizosphaerae DSM 28161 Isolate Rhizosphere
133 8054465665 Paenibacillus sonchi IIRRBNF1 Isolate Rhizosphere
134 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified
135 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
136 8057733483 Paenibacillus apiarius MW-14 Isolate Rhizosphere
137 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 52.84
Metatranscriptomes 1.14
Isolates 46.02

Biome Distribution

Category Percentage (%)
Aerial Root 1.14
Bulb 0
Endosphere 7.95
Nodule 0.57
Rhizoplane 0.57
Rhizosphere 47.16
Stem 0
Stem Tuber 0
Unclassified 42.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055538_1000338 3300003751 Bacteria 20966
2 Ga0055532_1001802 3300003758 Bacteria 5318
3 Ga0055535_1006795 3300003761 Bacteria 2267
4 Ga0055534_1034326 3300003784 Bacteria 769
5 Ga0105251_10039008 3300009011 Bacteria 2322
6 Ga0105244_10008980 3300009036 Bacteria 6186
7 Ga0105237_10000073 3300009545 Bacteria 134905
8 Ga0105246_10008714 3300011119 Bacteria 6242
9 Ga0157371_10185126 3300013102 Bacteria 1490
10 Ga0157378_10201877 3300013297 Bacteria 1881
11 Ga0157379_10701681 3300014968 Bacteria 950
12 Ga0209784_100092 3300025224 Bacteria 116472
13 Ga0209784_102214 3300025224 Bacteria 2058
14 Ga0209566_100077 3300025225 Bacteria 160414
15 Ga0209566_100299 3300025225 Bacteria 44992
16 Ga0209566_100848 3300025225 Bacteria 15218
17 Ga0209566_103634 3300025225 Bacteria 2300
18 Ga0209147_100050 3300025229 Bacteria 274639
19 Ga0209437_101446 3300025233 Bacteria 5793
20 Ga0209675_1005393 3300025291 Bacteria 5365
21 Ga0209676_1052387 3300025292 Bacteria 1064
22 Ga0207655_1020588 3300025728 Bacteria 3383
23 Ga0207655_1053202 3300025728 Bacteria 1621
24 Ga0207671_10000007 3300025914 Bacteria 825758
25 Ga0307515_10000005 3300028794 Bacteria 758563
26 Ga0307515_10216113 3300028794 Bacteria 1747
27 Ga0395899_0030537 3300037312 Bacteria 4052
28 Ga0395899_0151012 3300037312 Bacteria 1646
29 Ga0395900_1150733 3300037418 Bacteria 692
30 Ga0436364_1487472 3300037853 Unclassified 554
31 Ga0439436_0004964 3300041404 Bacteria 4077
32 Ga0451852_18781 3300041508 Bacteria 931
33 Ga0439433_0053605 3300041999 Bacteria 953
34 Ga0439449_0020976 3300042007 Bacteria 2448
35 Ga0439449_0029723 3300042007 Bacteria 2036
36 Ga0439457_002797 3300042014 Bacteria 4880
37 Ga0439462_0000254 3300042015 Bacteria 9580
38 Ga0439462_0003537 3300042015 Bacteria 3754
39 Ga0466969_0008335 3300044656 Bacteria 5497
40 Ga0466965_0201512 3300044683 Bacteria 1056
41 Ga0466965_0228957 3300044683 Bacteria 992
42 Ga0453684_0060490 3300044712 Bacteria 4871
43 Ga0453684_0293383 3300044712 Bacteria 1851
44 Ga0466971_0086394 3300044719 Bacteria 1434
45 Ga0466968_0005071 3300044735 Bacteria 4935
46 Ga0466958_0495963 3300045836 Bacteria 792
47 Ga0495627_171563 3300046453 Bacteria 602
48 Ga0495590_0016831 3300046457 Bacteria 2638
49 Ga0495661_0204758 3300046665 Bacteria 1031
50 Ga0495670_0288834 3300046691 Bacteria 878
51 Ga0495626_0064773 3300048091 Bacteria 1655
52 Ga0496116_0001953 3300048919 Bacteria 22221
53 Ga0496116_0009506 3300048919 Bacteria 8279
54 Ga0496116_0018371 3300048919 Bacteria 5393
55 Ga0496116_0055309 3300048919 Bacteria 2607
56 Ga0496116_0061234 3300048919 Bacteria 2437
57 Ga0496116_0062534 3300048919 Bacteria 2403
58 Ga0496116_0248386 3300048919 Bacteria 887
59 Ga0496116_0347588 3300048919 Bacteria 681
60 Ga0496117_0037377 3300048920 Bacteria 3617
61 Ga0496118_0051790 3300048921 Bacteria 3138
62 Ga0496119_0009257 3300048922 Bacteria 8485
63 Ga0496119_0070957 3300048922 Bacteria 2041
64 Ga0496119_0329255 3300048922 Bacteria 745
65 Ga0496120_0007125 3300048923 Bacteria 8385
66 Ga0496120_0145540 3300048923 Bacteria 1197
67 Ga0496121_0360236 3300048924 Bacteria 966
68 Ga0496121_0754388 3300048924 Bacteria 578
69 Ga0496122_0018563 3300048925 Bacteria 6414
70 Ga0496122_0030091 3300048925 Bacteria 4559
71 Ga0496122_0055089 3300048925 Bacteria 2979
72 Ga0496122_0063652 3300048925 Bacteria 2689
73 Ga0496122_0102546 3300048925 Bacteria 1907
74 Ga0496122_0115436 3300048925 Bacteria 1749
75 Ga0496122_0430985 3300048925 Bacteria 660
76 Ga0496123_0003227 3300048926 Bacteria 18557
77 Ga0496123_0057414 3300048926 Bacteria 2533
78 Ga0496123_0074779 3300048926 Bacteria 2095
79 Ga0496123_0330423 3300048926 Bacteria 716
80 Ga0496124_0000170 3300048927 Bacteria 131603
81 Ga0496124_0005197 3300048927 Bacteria 14787
82 Ga0496124_0027967 3300048927 Bacteria 5050
83 Ga0496125_0000700 3300048928 Bacteria 55427
84 Ga0496125_0005956 3300048928 Bacteria 13346
85 Ga0496125_0022594 3300048928 Bacteria 5835
86 Ga0496125_0250463 3300048928 Bacteria 1118
87 Ga0496126_0001067 3300048929 Bacteria 46207
88 Ga0496126_0002480 3300048929 Bacteria 24828
89 Ga0496126_0059591 3300048929 Bacteria 3437
90 Ga0496126_1168053 3300048929 Bacteria 568
91 Ga0501305_021044 3300049161 Bacteria 962
92 Ga0501048_1117286 3300049582 Bacteria 567
93 Ga0501208_001561 3300049655 Bacteria 2210
94 Ga0501217_001257 3300049661 Bacteria 4700
95 Ga0530510_0881091 3300061734 Bacteria 684

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013297 Ga0157378_10201877 Ga0157378_102018772 134
2 3300041404 Ga0439436_0004964 Ga0439436_0004964_20_436 137
3 3300009545 Ga0105237_10000073 Ga0105237_1000007362 138
4 3300025914 Ga0207671_10000007 Ga0207671_10000007243 138
5 3300044712 Ga0453684_0293383 Ga0453684_0293383_1348_1827 138
6 iso_pu_bacteria 2802428803 2802438678 144
7 iso_pu_bacteria 2512564039 2512735705 145
8 iso_pu_bacteria 8057733483 8057737158 146
9 iso_pu_bacteria 2510917027 2511176199 147
10 iso_pu_bacteria 2512564013 2512640176 147
11 iso_pu_bacteria 2548877040 2550903761 147
12 iso_pu_bacteria 2571042143 2571529536 147
13 iso_pu_bacteria 2600255286 2601640695 147
14 iso_pu_bacteria 2728368933 2728532173 147
15 iso_pu_bacteria 2898907183 2898909316 147
16 iso_pu_bacteria 2915597211 2915600258 147
17 iso_pu_bacteria 2915606848 2915609845 147
18 iso_pu_bacteria 2929183550 2929185441 147
19 iso_pu_bacteria 2929206907 2929211088 147
20 iso_pu_bacteria 2938649242 2938652898 147
21 iso_pu_bacteria 2968558590 2968563632 147
22 iso_pu_bacteria 2988225383 2988225962 147
23 iso_pu_bacteria 2996632988 2996634224 147
24 iso_pu_bacteria 8007371054 8007375099 147
25 iso_pu_bacteria 8054465665 8054470692 147
26 iso_pu_bacteria 2524023129 2524187179 148
27 iso_pu_bacteria 2563366752 2563928583 148
28 iso_pu_bacteria 2571042588 2573037610 148
29 iso_pu_bacteria 2576861424 2578338373 148
30 iso_pu_bacteria 2579778775 2580934844 148
31 iso_pu_bacteria 2585428059 2587742807 148
32 iso_pu_bacteria 2619619294 2621276817 148
33 iso_pu_bacteria 2643221543 2643740950 148
34 iso_pu_bacteria 2643221676 2644428061 148
35 iso_pu_bacteria 2791355222 2793186234 148
36 iso_pu_bacteria 2818991459 2819671046 148
37 iso_pu_bacteria 2821111986 2821117322 148
38 iso_pu_bacteria 2857453340 2857457946 148
39 iso_pu_bacteria 2857465823 2857466374 148
40 iso_pu_bacteria 2857472729 2857478905 148
41 iso_pu_bacteria 2857591370 2857593551 148
42 iso_pu_bacteria 2864733723 2864735579 148
43 iso_pu_bacteria 2864997549 2864998919 148
44 iso_pu_bacteria 2865002811 2865006303 148
45 iso_pu_bacteria 2881636855 2881640186 148
46 iso_pu_bacteria 2885526491 2885533066 148
47 iso_pu_bacteria 2888578766 2888583598 148
48 iso_pu_bacteria 2889042446 2889047590 148
49 iso_pu_bacteria 2889049205 2889053937 148
50 iso_pu_bacteria 2889276214 2889276233 148
51 iso_pu_bacteria 2889295896 2889300557 148
52 iso_pu_bacteria 2904162308 2904162459 148
53 iso_pu_bacteria 2904490793 2904495619 148
54 iso_pu_bacteria 2904595352 2904598975 148
55 iso_pu_bacteria 2904755435 2904755933 148
56 iso_pu_bacteria 2907202186 2907207560 148
57 iso_pu_bacteria 2919160200 2919164494 148
58 iso_pu_bacteria 2919425241 2919428536 148
59 iso_pu_bacteria 2925326138 2925333157 148
60 iso_pu_bacteria 2931384279 2931384640 148
61 iso_pu_bacteria 2939679117 2939683924 148
62 iso_pu_bacteria 2945991243 2945996704 148
63 iso_pu_bacteria 2946053406 2946059393 148
64 iso_pu_bacteria 2971410472 2971413560 148
65 iso_pu_bacteria 2971511577 2971516007 148
66 iso_pu_bacteria 2980125574 2980126437 148
67 iso_pu_bacteria 2980176882 2980177781 148
68 iso_pu_bacteria 2981284811 2981287529 148
69 iso_pu_bacteria 2981289755 2981292724 148
70 iso_pu_bacteria 2981980479 2981983062 148
71 iso_pu_bacteria 2981985349 2981987972 148
72 iso_pu_bacteria 2984527788 2984530855 148
73 iso_pu_bacteria 2984532647 2984536964 148
74 iso_pu_bacteria 2996706504 2996711597 148
75 iso_pu_bacteria 648028048 648171769 148
76 iso_pu_bacteria 8002317523 8002321423 148
77 iso_pu_bacteria 8046991243 8046995663 148
78 iso_pu_bacteria 8055632911 8055633414 148
79 iso_pu_bacteria 8056533031 8056535690 148
80 iso_pu_bacteria 8057977335 8057980829 148
81 3300037312 Ga0395899_0030537 Ga0395899_0030537_1397_1846 149
82 3300037312 Ga0395899_0151012 Ga0395899_0151012_328_780 149
83 iso_pu_bacteria 2857460504 2857462503 149
84 3300003761 Ga0055535_1006795 Ga0055535_10067952 150
85 3300014968 Ga0157379_10701681 Ga0157379_107016811 150
86 3300025225 Ga0209566_100077 Ga0209566_10007719 150
87 3300028794 Ga0307515_10000005 Ga0307515_10000005249 150
88 3300041508 Ga0451852_18781 Ga0451852_18781_303_773 150
89 3300044656 Ga0466969_0008335 Ga0466969_0008335_2561_3064 150
90 3300044683 Ga0466965_0201512 Ga0466965_0201512_485_988 150
91 3300044719 Ga0466971_0086394 Ga0466971_0086394_535_1038 150
92 3300044735 Ga0466968_0005071 Ga0466968_0005071_2198_2701 150
93 3300046665 Ga0495661_0204758 Ga0495661_0204758_488_943 150
94 3300046691 Ga0495670_0288834 Ga0495670_0288834_33_488 150
95 3300048091 Ga0495626_0064773 Ga0495626_0064773_189_644 150
96 iso_pu_bacteria 2721755693 2723605722 150
97 iso_pu_bacteria 2728369359 2730136397 150
98 iso_pu_bacteria 2751185905 2753810352 150
99 iso_pu_bacteria 2939702853 2939704245 150
100 3300003758 Ga0055532_1001802 Ga0055532_10018023 151
101 3300003784 Ga0055534_1034326 Ga0055534_10343261 151
102 3300025224 Ga0209784_102214 Ga0209784_1022142 151
103 3300025229 Ga0209147_100050 Ga0209147_100050123 151
104 3300025291 Ga0209675_1005393 Ga0209675_10053934 151
105 3300028794 Ga0307515_10216113 Ga0307515_102161132 151
106 3300037853 Ga0436364_1487472 Ga0436364_1487472_77_541 151
107 3300044683 Ga0466965_0228957 Ga0466965_0228957_473_958 151
108 3300044712 Ga0453684_0060490 Ga0453684_0060490_3649_4128 151
109 3300046453 Ga0495627_171563 Ga0495627_171563_29_487 151
110 3300046457 Ga0495590_0016831 Ga0495590_0016831_959_1417 151
111 3300048919 Ga0496116_0347588 Ga0496116_0347588_23_478 151
112 3300048922 Ga0496119_0329255 Ga0496119_0329255_127_582 151
113 3300048924 Ga0496121_0754388 Ga0496121_0754388_65_520 151
114 3300048929 Ga0496126_1168053 Ga0496126_1168053_42_497 151
115 3300049161 Ga0501305_021044 Ga0501305_021044_371_829 151
116 3300049582 Ga0501048_1117286 Ga0501048_1117286_37_495 151
117 3300049655 Ga0501208_001561 Ga0501208_001561_152_610 151
118 3300049661 Ga0501217_001257 Ga0501217_001257_3199_3657 151
119 3300061734 Ga0530510_0881091 Ga0530510_0881091_83_541 151
120 iso_pu_bacteria 2971403814 2971408822 151
121 3300003751 Ga0055538_1000338 Ga0055538_10003386 152
122 3300009011 Ga0105251_10039008 Ga0105251_100390082 152
123 3300009036 Ga0105244_10008980 Ga0105244_100089806 152
124 3300011119 Ga0105246_10008714 Ga0105246_100087142 152
125 3300013102 Ga0157371_10185126 Ga0157371_101851262 152
126 3300025224 Ga0209784_100092 Ga0209784_10009239 152
127 3300025225 Ga0209566_100299 Ga0209566_10029914 152
128 3300025225 Ga0209566_100848 Ga0209566_10084815 152
129 3300025225 Ga0209566_103634 Ga0209566_1036341 152
130 3300025233 Ga0209437_101446 Ga0209437_1014464 152
131 3300025292 Ga0209676_1052387 Ga0209676_10523871 152
132 3300025728 Ga0207655_1020588 Ga0207655_10205882 152
133 3300025728 Ga0207655_1053202 Ga0207655_10532022 152
134 3300037418 Ga0395900_1150733 Ga0395900_1150733_191_649 152
135 3300041999 Ga0439433_0053605 Ga0439433_0053605_273_734 152
136 3300042007 Ga0439449_0020976 Ga0439449_0020976_279_740 152
137 3300042007 Ga0439449_0029723 Ga0439449_0029723_868_1329 152
138 3300042014 Ga0439457_002797 Ga0439457_002797_3265_3726 152
139 3300042015 Ga0439462_0000254 Ga0439462_0000254_8634_9095 152
140 3300042015 Ga0439462_0003537 Ga0439462_0003537_2840_3301 152
141 3300045836 Ga0466958_0495963 Ga0466958_0495963_50_511 152
142 3300048919 Ga0496116_0001953 Ga0496116_0001953_11198_11656 152
143 3300048919 Ga0496116_0009506 Ga0496116_0009506_3304_3762 152
144 3300048919 Ga0496116_0018371 Ga0496116_0018371_3250_3711 152
145 3300048919 Ga0496116_0055309 Ga0496116_0055309_1952_2410 152
146 3300048919 Ga0496116_0061234 Ga0496116_0061234_947_1405 152
147 3300048919 Ga0496116_0062534 Ga0496116_0062534_146_604 152
148 3300048919 Ga0496116_0248386 Ga0496116_0248386_276_734 152
149 3300048920 Ga0496117_0037377 Ga0496117_0037377_2231_2689 152
150 3300048921 Ga0496118_0051790 Ga0496118_0051790_2591_3049 152
151 3300048922 Ga0496119_0009257 Ga0496119_0009257_1867_2325 152
152 3300048922 Ga0496119_0070957 Ga0496119_0070957_181_642 152
153 3300048923 Ga0496120_0007125 Ga0496120_0007125_6189_6647 152
154 3300048923 Ga0496120_0145540 Ga0496120_0145540_705_1163 152
155 3300048924 Ga0496121_0360236 Ga0496121_0360236_263_721 152
156 3300048925 Ga0496122_0018563 Ga0496122_0018563_3913_4374 152
157 3300048925 Ga0496122_0030091 Ga0496122_0030091_4064_4522 152
158 3300048925 Ga0496122_0055089 Ga0496122_0055089_1316_1774 152
159 3300048925 Ga0496122_0063652 Ga0496122_0063652_1155_1613 152
160 3300048925 Ga0496122_0102546 Ga0496122_0102546_588_1046 152
161 3300048925 Ga0496122_0115436 Ga0496122_0115436_889_1347 152
162 3300048925 Ga0496122_0430985 Ga0496122_0430985_119_577 152
163 3300048926 Ga0496123_0003227 Ga0496123_0003227_11651_12112 152
164 3300048926 Ga0496123_0057414 Ga0496123_0057414_1423_1881 152
165 3300048926 Ga0496123_0074779 Ga0496123_0074779_1518_1976 152
166 3300048926 Ga0496123_0330423 Ga0496123_0330423_218_682 152
167 3300048927 Ga0496124_0000170 Ga0496124_0000170_89121_89579 152
168 3300048927 Ga0496124_0005197 Ga0496124_0005197_5811_6272 152
169 3300048927 Ga0496124_0027967 Ga0496124_0027967_3086_3544 152
170 3300048928 Ga0496125_0000700 Ga0496125_0000700_54637_55095 152
171 3300048928 Ga0496125_0005956 Ga0496125_0005956_4964_5425 152
172 3300048928 Ga0496125_0022594 Ga0496125_0022594_4546_5004 152
173 3300048928 Ga0496125_0250463 Ga0496125_0250463_526_984 152
174 3300048929 Ga0496126_0001067 Ga0496126_0001067_34787_35245 152
175 3300048929 Ga0496126_0002480 Ga0496126_0002480_23282_23740 152
176 3300048929 Ga0496126_0059591 Ga0496126_0059591_2595_3053 152

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04509

CheC

CheC-like family

101

136

0.95

PF13690

CheX

Chemotaxis phosphatase CheX

59

156

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
1squ-assembly1.cif.gz_A structural genomics, crystal structure of the chex protein from thermotoga maritima 0.8826 1 152
1xko-assembly1.cif.gz_A structure of thermotoga maritima chex 0.8749 1 152
1xko-assembly1.cif.gz_A structure of thermotoga maritima chex 0.8643 1 152
3hm4-assembly1.cif.gz_B crystal structure of a chemotaxis protein chex (dde_0281) from desulfovibrio desulfuricans subsp. at 1.30 a resolution 0.8605 4 152
3iic-assembly1.cif.gz_B crystal structure of chec-like superfamily protein (yp_001095400.1) from shewanella sp. pv-4 at 2.13 a resolution 0.8582 1 152
ID Description Score Start End Superfamily
1xkoA00 Alpha Beta;3-Layer(aba) Sandwich;Chemotaxis protein chec;CheC-like 0.8749 1 152 3.40.1550.10
1xkoA00 Alpha Beta;3-Layer(aba) Sandwich;Chemotaxis protein chec;CheC-like 0.8643 1 152 3.40.1550.10
3hm4A00 Alpha Beta;3-Layer(aba) Sandwich;Chemotaxis protein chec;CheC-like 0.8546 4 152 3.40.1550.10
3hm4A00 Alpha Beta;3-Layer(aba) Sandwich;Chemotaxis protein chec;CheC-like 0.8281 4 152 3.40.1550.10
3hzhB00 Alpha Beta;3-Layer(aba) Sandwich;Chemotaxis protein chec;CheC-like 0.8169 5 151 3.40.1550.10
ID Description Score Start End GO Terms
AF-A0A7X8VCD0-F1-model_v4 Chemotaxis protein CheX 0.9611 1 123 GO:0006935
AF-R9LI97-F1-model_v4 Chemotaxis protein CheX 0.9583 38 152 GO:0006935
AF-A0A7X8VCD0-F1-model_v4 Chemotaxis protein CheX 0.9536 1 123 GO:0006935
AF-A0A3D4HRA8-F1-model_v4 Chemotaxis protein CheX 0.9466 1 126 GO:0006935
AF-A0A3A8Z9R5-F1-model_v4 Chemotaxis protein CheX 0.9435 1 152 GO:0006935

Feature Viewer

pLDDT pTM Quality
86.14 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map