F268749

General Info

Members Datasets Scaffolds Average Seq Length
176 136 176 123

Family's Representative Sequence

Representative Sequence 3300042118|Ga0450914_001445|Ga0450914_001445_458_901
Length 147
Sequence MAAPRQLDVRGRHQLYNPLVTQLEGYAMATSARLDATFAALADPTRRAILARLSSGEASVLELAEPFDMSQPAISKHLKVLERAGLISRGRDAQRRPCRIEPRPLAEANGWIENYRQLWESNFRRLDSVLQEMKTSSGNRPKRRRLR

Samples

Sample ID Description Type Environment
1 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
38 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
39 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
40 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
41 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
42 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
43 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
44 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
45 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
46 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
59 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
60 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
61 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
62 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
63 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
64 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
87 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
89 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
90 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
91 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
92 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
93 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
94 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
95 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
96 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
97 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
98 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
99 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
100 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
101 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
102 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
103 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
104 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
105 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
106 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
107 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
108 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
109 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
110 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
111 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
112 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
113 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
114 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
115 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
116 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
117 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
118 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
119 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
120 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
121 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
122 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
123 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
124 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
125 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
126 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
127 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
128 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
129 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
130 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
131 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
132 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
133 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
134 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
135 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
136 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.18
Nodule 0
Rhizoplane 1.7
Rhizosphere 75.57
Stem 0
Stem Tuber 0
Unclassified 4.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10000127 3300003187 Bacteria 102790
2 rootL2_10048628 3300003322 Bacteria 6947
3 rootH1_10087256 3300003323 Bacteria 4886
4 Ga0070683_100000032 3300005329 Bacteria 148421
5 Ga0068869_100532229 3300005334 Bacteria 985
6 Ga0070680_100109528 3300005336 Bacteria 2298
7 Ga0070689_100026590 3300005340 Bacteria 4357
8 Ga0070689_100291318 3300005340 Bacteria 1357
9 Ga0070689_100344575 3300005340 Bacteria 1248
10 Ga0070687_100939089 3300005343 Bacteria 623
11 Ga0070687_101375694 3300005343 Bacteria 527
12 Ga0070675_100100832 3300005354 Bacteria 2432
13 Ga0070688_100003910 3300005365 Bacteria 7730
14 Ga0070688_100359108 3300005365 Bacteria 1069
15 Ga0070714_101153199 3300005435 Bacteria 756
16 Ga0070710_10032406 3300005437 Bacteria 2831
17 Ga0070701_10002549 3300005438 Bacteria 7051
18 Ga0070705_100063434 3300005440 Bacteria 2204
19 Ga0070700_100351781 3300005441 Bacteria 1092
20 Ga0070708_101842836 3300005445 Bacteria 561
21 Ga0070681_10084083 3300005458 Bacteria 3135
22 Ga0068867_100029622 3300005459 Bacteria 3944
23 Ga0070685_10039724 3300005466 Bacteria 2675
24 Ga0070685_10071415 3300005466 Bacteria 2058
25 Ga0070706_100452893 3300005467 Bacteria 1194
26 Ga0070699_100189622 3300005518 Bacteria 1826
27 Ga0070699_101518631 3300005518 Bacteria 614
28 Ga0070679_100605192 3300005530 Bacteria 1039
29 Ga0070684_100000422 3300005535 Bacteria 29069
30 Ga0070686_100787180 3300005544 Bacteria 766
31 Ga0070686_100917194 3300005544 Bacteria 714
32 Ga0070695_100532694 3300005545 Bacteria 913
33 Ga0070693_100550056 3300005547 Bacteria 826
34 Ga0070665_100091337 3300005548 Bacteria 3050
35 Ga0070665_102010573 3300005548 Bacteria 583
36 Ga0068857_102253767 3300005577 Bacteria 535
37 Ga0068856_101398370 3300005614 Bacteria 714
38 Ga0070702_100141094 3300005615 Bacteria 1535
39 Ga0068852_100003088 3300005616 Bacteria 11593
40 Ga0068861_101470925 3300005719 Bacteria 667
41 Ga0068863_101789515 3300005841 Bacteria 624
42 Ga0068858_101594395 3300005842 Bacteria 644
43 Ga0068860_100033620 3300005843 Bacteria 4919
44 Ga0081455_10036912 3300005937 Bacteria 4344
45 Ga0075363_100110992 3300006048 Bacteria 1524
46 Ga0075364_10003535 3300006051 Bacteria 8892
47 Ga0075364_10041944 3300006051 Bacteria 2972
48 Ga0070715_10029544 3300006163 Bacteria 2208
49 Ga0070716_100000345 3300006173 Bacteria 18865
50 Ga0070712_100001029 3300006175 Bacteria 16833
51 Ga0075362_10002996 3300006177 Bacteria 5814
52 Ga0075367_10007626 3300006178 Bacteria 5555
53 Ga0075369_10002489 3300006186 Bacteria 6578
54 Ga0075366_10004131 3300006195 Bacteria 7769
55 Ga0075366_10071968 3300006195 Bacteria 2060
56 Ga0075366_10601006 3300006195 Bacteria 682
57 Ga0075370_10010365 3300006353 Bacteria 4871
58 Ga0075370_10044130 3300006353 Bacteria 2520
59 Ga0075370_10265127 3300006353 Bacteria 1019
60 Ga0075430_100000758 3300006846 Bacteria 24898
61 Ga0075430_100424005 3300006846 Bacteria 1098
62 Ga0075433_10018897 3300006852 Bacteria 5736
63 Ga0075434_100276838 3300006871 Bacteria 1697
64 Ga0075429_100000507 3300006880 Bacteria 29416
65 Ga0068865_100663611 3300006881 Bacteria 887
66 Ga0075435_100260341 3300007076 Bacteria 1478
67 Ga0099794_10017447 3300007265 Bacteria 3200
68 Ga0111539_10145143 3300009094 Bacteria 2778
69 Ga0111539_10267682 3300009094 Bacteria 1989
70 Ga0111539_12369345 3300009094 Bacteria 616
71 Ga0111539_12629904 3300009094 Bacteria 583
72 Ga0114129_10005352 3300009147 Bacteria 18113
73 Ga0114129_10022055 3300009147 Bacteria 9037
74 Ga0114129_10571671 3300009147 Bacteria 1468
75 Ga0114129_11339030 3300009147 Bacteria 886
76 Ga0105243_10247929 3300009148 Bacteria 1588
77 Ga0157380_10241290 3300014326 Bacteria 1629
78 Ga0182008_10061362 3300014497 Bacteria 1853
79 Ga0157377_10241577 3300014745 Bacteria 1166
80 Ga0157377_10403897 3300014745 Bacteria 931
81 Ga0213876_10018593 3300021384 Bacteria 3669
82 Ga0224569_101497 3300022732 Bacteria 1956
83 Ga0224571_102883 3300022734 Bacteria 1100
84 Ga0228598_1002242 3300024227 Bacteria 4229
85 Ga0207692_10079938 3300025898 Bacteria 1746
86 Ga0207692_10310017 3300025898 Bacteria 963
87 Ga0207685_10007373 3300025905 Bacteria 3061
88 Ga0207699_10242906 3300025906 Bacteria 1238
89 Ga0207643_10690931 3300025908 Bacteria 659
90 Ga0207654_10403067 3300025911 Bacteria 951
91 Ga0207693_10008428 3300025915 Bacteria 8433
92 Ga0207663_10210896 3300025916 Bacteria 1407
93 Ga0207652_10607755 3300025921 Bacteria 980
94 Ga0207659_10940943 3300025926 Bacteria 743
95 Ga0207664_11461855 3300025929 Bacteria 605
96 Ga0207690_10522714 3300025932 Bacteria 962
97 Ga0207706_10395281 3300025933 Bacteria 1199
98 Ga0207709_10252665 3300025935 Bacteria 1288
99 Ga0207670_10016708 3300025936 Bacteria 4418
100 Ga0207670_10474466 3300025936 Bacteria 1012
101 Ga0207665_10000147 3300025939 Bacteria 47628
102 Ga0207689_11226547 3300025942 Bacteria 631
103 Ga0207661_10000020 3300025944 Bacteria 216011
104 Ga0207677_10080457 3300026023 Bacteria 2334
105 Ga0207677_10398247 3300026023 Bacteria 1167
106 Ga0207703_11316509 3300026035 Bacteria 695
107 Ga0207708_10148446 3300026075 Bacteria 1844
108 Ga0207641_10268633 3300026088 Bacteria 1600
109 Ga0207641_11528026 3300026088 Bacteria 669
110 Ga0207698_10006534 3300026142 Bacteria 7284
111 Ga0209813_10001113 3300027866 Bacteria 5991
112 Ga0268264_10084328 3300028381 Bacteria 2724
113 Ga0307511_10346622 3300030521 Bacteria 641
114 Ga0265332_10007526 3300031238 Bacteria 4922
115 Ga0307509_10054516 3300031507 Bacteria 4256
116 Ga0307408_100097166 3300031548 Bacteria 2237
117 Ga0307408_100395684 3300031548 Bacteria 1185
118 Ga0307408_101470279 3300031548 Bacteria 643
119 Ga0307508_10103953 3300031616 Bacteria 2437
120 Ga0307516_10017963 3300031730 Bacteria 7360
121 Ga0307413_10149244 3300031824 Bacteria 1627
122 Ga0307412_10890365 3300031911 Bacteria 779
123 Ga0307409_100220246 3300031995 Bacteria 1713
124 Ga0307416_100589171 3300032002 Bacteria 1190
125 Ga0307416_100922557 3300032002 Bacteria 974
126 Ga0307411_10247469 3300032005 Bacteria 1400
127 Ga0373939_0366059 3300035114 Bacteria 590
128 Ga0373935_1072902 3300035692 Bacteria 599
129 Ga0373925_1000024 3300037068 Unclassified 689
130 Ga0436365_1276296 3300039437 Bacteria 23903
131 Ga0450914_001445 3300042118 Bacteria 1492
132 Ga0439464_0316869 3300042439 Bacteria 511
133 Ga0495580_0091042 3300046472 Bacteria 2123
134 Ga0495594_0473180 3300046499 Bacteria 712
135 Ga0496106_0862391 3300048909 Bacteria 716
136 Ga0496107_0441064 3300048910 Bacteria 967
137 Ga0496114_0750009 3300048917 Bacteria 853
138 Ga0501079_1508899 3300049741 Bacteria 529
139 Ga0501081_0883584 3300049743 Bacteria 674
140 Ga0501083_0423179 3300049744 Bacteria 867
141 nmdc:mga03683_2495_c1 3300050489 Bacteria 5726
142 nmdc:mga03n38_336151_c1 3300050490 Bacteria 819
143 nmdc:mga03n38_6537_c1 3300050490 Bacteria 4059
144 nmdc:mga00v17_287852_c1 3300050491 Bacteria 1067
145 nmdc:mga00v17_53257_c1 3300050491 Bacteria 2466
146 nmdc:mga0yw44_673561_c1 3300050492 Bacteria 703
147 nmdc:mga0k408_68787_c1 3300050493 Bacteria 2066
148 nmdc:mga06z11_146055_c1 3300050494 Bacteria 1341
149 nmdc:mga04h51_1388_c1 3300050495 Bacteria 5588
150 nmdc:mga07m45_217713_c1 3300050496 Bacteria 1111
151 nmdc:mga07m45_30488_c1 3300050496 Bacteria 2987
152 nmdc:mga05p37_1813243_c1 3300050507 Bacteria 588
153 nmdc:mga05p37_38033_c1 3300050507 Bacteria 5902
154 nmdc:mga05p37_478347_c1 3300050507 Bacteria 1435
155 nmdc:mga05p37_8149_c1 3300050507 Bacteria 12385
156 nmdc:mga09592_13939_c1 3300050508 Bacteria 6566
157 nmdc:mga0qj67_1397939_c1 3300050509 Bacteria 540
158 nmdc:mga0qj67_406879_c1 3300050509 Bacteria 1098
159 nmdc:mga0qj67_411974_c1 3300050509 Bacteria 1090
160 nmdc:mga0qj67_4184_c1 3300050509 Bacteria 10454
161 nmdc:mga06r32_1879_c1 3300050510 Bacteria 12730
162 nmdc:mga06r32_807410_c1 3300050510 Bacteria 898
163 nmdc:mga08y16_26496_c1 3300050511 Bacteria 6112
164 nmdc:mga08y16_85385_c1 3300050511 Bacteria 3289
165 nmdc:mga0n895_304044_c1 3300050512 Bacteria 1617
166 nmdc:mga0a205_99590_c1 3300050515 Bacteria 2805
167 nmdc:mga0sz30_12396_c1 3300050516 Bacteria 3317
168 Ga0500566_0175689 3300053094 Bacteria 1103
169 Ga0500554_018880 3300053102 Bacteria 1870
170 Ga0500595_146556 3300053119 Bacteria 661
171 Ga0500597_025188 3300053120 Bacteria 2395
172 Ga0500636_0360401 3300053177 Bacteria 690
173 Ga0500637_0309904 3300053178 Bacteria 857
174 Ga0501084_0469284 3300054114 Bacteria 1064
175 Ga0501082_0307725 3300060353 Bacteria 1380
176 Ga0501082_0371964 3300060353 Bacteria 1247

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003322 rootL2_10048628 rootL2_100486283 112
2 3300014497 Ga0182008_10061362 Ga0182008_100613622 112
3 3300003323 rootH1_10087256 rootH1_100872563 115
4 3300006048 Ga0075363_100110992 Ga0075363_1001109923 115
5 3300006051 Ga0075364_10041944 Ga0075364_100419442 115
6 3300006353 Ga0075370_10010365 Ga0075370_100103654 115
7 3300009147 Ga0114129_11339030 Ga0114129_113390301 115
8 3300049741 Ga0501079_1508899 Ga0501079_1508899_89_454 115
9 3300050490 nmdc:mga03n38_336151_c1 nmdc:mga03n38_336151_c1_64_450 115
10 3300050491 nmdc:mga00v17_287852_c1 nmdc:mga00v17_287852_c1_168_554 115
11 3300050492 nmdc:mga0yw44_673561_c1 nmdc:mga0yw44_673561_c1_259_645 115
12 3300053177 Ga0500636_0360401 Ga0500636_0360401_90_455 115
13 3300005329 Ga0070683_100000032 Ga0070683_10000003293 116
14 3300005334 Ga0068869_100532229 Ga0068869_1005322292 116
15 3300005340 Ga0070689_100026590 Ga0070689_1000265904 116
16 3300005343 Ga0070687_100939089 Ga0070687_1009390892 116
17 3300005435 Ga0070714_101153199 Ga0070714_1011531991 116
18 3300005437 Ga0070710_10032406 Ga0070710_100324062 116
19 3300005438 Ga0070701_10002549 Ga0070701_100025497 116
20 3300005440 Ga0070705_100063434 Ga0070705_1000634344 116
21 3300005445 Ga0070708_101842836 Ga0070708_1018428361 116
22 3300005467 Ga0070706_100452893 Ga0070706_1004528932 116
23 3300005518 Ga0070699_101518631 Ga0070699_1015186312 116
24 3300005535 Ga0070684_100000422 Ga0070684_1000004223 116
25 3300005545 Ga0070695_100532694 Ga0070695_1005326941 116
26 3300005547 Ga0070693_100550056 Ga0070693_1005500562 116
27 3300005615 Ga0070702_100141094 Ga0070702_1001410943 116
28 3300005841 Ga0068863_101789515 Ga0068863_1017895152 116
29 3300005843 Ga0068860_100033620 Ga0068860_1000336206 116
30 3300006051 Ga0075364_10003535 Ga0075364_100035354 116
31 3300006163 Ga0070715_10029544 Ga0070715_100295442 116
32 3300006173 Ga0070716_100000345 Ga0070716_10000034511 116
33 3300006175 Ga0070712_100001029 Ga0070712_10000102919 116
34 3300006177 Ga0075362_10002996 Ga0075362_100029964 116
35 3300006178 Ga0075367_10007626 Ga0075367_100076264 116
36 3300006186 Ga0075369_10002489 Ga0075369_100024894 116
37 3300006195 Ga0075366_10004131 Ga0075366_100041313 116
38 3300006195 Ga0075366_10071968 Ga0075366_100719684 116
39 3300006195 Ga0075366_10601006 Ga0075366_106010061 116
40 3300006353 Ga0075370_10044130 Ga0075370_100441302 116
41 3300006353 Ga0075370_10265127 Ga0075370_102651271 116
42 3300006846 Ga0075430_100424005 Ga0075430_1004240051 116
43 3300006852 Ga0075433_10018897 Ga0075433_100188973 116
44 3300006871 Ga0075434_100276838 Ga0075434_1002768384 116
45 3300007076 Ga0075435_100260341 Ga0075435_1002603412 116
46 3300007265 Ga0099794_10017447 Ga0099794_100174474 116
47 3300009094 Ga0111539_10267682 Ga0111539_102676824 116
48 3300009094 Ga0111539_12369345 Ga0111539_123693452 116
49 3300009094 Ga0111539_12629904 Ga0111539_126299041 116
50 3300009147 Ga0114129_10022055 Ga0114129_100220555 116
51 3300009147 Ga0114129_10571671 Ga0114129_105716712 116
52 3300021384 Ga0213876_10018593 Ga0213876_100185933 116
53 3300022732 Ga0224569_101497 Ga0224569_1014973 116
54 3300022734 Ga0224571_102883 Ga0224571_1028831 116
55 3300024227 Ga0228598_1002242 Ga0228598_10022425 116
56 3300025898 Ga0207692_10079938 Ga0207692_100799382 116
57 3300025905 Ga0207685_10007373 Ga0207685_100073734 116
58 3300025906 Ga0207699_10242906 Ga0207699_102429062 116
59 3300025908 Ga0207643_10690931 Ga0207643_106909312 116
60 3300025915 Ga0207693_10008428 Ga0207693_100084288 116
61 3300025916 Ga0207663_10210896 Ga0207663_102108962 116
62 3300025929 Ga0207664_11461855 Ga0207664_114618551 116
63 3300025933 Ga0207706_10395281 Ga0207706_103952812 116
64 3300025936 Ga0207670_10016708 Ga0207670_100167082 116
65 3300025939 Ga0207665_10000147 Ga0207665_1000014725 116
66 3300025944 Ga0207661_10000020 Ga0207661_10000020103 116
67 3300026088 Ga0207641_11528026 Ga0207641_115280262 116
68 3300027866 Ga0209813_10001113 Ga0209813_100011136 116
69 3300028381 Ga0268264_10084328 Ga0268264_100843283 116
70 3300030521 Ga0307511_10346622 Ga0307511_103466221 116
71 3300031238 Ga0265332_10007526 Ga0265332_100075265 116
72 3300031507 Ga0307509_10054516 Ga0307509_100545164 116
73 3300031616 Ga0307508_10103953 Ga0307508_101039531 116
74 3300031730 Ga0307516_10017963 Ga0307516_100179635 116
75 3300035114 Ga0373939_0366059 Ga0373939_0366059_101_472 116
76 3300035692 Ga0373935_1072902 Ga0373935_1072902_27_398 116
77 3300039437 Ga0436365_1276296 Ga0436365_1276296_3021_3380 116
78 3300042118 Ga0450914_001445 Ga0450914_001445_458_901 116
79 3300046472 Ga0495580_0091042 Ga0495580_0091042_1495_1872 116
80 3300046499 Ga0495594_0473180 Ga0495594_0473180_335_691 116
81 3300048909 Ga0496106_0862391 Ga0496106_0862391_16_378 116
82 3300048910 Ga0496107_0441064 Ga0496107_0441064_446_808 116
83 3300049744 Ga0501083_0423179 Ga0501083_0423179_349_711 116
84 3300050489 nmdc:mga03683_2495_c1 nmdc:mga03683_2495_c1_4348_4728 116
85 3300050490 nmdc:mga03n38_6537_c1 nmdc:mga03n38_6537_c1_1120_1500 116
86 3300050491 nmdc:mga00v17_53257_c1 nmdc:mga00v17_53257_c1_407_787 116
87 3300050493 nmdc:mga0k408_68787_c1 nmdc:mga0k408_68787_c1_805_1185 116
88 3300050494 nmdc:mga06z11_146055_c1 nmdc:mga06z11_146055_c1_882_1262 116
89 3300050495 nmdc:mga04h51_1388_c1 nmdc:mga04h51_1388_c1_1009_1389 116
90 3300050496 nmdc:mga07m45_217713_c1 nmdc:mga07m45_217713_c1_705_1085 116
91 3300050496 nmdc:mga07m45_30488_c1 nmdc:mga07m45_30488_c1_335_718 116
92 3300050507 nmdc:mga05p37_1813243_c1 nmdc:mga05p37_1813243_c1_172_534 116
93 3300050507 nmdc:mga05p37_38033_c1 nmdc:mga05p37_38033_c1_2081_2443 116
94 3300050507 nmdc:mga05p37_478347_c1 nmdc:mga05p37_478347_c1_109_468 116
95 3300050509 nmdc:mga0qj67_406879_c1 nmdc:mga0qj67_406879_c1_52_435 116
96 3300050509 nmdc:mga0qj67_411974_c1 nmdc:mga0qj67_411974_c1_23_385 116
97 3300050510 nmdc:mga06r32_807410_c1 nmdc:mga06r32_807410_c1_489_848 116
98 3300050511 nmdc:mga08y16_26496_c1 nmdc:mga08y16_26496_c1_694_1056 116
99 3300050512 nmdc:mga0n895_304044_c1 nmdc:mga0n895_304044_c1_101_463 116
100 3300050515 nmdc:mga0a205_99590_c1 nmdc:mga0a205_99590_c1_1255_1617 116
101 3300050516 nmdc:mga0sz30_12396_c1 nmdc:mga0sz30_12396_c1_2544_2924 116
102 3300053094 Ga0500566_0175689 Ga0500566_0175689_370_738 116
103 3300053102 Ga0500554_018880 Ga0500554_018880_428_796 116
104 3300053119 Ga0500595_146556 Ga0500595_146556_211_579 116
105 3300053120 Ga0500597_025188 Ga0500597_025188_1293_1661 116
106 3300053178 Ga0500637_0309904 Ga0500637_0309904_384_752 116
107 3300054114 Ga0501084_0469284 Ga0501084_0469284_223_591 116
108 3300060353 Ga0501082_0307725 Ga0501082_0307725_464_826 116
109 3300003187 JGI25151J46595_10000127 JGI25151J46595_1000012735 117
110 3300005336 Ga0070680_100109528 Ga0070680_1001095282 117
111 3300005340 Ga0070689_100291318 Ga0070689_1002913181 117
112 3300005340 Ga0070689_100344575 Ga0070689_1003445752 117
113 3300005343 Ga0070687_101375694 Ga0070687_1013756941 117
114 3300005354 Ga0070675_100100832 Ga0070675_1001008322 117
115 3300005365 Ga0070688_100003910 Ga0070688_1000039106 117
116 3300005365 Ga0070688_100359108 Ga0070688_1003591081 117
117 3300005441 Ga0070700_100351781 Ga0070700_1003517812 117
118 3300005458 Ga0070681_10084083 Ga0070681_100840834 117
119 3300005459 Ga0068867_100029622 Ga0068867_1000296224 117
120 3300005466 Ga0070685_10039724 Ga0070685_100397243 117
121 3300005466 Ga0070685_10071415 Ga0070685_100714152 117
122 3300005518 Ga0070699_100189622 Ga0070699_1001896222 117
123 3300005530 Ga0070679_100605192 Ga0070679_1006051923 117
124 3300005544 Ga0070686_100787180 Ga0070686_1007871801 117
125 3300005544 Ga0070686_100917194 Ga0070686_1009171941 117
126 3300005548 Ga0070665_100091337 Ga0070665_1000913375 117
127 3300005548 Ga0070665_102010573 Ga0070665_1020105732 117
128 3300005577 Ga0068857_102253767 Ga0068857_1022537671 117
129 3300005614 Ga0068856_101398370 Ga0068856_1013983701 117
130 3300005616 Ga0068852_100003088 Ga0068852_1000030885 117
131 3300005719 Ga0068861_101470925 Ga0068861_1014709251 117
132 3300005842 Ga0068858_101594395 Ga0068858_1015943952 117
133 3300005937 Ga0081455_10036912 Ga0081455_100369124 117
134 3300006846 Ga0075430_100000758 Ga0075430_10000075832 117
135 3300006880 Ga0075429_100000507 Ga0075429_10000050737 117
136 3300006881 Ga0068865_100663611 Ga0068865_1006636112 117
137 3300009094 Ga0111539_10145143 Ga0111539_101451432 117
138 3300009147 Ga0114129_10005352 Ga0114129_1000535215 117
139 3300009148 Ga0105243_10247929 Ga0105243_102479292 117
140 3300014326 Ga0157380_10241290 Ga0157380_102412902 117
141 3300014745 Ga0157377_10241577 Ga0157377_102415772 117
142 3300014745 Ga0157377_10403897 Ga0157377_104038972 117
143 3300025898 Ga0207692_10310017 Ga0207692_103100171 117
144 3300025911 Ga0207654_10403067 Ga0207654_104030671 117
145 3300025921 Ga0207652_10607755 Ga0207652_106077551 117
146 3300025926 Ga0207659_10940943 Ga0207659_109409432 117
147 3300025932 Ga0207690_10522714 Ga0207690_105227142 117
148 3300025935 Ga0207709_10252665 Ga0207709_102526652 117
149 3300025936 Ga0207670_10474466 Ga0207670_104744662 117
150 3300025942 Ga0207689_11226547 Ga0207689_112265472 117
151 3300026023 Ga0207677_10080457 Ga0207677_100804572 117
152 3300026023 Ga0207677_10398247 Ga0207677_103982472 117
153 3300026035 Ga0207703_11316509 Ga0207703_113165092 117
154 3300026075 Ga0207708_10148446 Ga0207708_101484462 117
155 3300026088 Ga0207641_10268633 Ga0207641_102686332 117
156 3300026142 Ga0207698_10006534 Ga0207698_100065345 117
157 3300031548 Ga0307408_100097166 Ga0307408_1000971662 117
158 3300031548 Ga0307408_100395684 Ga0307408_1003956842 117
159 3300031548 Ga0307408_101470279 Ga0307408_1014702791 117
160 3300031824 Ga0307413_10149244 Ga0307413_101492441 117
161 3300031911 Ga0307412_10890365 Ga0307412_108903651 117
162 3300031995 Ga0307409_100220246 Ga0307409_1002202462 117
163 3300032002 Ga0307416_100589171 Ga0307416_1005891712 117
164 3300032002 Ga0307416_100922557 Ga0307416_1009225572 117
165 3300032005 Ga0307411_10247469 Ga0307411_102474692 117
166 3300037068 Ga0373925_1000024 Ga0373925_1000024_245_619 117
167 3300042439 Ga0439464_0316869 Ga0439464_0316869_97_471 117
168 3300048917 Ga0496114_0750009 Ga0496114_0750009_123_497 117
169 3300049743 Ga0501081_0883584 Ga0501081_0883584_190_570 117
170 3300050507 nmdc:mga05p37_8149_c1 nmdc:mga05p37_8149_c1_3406_3780 117
171 3300050508 nmdc:mga09592_13939_c1 nmdc:mga09592_13939_c1_2307_2681 117
172 3300050509 nmdc:mga0qj67_1397939_c1 nmdc:mga0qj67_1397939_c1_17_391 117
173 3300050509 nmdc:mga0qj67_4184_c1 nmdc:mga0qj67_4184_c1_3407_3781 117
174 3300050510 nmdc:mga06r32_1879_c1 nmdc:mga06r32_1879_c1_8471_8845 117
175 3300050511 nmdc:mga08y16_85385_c1 nmdc:mga08y16_85385_c1_934_1308 117
176 3300060353 Ga0501082_0371964 Ga0501082_0371964_103_468 117

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01022

HTH_5

Bacterial regulatory protein, arsR family

43

89

0.98

PF12840

HTH_20

Helix-turn-helix domain

41

89

0.98

PF13412

HTH_24

Winged helix-turn-helix DNA-binding

43

88

0.98

PF01047

MarR

MarR family

44

96

0.89

PF12802

MarR_2

MarR family

43

96

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
7p6f-assembly1.cif.gz_BBB 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus 0.9443 5 88
7p6f-assembly2.cif.gz_CCC-2 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus 0.9371 1 90
4kmf-assembly1.cif.gz_A-2 crystal structure of zalpha domain from carassius auratus pkz in complex with z-dna 0.9342 18 74
3f6o-assembly1.cif.gz_B crystal structure of arsr family transcriptional regulator, rha00566 0.9237 6 93
3lmm-assembly4.cif.gz_D crystal structure of the dip2311 protein from corynebacterium diphtheriae, northeast structural genomics consortium target cdr35 0.9218 18 74
ID Description Score Start End Superfamily
3tgnA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9507 16 61 1.10.10.10
2vxzA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9507 18 73 1.10.10.10
af_P0ACK8_1_59_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9386 18 74 1.10.10.10
4kmfA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9342 18 74 1.10.10.10
af_Q5NE14_88_145_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9267 18 73 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2W5VFY7-F1-model_v4 HTH arsR-type domain-containing protein 0.9786 4 86 GO:0003700
AF-A0A7W0YP81-F1-model_v4 Winged helix-turn-helix transcriptional regulator 0.9716 4 90 GO:0003700
AF-A0A1H7BVU5-F1-model_v4 DNA-binding transcriptional regulator, ArsR family 0.9701 4 90 GO:0003677
GO:0003700
AF-A0A2M8HG34-F1-model_v4 Transcriptional regulator 0.9698 2 90 GO:0003700
AF-A0A536R0Y3-F1-model_v4 Winged helix-turn-helix transcriptional regulator 0.9679 5 85 GO:0003700

Feature Viewer

pLDDT pTM Quality
88.46 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map