F268615

General Info

Members Datasets Scaffolds Average Seq Length
176 109 176 171

Family's Representative Sequence

Representative Sequence 3300035111|Ga0373923_0008058|Ga0373923_0008058_1626_2210
Length 194
Sequence MPSSNLPAPVTLNAASREASMKCSVAVVCVILFSLSSFAANAENAPSKTTTEYAQHFGALSGLSVAVAQAMPADQYSFRPHPESMTFGELMLHIASTNYAFCAGLKDSDAPATPSPAATDKDAVVKLLSGSFEYCSSIIPNLTEQQLSQYHNSPDGRLVGREVLLAMYVHVAHHRGQAEIYLRDKGIRPPSYRI

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
3 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
4 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
11 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
23 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
24 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
25 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
26 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
28 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
29 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
31 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
34 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
37 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
38 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
39 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
40 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
41 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
42 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
45 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
68 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
69 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
70 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
71 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
72 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
73 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
74 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
75 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
76 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
77 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
78 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
79 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
80 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
81 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
82 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
83 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
84 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
85 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
86 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
87 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
88 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
89 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
90 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
91 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
92 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
93 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
94 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
95 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
96 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
97 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
98 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
99 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
100 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
101 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
102 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
103 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
104 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
105 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
106 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
107 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
108 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
109 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 99.43
Stem 0
Stem Tuber 0
Unclassified 0.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100054750 3300005329 Bacteria 3700
2 Ga0068868_100059119 3300005338 Unclassified 3032
3 Ga0070673_100262465 3300005364 Bacteria 1509
4 Ga0070709_10042455 3300005434 Bacteria 2809
5 Ga0070709_10053206 3300005434 Bacteria 2548
6 Ga0070709_10122941 3300005434 Bacteria 1762
7 Ga0070709_10375417 3300005434 Bacteria 1056
8 Ga0070714_100000211 3300005435 Bacteria 46913
9 Ga0070714_100012798 3300005435 Bacteria 6704
10 Ga0070714_100014046 3300005435 Bacteria 6425
11 Ga0070714_100049610 3300005435 Unclassified 3573
12 Ga0070714_100137085 3300005435 Bacteria 2193
13 Ga0070714_100208670 3300005435 Bacteria 1790
14 Ga0070714_100467373 3300005435 Unclassified 1200
15 Ga0070714_100554477 3300005435 Bacteria 1100
16 Ga0070714_100694083 3300005435 Bacteria 982
17 Ga0070713_100060696 3300005436 Unclassified 3161
18 Ga0070713_100555967 3300005436 Bacteria 1087
19 Ga0070713_100687457 3300005436 Unclassified 976
20 Ga0070713_100700862 3300005436 Unclassified 967
21 Ga0070713_100732674 3300005436 Unclassified 945
22 Ga0070710_10229021 3300005437 Unclassified 1186
23 Ga0070711_100058138 3300005439 Unclassified 2680
24 Ga0070711_100072697 3300005439 Bacteria 2427
25 Ga0070711_100107488 3300005439 Bacteria 2042
26 Ga0070681_10000275 3300005458 Bacteria 41301
27 Ga0070707_100695375 3300005468 Bacteria 980
28 Ga0070698_100040122 3300005471 Bacteria 4814
29 Ga0070698_100301384 3300005471 Bacteria 1533
30 Ga0070679_100006494 3300005530 Bacteria 10902
31 Ga0070684_100087830 3300005535 Unclassified 2761
32 Ga0068853_100114212 3300005539 Unclassified 2402
33 Ga0070693_100043873 3300005547 Unclassified 2527
34 Ga0068855_100000874 3300005563 Bacteria 37439
35 Ga0068857_100032632 3300005577 Unclassified 4604
36 Ga0068854_100048529 3300005578 Unclassified 3030
37 Ga0068854_100768303 3300005578 Unclassified 837
38 Ga0068856_100003564 3300005614 Bacteria 15669
39 Ga0068852_100023995 3300005616 Bacteria 4921
40 Ga0068859_100998743 3300005617 Unclassified 919
41 Ga0068858_100134268 3300005842 Unclassified 2321
42 Ga0070717_10095392 3300006028 Bacteria 2518
43 Ga0070717_10181507 3300006028 Bacteria 1835
44 Ga0070717_10184989 3300006028 Unclassified 1817
45 Ga0070717_11218984 3300006028 Bacteria 685
46 Ga0070716_100156824 3300006173 Bacteria 1471
47 Ga0070716_100688969 3300006173 Bacteria 779
48 Ga0070712_100001954 3300006175 Bacteria 12624
49 Ga0097621_100001001 3300006237 Bacteria 19864
50 Ga0068871_100000797 3300006358 Bacteria 21201
51 Ga0075436_100001210 3300006914 Bacteria 17530
52 Ga0097620_100998701 3300006931 Unclassified 919
53 Ga0075435_100111122 3300007076 Bacteria 2280
54 Ga0075435_100171717 3300007076 Unclassified 1829
55 Ga0099795_10060738 3300007788 Bacteria 1402
56 Ga0105240_10011687 3300009093 Bacteria 12201
57 Ga0105240_10082607 3300009093 Bacteria 3945
58 Ga0105241_10073007 3300009174 Unclassified 2668
59 Ga0105242_12337877 3300009176 Unclassified 581
60 Ga0105248_10124759 3300009177 Bacteria 2905
61 Ga0105237_10122818 3300009545 Bacteria 2591
62 Ga0105238_10001002 3300009551 Bacteria 28831
63 Ga0105238_10042708 3300009551 Bacteria 4590
64 Ga0099796_10112863 3300010159 Bacteria 1036
65 Ga0157373_10590183 3300013100 Unclassified 808
66 Ga0157370_10268007 3300013104 Unclassified 1578
67 Ga0157369_10000924 3300013105 Bacteria 37397
68 Ga0157369_10010176 3300013105 Bacteria 10733
69 Ga0157374_10001244 3300013296 Bacteria 21739
70 Ga0157372_10000907 3300013307 Bacteria 32188
71 Ga0157372_10272306 3300013307 Bacteria 1968
72 Ga0213872_10002067 3300021361 Bacteria 12151
73 Ga0207699_10173700 3300025906 Bacteria 1444
74 Ga0207684_10104267 3300025910 Bacteria 2425
75 Ga0207684_10310689 3300025910 Bacteria 1359
76 Ga0207654_10083450 3300025911 Unclassified 1929
77 Ga0207707_10000434 3300025912 Bacteria 43467
78 Ga0207695_10057691 3300025913 Bacteria 4033
79 Ga0207695_10178514 3300025913 Unclassified 2045
80 Ga0207671_10261607 3300025914 Unclassified 1362
81 Ga0207693_10007222 3300025915 Bacteria 9143
82 Ga0207693_10284247 3300025915 Bacteria 1296
83 Ga0207663_10188262 3300025916 Unclassified 1480
84 Ga0207652_10045516 3300025921 Bacteria 3742
85 Ga0207694_10001280 3300025924 Bacteria 21682
86 Ga0207700_10014856 3300025928 Bacteria 5114
87 Ga0207700_10019345 3300025928 Bacteria 4597
88 Ga0207700_10206312 3300025928 Unclassified 1659
89 Ga0207700_10639687 3300025928 Unclassified 948
90 Ga0207664_10000097 3300025929 Bacteria 80906
91 Ga0207664_10066284 3300025929 Unclassified 2894
92 Ga0207664_10074127 3300025929 Bacteria 2748
93 Ga0207664_10162468 3300025929 Bacteria 1906
94 Ga0207664_10554168 3300025929 Bacteria 1031
95 Ga0207665_10025392 3300025939 Unclassified 3909
96 Ga0207665_10464498 3300025939 Bacteria 973
97 Ga0207665_10942365 3300025939 Bacteria 686
98 Ga0207661_10291615 3300025944 Bacteria 1460
99 Ga0207667_10000813 3300025949 Bacteria 40503
100 Ga0207667_10244388 3300025949 Unclassified 1836
101 Ga0207640_10101883 3300025981 Unclassified 2016
102 Ga0207677_10539696 3300026023 Unclassified 1015
103 Ga0207703_10137046 3300026035 Unclassified 2120
104 Ga0207702_10000207 3300026078 Bacteria 69989
105 Ga0207702_10204403 3300026078 Unclassified 1833
106 Ga0207676_10868495 3300026095 Unclassified 883
107 Ga0207674_10057691 3300026116 Unclassified 3936
108 Ga0207698_10043788 3300026142 Unclassified 3357
109 Ga0265325_10136557 3300031241 Bacteria 1169
110 Ga0265316_10258583 3300031344 Bacteria 1277
111 Ga0265313_10004839 3300031595 Bacteria 10124
112 Ga0265314_10093268 3300031711 Bacteria 1955
113 Ga0265342_10143422 3300031712 Bacteria 1331
114 Ga0373926_0174649 3300035083 Bacteria 823
115 Ga0373934_0101898 3300035086 Bacteria 1161
116 Ga0373934_0207772 3300035086 Bacteria 807
117 Ga0373923_0008058 3300035111 Bacteria 3737
118 Ga0373936_0002872 3300035113 Bacteria 6434
119 Ga0373945_0002677 3300035116 Bacteria 5587
120 Ga0373954_0414894 3300035118 Unclassified 666
121 Ga0373956_0080343 3300035119 Bacteria 1496
122 Ga0373957_0093970 3300035120 Bacteria 1194
123 Ga0373943_0000993 3300035170 Bacteria 12593
124 Ga0373955_0157556 3300035172 Bacteria 1338
125 Ga0373935_0012439 3300035692 Bacteria 5119
126 Ga0373935_0976553 3300035692 Bacteria 629
127 Ga0373927_0000041 3300035695 Bacteria 94763
128 Ga0373927_0000087 3300035695 Bacteria 69531
129 Ga0373927_0016437 3300035695 Bacteria 4880
130 Ga0373927_0145551 3300035695 Bacteria 1551
131 Ga0373933_0162312 3300035724 Unclassified 1419
132 Ga0373933_0295257 3300035724 Unclassified 1048
133 Ga0373937_0023236 3300036401 Bacteria 5582
134 Ga0373937_0026797 3300036401 Bacteria 5210
135 Ga0373937_0079606 3300036401 Bacteria 3028
136 Ga0373925_0001552 3300037068 Bacteria 19542
137 Ga0373925_0017421 3300037068 Bacteria 5207
138 Ga0373925_0031147 3300037068 Unclassified 3918
139 Ga0436361_0773703 3300039447 Bacteria 14469
140 Ga0436361_1098987 3300039447 Bacteria 3310
141 Ga0451839_0335114 3300041496 Unclassified 648
142 Ga0466969_0160453 3300044656 Bacteria 1033
143 Ga0453683_0673914 3300044673 Bacteria 677
144 Ga0466964_0310277 3300044706 Unclassified 798
145 Ga0466971_0654157 3300044719 Unclassified 526
146 Ga0466957_0341953 3300044842 Unclassified 1014
147 Ga0466957_0732737 3300044842 Bacteria 699
148 Ga0451576_1350035 3300045051 Bacteria 743
149 Ga0451576_2105726 3300045051 Unclassified 580
150 Ga0466958_0124016 3300045836 Unclassified 1619
151 Ga0495592_0169736 3300046454 Unclassified 1495
152 Ga0495653_0096777 3300046463 Unclassified 2146
153 Ga0495580_0000628 3300046472 Bacteria 29902
154 Ga0495580_0001121 3300046472 Bacteria 23574
155 Ga0495580_0002901 3300046472 Bacteria 14734
156 Ga0495580_0022877 3300046472 Bacteria 4594
157 Ga0495580_0064707 3300046472 Bacteria 2563
158 Ga0495580_0442148 3300046472 Unclassified 873
159 Ga0495664_0050498 3300046477 Bacteria 2470
160 Ga0495608_0113609 3300046511 Bacteria 1740
161 Ga0495630_0033898 3300046517 Bacteria 3809
162 Ga0495630_0045410 3300046517 Bacteria 3283
163 Ga0495630_0105911 3300046517 Unclassified 2129
164 Ga0495586_0860435 3300046535 Unclassified 523
165 Ga0495657_0436085 3300046675 Bacteria 768
166 Ga0495657_0666715 3300046675 Unclassified 599
167 Ga0495674_0033258 3300047319 Bacteria 4672
168 Ga0495676_0083756 3300047321 Unclassified 2409
169 Ga0495676_0815285 3300047321 Bacteria 600
170 Ga0495602_0068097 3300048088 Bacteria 3059
171 Ga0495602_0611705 3300048088 Unclassified 748
172 Ga0495602_0668085 3300048088 Unclassified 708
173 Ga0501067_0107464 3300049583 Bacteria 1551
174 nmdc:mga0rr50_324522_c1 3300050513 Unclassified 1291
175 nmdc:mga0rr50_658689_c1 3300050513 Unclassified 893
176 nmdc:mga08x19_682_c1 3300050514 Bacteria 21769

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005437 Ga0070710_10229021 Ga0070710_102290212 144
2 3300006028 Ga0070717_10181507 Ga0070717_101815072 144
3 3300025916 Ga0207663_10188262 Ga0207663_101882622 144
4 3300005435 Ga0070714_100014046 Ga0070714_1000140468 154
5 3300005436 Ga0070713_100555967 Ga0070713_1005559672 154
6 3300009093 Ga0105240_10011687 Ga0105240_100116877 154
7 3300009174 Ga0105241_10073007 Ga0105241_100730072 154
8 3300009176 Ga0105242_12337877 Ga0105242_123378771 154
9 3300009177 Ga0105248_10124759 Ga0105248_101247591 154
10 3300009551 Ga0105238_10001002 Ga0105238_1000100221 154
11 3300013105 Ga0157369_10000924 Ga0157369_1000092416 154
12 3300013296 Ga0157374_10001244 Ga0157374_1000124421 154
13 3300013307 Ga0157372_10000907 Ga0157372_1000090720 154
14 3300045051 Ga0451576_2105726 Ga0451576_2105726_81_545 154
15 3300048088 Ga0495602_0611705 Ga0495602_0611705_30_545 154
16 3300035086 Ga0373934_0101898 Ga0373934_0101898_150_734 156
17 3300035119 Ga0373956_0080343 Ga0373956_0080343_187_771 156
18 3300035120 Ga0373957_0093970 Ga0373957_0093970_357_941 156
19 3300036401 Ga0373937_0079606 Ga0373937_0079606_2192_2776 156
20 3300046454 Ga0495592_0169736 Ga0495592_0169736_27_611 156
21 3300046511 Ga0495608_0113609 Ga0495608_0113609_31_615 156
22 3300044673 Ga0453683_0673914 Ga0453683_0673914_132_614 160
23 3300045051 Ga0451576_1350035 Ga0451576_1350035_190_672 160
24 3300048088 Ga0495602_0668085 Ga0495602_0668085_15_497 160
25 3300050513 nmdc:mga0rr50_658689_c1 nmdc:mga0rr50_658689_c1_245_727 160
26 3300005435 Ga0070714_100000211 Ga0070714_10000021110 161
27 3300025929 Ga0207664_10000097 Ga0207664_1000009742 161
28 3300035724 Ga0373933_0295257 Ga0373933_0295257_21_545 161
29 3300046535 Ga0495586_0860435 Ga0495586_0860435_20_505 161
30 3300035695 Ga0373927_0000087 Ga0373927_0000087_56106_56603 162
31 3300037068 Ga0373925_0001552 Ga0373925_0001552_12907_13404 162
32 3300046517 Ga0495630_0105911 Ga0495630_0105911_1318_1815 162
33 3300047321 Ga0495676_0815285 Ga0495676_0815285_33_530 162
34 3300005439 Ga0070711_100072697 Ga0070711_1000726973 163
35 3300044656 Ga0466969_0160453 Ga0466969_0160453_450_941 163
36 3300044706 Ga0466964_0310277 Ga0466964_0310277_284_787 163
37 3300044719 Ga0466971_0654157 Ga0466971_0654157_18_509 163
38 3300046463 Ga0495653_0096777 Ga0495653_0096777_1637_2134 163
39 3300047321 Ga0495676_0083756 Ga0495676_0083756_1897_2394 163
40 3300005434 Ga0070709_10122941 Ga0070709_101229412 165
41 3300005435 Ga0070714_100208670 Ga0070714_1002086702 165
42 3300005435 Ga0070714_100467373 Ga0070714_1004673731 165
43 3300035692 Ga0373935_0976553 Ga0373935_0976553_62_565 165
44 3300035695 Ga0373927_0145551 Ga0373927_0145551_877_1398 165
45 3300046472 Ga0495580_0000628 Ga0495580_0000628_26641_27162 165
46 3300046675 Ga0495657_0436085 Ga0495657_0436085_152_655 165
47 3300005436 Ga0070713_100060696 Ga0070713_1000606963 166
48 3300005439 Ga0070711_100058138 Ga0070711_1000581384 166
49 3300006173 Ga0070716_100156824 Ga0070716_1001568243 166
50 3300006175 Ga0070712_100001954 Ga0070712_1000019545 166
51 3300007076 Ga0075435_100171717 Ga0075435_1001717173 166
52 3300025915 Ga0207693_10007222 Ga0207693_100072225 166
53 3300025928 Ga0207700_10019345 Ga0207700_100193455 166
54 3300025939 Ga0207665_10025392 Ga0207665_100253921 166
55 3300046472 Ga0495580_0001121 Ga0495580_0001121_22015_22518 166
56 3300046472 Ga0495580_0022877 Ga0495580_0022877_2303_2815 166
57 3300050513 nmdc:mga0rr50_324522_c1 nmdc:mga0rr50_324522_c1_251_760 166
58 3300005468 Ga0070707_100695375 Ga0070707_1006953751 167
59 3300006028 Ga0070717_11218984 Ga0070717_112189841 167
60 3300035083 Ga0373926_0174649 Ga0373926_0174649_82_603 167
61 3300035086 Ga0373934_0207772 Ga0373934_0207772_76_579 167
62 3300035695 Ga0373927_0016437 Ga0373927_0016437_3361_3870 167
63 3300037068 Ga0373925_0031147 Ga0373925_0031147_259_780 167
64 3300044842 Ga0466957_0341953 Ga0466957_0341953_31_537 167
65 3300045836 Ga0466958_0124016 Ga0466958_0124016_982_1488 167
66 3300046517 Ga0495630_0033898 Ga0495630_0033898_1371_1880 167
67 3300049583 Ga0501067_0107464 Ga0501067_0107464_105_611 168
68 3300005434 Ga0070709_10053206 Ga0070709_100532062 169
69 3300005435 Ga0070714_100012798 Ga0070714_1000127982 169
70 3300005471 Ga0070698_100040122 Ga0070698_1000401224 169
71 3300005578 Ga0068854_100768303 Ga0068854_1007683031 169
72 3300009093 Ga0105240_10082607 Ga0105240_100826074 169
73 3300009545 Ga0105237_10122818 Ga0105237_101228183 169
74 3300009551 Ga0105238_10042708 Ga0105238_100427085 169
75 3300013100 Ga0157373_10590183 Ga0157373_105901831 169
76 3300013104 Ga0157370_10268007 Ga0157370_102680072 169
77 3300013105 Ga0157369_10010176 Ga0157369_100101762 169
78 3300013307 Ga0157372_10272306 Ga0157372_102723062 169
79 3300025913 Ga0207695_10057691 Ga0207695_100576913 169
80 3300025914 Ga0207671_10261607 Ga0207671_102616072 169
81 3300025928 Ga0207700_10014856 Ga0207700_100148563 169
82 3300025928 Ga0207700_10206312 Ga0207700_102063123 169
83 3300025929 Ga0207664_10554168 Ga0207664_105541682 169
84 3300025949 Ga0207667_10244388 Ga0207667_102443882 169
85 3300026078 Ga0207702_10204403 Ga0207702_102044032 169
86 3300005434 Ga0070709_10375417 Ga0070709_103754172 170
87 3300005435 Ga0070714_100049610 Ga0070714_1000496103 170
88 3300005435 Ga0070714_100137085 Ga0070714_1001370852 170
89 3300005436 Ga0070713_100700862 Ga0070713_1007008622 170
90 3300005436 Ga0070713_100732674 Ga0070713_1007326742 170
91 3300007788 Ga0099795_10060738 Ga0099795_100607381 170
92 3300025929 Ga0207664_10066284 Ga0207664_100662842 170
93 3300025929 Ga0207664_10074127 Ga0207664_100741272 170
94 3300025929 Ga0207664_10162468 Ga0207664_101624683 170
95 3300035118 Ga0373954_0414894 Ga0373954_0414894_34_546 170
96 3300035724 Ga0373933_0162312 Ga0373933_0162312_84_596 170
97 3300036401 Ga0373937_0026797 Ga0373937_0026797_3877_4389 170
98 3300046675 Ga0495657_0666715 Ga0495657_0666715_67_579 170
99 3300005471 Ga0070698_100301384 Ga0070698_1003013842 171
100 3300006028 Ga0070717_10095392 Ga0070717_100953924 171
101 3300021361 Ga0213872_10002067 Ga0213872_100020679 171
102 3300025910 Ga0207684_10104267 Ga0207684_101042672 171
103 3300039447 Ga0436361_0773703 Ga0436361_0773703_8604_9122 171
104 3300005329 Ga0070683_100054750 Ga0070683_1000547504 172
105 3300005338 Ga0068868_100059119 Ga0068868_1000591194 172
106 3300005364 Ga0070673_100262465 Ga0070673_1002624652 172
107 3300005434 Ga0070709_10042455 Ga0070709_100424552 172
108 3300005435 Ga0070714_100554477 Ga0070714_1005544771 172
109 3300005435 Ga0070714_100694083 Ga0070714_1006940831 172
110 3300005436 Ga0070713_100687457 Ga0070713_1006874571 172
111 3300005439 Ga0070711_100107488 Ga0070711_1001074882 172
112 3300005458 Ga0070681_10000275 Ga0070681_1000027533 172
113 3300005530 Ga0070679_100006494 Ga0070679_1000064947 172
114 3300005535 Ga0070684_100087830 Ga0070684_1000878304 172
115 3300005539 Ga0068853_100114212 Ga0068853_1001142123 172
116 3300005547 Ga0070693_100043873 Ga0070693_1000438734 172
117 3300005563 Ga0068855_100000874 Ga0068855_10000087422 172
118 3300005577 Ga0068857_100032632 Ga0068857_1000326324 172
119 3300005578 Ga0068854_100048529 Ga0068854_1000485294 172
120 3300005614 Ga0068856_100003564 Ga0068856_10000356417 172
121 3300005616 Ga0068852_100023995 Ga0068852_1000239954 172
122 3300005617 Ga0068859_100998743 Ga0068859_1009987431 172
123 3300005842 Ga0068858_100134268 Ga0068858_1001342683 172
124 3300006028 Ga0070717_10184989 Ga0070717_101849892 172
125 3300006173 Ga0070716_100688969 Ga0070716_1006889691 172
126 3300006237 Ga0097621_100001001 Ga0097621_1000010014 172
127 3300006358 Ga0068871_100000797 Ga0068871_1000007972 172
128 3300006914 Ga0075436_100001210 Ga0075436_1000012104 172
129 3300006931 Ga0097620_100998701 Ga0097620_1009987011 172
130 3300007076 Ga0075435_100111122 Ga0075435_1001111222 172
131 3300010159 Ga0099796_10112863 Ga0099796_101128631 172
132 3300025906 Ga0207699_10173700 Ga0207699_101737002 172
133 3300025910 Ga0207684_10310689 Ga0207684_103106892 172
134 3300025911 Ga0207654_10083450 Ga0207654_100834502 172
135 3300025912 Ga0207707_10000434 Ga0207707_1000043412 172
136 3300025913 Ga0207695_10178514 Ga0207695_101785142 172
137 3300025915 Ga0207693_10284247 Ga0207693_102842472 172
138 3300025921 Ga0207652_10045516 Ga0207652_100455162 172
139 3300025924 Ga0207694_10001280 Ga0207694_100012803 172
140 3300025928 Ga0207700_10639687 Ga0207700_106396872 172
141 3300025939 Ga0207665_10464498 Ga0207665_104644981 172
142 3300025939 Ga0207665_10942365 Ga0207665_109423651 172
143 3300025944 Ga0207661_10291615 Ga0207661_102916152 172
144 3300025949 Ga0207667_10000813 Ga0207667_1000081320 172
145 3300025981 Ga0207640_10101883 Ga0207640_101018832 172
146 3300026023 Ga0207677_10539696 Ga0207677_105396962 172
147 3300026035 Ga0207703_10137046 Ga0207703_101370463 172
148 3300026078 Ga0207702_10000207 Ga0207702_1000020755 172
149 3300026095 Ga0207676_10868495 Ga0207676_108684952 172
150 3300026116 Ga0207674_10057691 Ga0207674_100576913 172
151 3300026142 Ga0207698_10043788 Ga0207698_100437882 172
152 3300031241 Ga0265325_10136557 Ga0265325_101365572 172
153 3300031344 Ga0265316_10258583 Ga0265316_102585832 172
154 3300031595 Ga0265313_10004839 Ga0265313_100048392 172
155 3300031711 Ga0265314_10093268 Ga0265314_100932681 172
156 3300031712 Ga0265342_10143422 Ga0265342_101434222 172
157 3300035111 Ga0373923_0008058 Ga0373923_0008058_1626_2210 172
158 3300035113 Ga0373936_0002872 Ga0373936_0002872_1156_1740 172
159 3300035116 Ga0373945_0002677 Ga0373945_0002677_2250_2834 172
160 3300035170 Ga0373943_0000993 Ga0373943_0000993_9924_10508 172
161 3300035172 Ga0373955_0157556 Ga0373955_0157556_150_734 172
162 3300035692 Ga0373935_0012439 Ga0373935_0012439_1788_2372 172
163 3300035695 Ga0373927_0000041 Ga0373927_0000041_51032_51616 172
164 3300036401 Ga0373937_0023236 Ga0373937_0023236_2265_2783 172
165 3300037068 Ga0373925_0017421 Ga0373925_0017421_916_1500 172
166 3300039447 Ga0436361_1098987 Ga0436361_1098987_2463_2987 172
167 3300041496 Ga0451839_0335114 Ga0451839_0335114_15_533 172
168 3300044842 Ga0466957_0732737 Ga0466957_0732737_43_612 172
169 3300046472 Ga0495580_0002901 Ga0495580_0002901_904_1422 172
170 3300046472 Ga0495580_0064707 Ga0495580_0064707_1174_1692 172
171 3300046472 Ga0495580_0442148 Ga0495580_0442148_175_693 172
172 3300046477 Ga0495664_0050498 Ga0495664_0050498_1254_1838 172
173 3300046517 Ga0495630_0045410 Ga0495630_0045410_2655_3239 172
174 3300047319 Ga0495674_0033258 Ga0495674_0033258_2445_3029 172
175 3300048088 Ga0495602_0068097 Ga0495602_0068097_237_761 172
176 3300050514 nmdc:mga08x19_682_c1 nmdc:mga08x19_682_c1_11891_12409 172

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12867

DinB_2

DinB superfamily

57

178

0.95

PF05163

DinB

DinB family

46

193

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3gor-assembly2.cif.gz_D crystal structure of putative metal-dependent hydrolase apc36150 0.8714 28 170
3dka-assembly1.cif.gz_A crystal structure of a dinb-like protein (yjoa, bsu12410) from bacillus subtilis at 2.30 a resolution 0.8577 32 170
3dka-assembly1.cif.gz_B crystal structure of a dinb-like protein (yjoa, bsu12410) from bacillus subtilis at 2.30 a resolution 0.8525 32 170
3di5-assembly1.cif.gz_A crystal structure of a dinb-like protein (bce_4655) from bacillus cereus atcc 10987 at 2.01 a resolution 0.8525 33 171
6iz2-assembly1.cif.gz_A crystal structure of dinb/yfit protein dr0053 from d. radiodurans r1 0.8452 29 171
ID Description Score Start End Superfamily
3dkaA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8417 32 163 1.20.120.450
af_P71985_5_134_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8327 40 159 1.20.120.450
3dkaA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8238 32 163 1.20.120.450
3di5A00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8153 32 171 1.20.120.450
2yqyB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8147 32 157 1.20.120.450
ID Description Score Start End GO Terms
AF-A0A2V9AJS9-F1-model_v4 DinB-like domain-containing protein 0.9962 26 172
AF-A0A2V9A8I5-F1-model_v4 DinB-like domain-containing protein 0.9882 65 172
AF-A0A2V9QGU0-F1-model_v4 DinB-like domain-containing protein 0.9857 25 172
AF-A0A2V8Y6R3-F1-model_v4 DinB-like domain-containing protein 0.9796 18 172
AF-A0A2V9A8I5-F1-model_v4 DinB-like domain-containing protein 0.9792 65 172

Feature Viewer

pLDDT pTM Quality
88.11 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map