F268544

General Info

Members Datasets Scaffolds Average Seq Length
176 145 150 235

Family's Representative Sequence

Representative Sequence 3300031548|Ga0307408_100139180|Ga0307408_1001391802
Length 282
Sequence MPSLIGAVVLVTGANGGIGAHFVHDALARGASKVYATARTPRTWEDERIVPLTLDVTDPASIQAAVDAAGDVTVLINNAGASVASAGILTHTDAEIRTNVETNFLGPLFLARAFAPILSAKDEAVIIDIHSAMSWYATGGIYSATKAALWSATNSLRLELAPEGVHVVGVHVGYVDTAMAANATDPKMDPADLVRTVMDAVEAGEYEVLADETSVQLKAGLSAPIEALYPQLAHNKAQENDSAVVRTQVHDHGTASRIQTHGRTETESTTTYALRTRPGTLA

Samples

Sample ID Description Type Environment
1 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
2 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
3 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
4 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
5 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
6 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
7 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
8 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
9 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
10 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
11 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
12 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
13 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
14 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
15 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
16 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
17 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
18 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
19 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
20 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
21 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
22 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
23 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
24 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
25 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
36 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
37 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
38 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
39 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
48 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
71 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
72 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
73 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
74 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
75 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
76 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
77 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
78 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
79 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
80 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
81 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
82 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
83 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
84 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
85 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
86 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
87 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
88 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
89 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
90 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
91 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
92 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
93 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
94 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
95 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
96 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
97 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
98 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
99 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
100 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
101 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
102 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
103 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
104 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
105 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
106 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
107 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
108 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
109 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
110 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
111 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
112 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
113 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
114 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
115 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
116 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
117 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
118 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
119 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
120 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
121 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
122 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
123 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
124 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
125 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
126 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
127 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
128 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
129 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
130 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
131 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
136 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
138 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
139 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
140 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
141 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
142 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere
143 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere
144 8056054917 Glycomyces luteolus NEAU-A15 Isolate Rhizosphere
145 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.23
Metatranscriptomes 0
Isolates 14.77

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.52
Nodule 0
Rhizoplane 11.93
Rhizosphere 61.36
Stem 0
Stem Tuber 0
Unclassified 18.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055539_1000006 3300003752 Bacteria 580055
2 Ga0055533_1000002 3300003756 Bacteria 1196393
3 Ga0055525_1000022 3300003759 Bacteria 368755
4 Ga0070670_100007027 3300005331 Bacteria 9538
5 Ga0070666_10050819 3300005335 Bacteria 2789
6 Ga0070673_100259016 3300005364 Bacteria 1519
7 Ga0070714_100130974 3300005435 Bacteria 2241
8 Ga0070684_100775890 3300005535 Bacteria 895
9 Ga0070672_100007473 3300005543 Bacteria 7417
10 Ga0070664_100286973 3300005564 Bacteria 1485
11 Ga0068863_100785488 3300005841 Bacteria 949
12 Ga0070717_10230091 3300006028 Bacteria 1632
13 Ga0075364_10014205 3300006051 Bacteria 4915
14 Ga0075432_10003666 3300006058 Bacteria 5232
15 Ga0075369_10086208 3300006186 Bacteria 1398
16 Ga0105251_10018187 3300009011 Bacteria 3744
17 Ga0105244_10000643 3300009036 Bacteria 30795
18 Ga0105244_10002224 3300009036 Bacteria 14780
19 Ga0105243_10008822 3300009148 Bacteria 7721
20 Ga0105248_10000713 3300009177 Bacteria 37644
21 Ga0105246_10001935 3300011119 Bacteria 12501
22 Ga0105246_10060399 3300011119 Bacteria 2634
23 Ga0157369_10090765 3300013105 Bacteria 3262
24 Ga0157369_10287094 3300013105 Bacteria 1713
25 Ga0157374_10022154 3300013296 Bacteria 5665
26 Ga0163162_10037693 3300013306 Bacteria 4825
27 Ga0163162_10078455 3300013306 Bacteria 3368
28 Ga0157375_10089600 3300013308 Bacteria 3133
29 Ga0213876_10099065 3300021384 Bacteria 1545
30 Ga0209566_100013 3300025225 Bacteria 474033
31 Ga0209674_100001 3300025226 Bacteria 4013750
32 Ga0209563_100001 3300025230 Bacteria 4013775
33 Ga0209677_100001 3300025253 Bacteria 4013787
34 Ga0209051_1018889 3300025303 Bacteria 3032
35 Ga0207697_10020354 3300025315 Bacteria 2717
36 Ga0207655_1003632 3300025728 Bacteria 11395
37 Ga0207713_1027827 3300025735 Bacteria 2560
38 Ga0207682_10009946 3300025893 Bacteria 3736
39 Ga0207680_10028155 3300025903 Bacteria 3140
40 Ga0207645_10028221 3300025907 Bacteria 3624
41 Ga0207671_10005300 3300025914 Bacteria 11946
42 Ga0207681_10013172 3300025923 Bacteria 5113
43 Ga0207650_10013469 3300025925 Bacteria 5663
44 Ga0207659_10031540 3300025926 Bacteria 3629
45 Ga0207669_10066391 3300025937 Bacteria 2243
46 Ga0207691_10003282 3300025940 Bacteria 15757
47 Ga0207711_10000340 3300025941 Bacteria 49514
48 Ga0207711_10242573 3300025941 Bacteria 1652
49 Ga0207651_10028561 3300025960 Bacteria 3521
50 Ga0207658_10422195 3300025986 Bacteria 1176
51 Ga0207641_10382942 3300026088 Bacteria 1347
52 Ga0207683_10058518 3300026121 Bacteria 3384
53 Ga0307511_10228261 3300030521 Bacteria 925
54 Ga0307408_100139180 3300031548 Bacteria 1903
55 Ga0307516_10006936 3300031730 Bacteria 13147
56 Ga0307413_10278928 3300031824 Bacteria 1256
57 Ga0307410_10099112 3300031852 Bacteria 2085
58 Ga0307406_10001096 3300031901 Bacteria 15088
59 Ga0307406_10031704 3300031901 Bacteria 3220
60 Ga0307406_10123532 3300031901 Bacteria 1804
61 Ga0307406_10289520 3300031901 Bacteria 1253
62 Ga0307412_10032846 3300031911 Bacteria 3293
63 Ga0307412_10153242 3300031911 Bacteria 1703
64 Ga0307409_100054995 3300031995 Bacteria 3070
65 Ga0307409_100492875 3300031995 Bacteria 1191
66 Ga0307416_100220106 3300032002 Bacteria 1820
67 Ga0307414_10023630 3300032004 Bacteria 3903
68 Ga0307414_10036785 3300032004 Bacteria 3272
69 Ga0307414_10184611 3300032004 Bacteria 1681
70 Ga0307411_10197994 3300032005 Bacteria 1540
71 Ga0307415_100094161 3300032126 Bacteria 2177
72 Ga0307507_10001166 3300033179 Bacteria 58459
73 Ga0373941_0051763 3300035115 Bacteria 1308
74 Ga0395899_0012832 3300037312 Bacteria 6417
75 Ga0395898_0009776 3300037466 Bacteria 10052
76 Ga0436364_1165181 3300037853 Bacteria 998
77 Ga0395901_0190902 3300038443 Bacteria 2148
78 Ga0436365_1885895 3300039437 Bacteria 25793
79 Ga0439436_0000456 3300041404 Bacteria 10470
80 Ga0439447_050184 3300041407 Bacteria 998
81 Ga0439461_0048071 3300041410 Bacteria 939
82 Ga0451853_0838011 3300041512 Bacteria 779
83 Ga0439449_0014695 3300042007 Bacteria 2942
84 Ga0439455_0062653 3300042012 Bacteria 988
85 Ga0466969_0016770 3300044656 Bacteria 3830
86 Ga0466961_0161409 3300044693 Bacteria 1397
87 Ga0466963_0123002 3300044694 Bacteria 1787
88 Ga0466963_0593130 3300044694 Bacteria 782
89 Ga0466971_0155272 3300044719 Bacteria 1070
90 Ga0466957_0031829 3300044842 Bacteria 3155
91 Ga0466960_0010574 3300044901 Bacteria 3835
92 Ga0466959_0079441 3300045049 Bacteria 2365
93 Ga0466967_0000089 3300045976 Bacteria 32620
94 Ga0466967_0026849 3300045976 Bacteria 4778
95 Ga0466967_0046279 3300045976 Bacteria 3787
96 Ga0495632_0000015 3300046519 Bacteria 237713
97 Ga0495633_0122568 3300046558 Bacteria 1204
98 Ga0495656_0025659 3300046615 Bacteria 2338
99 Ga0495588_0001343 3300046674 Bacteria 10507
100 Ga0495670_0003582 3300046691 Bacteria 7625
101 Ga0495636_0008410 3300047318 Bacteria 4072
102 Ga0495677_0034596 3300047445 Bacteria 1843
103 Ga0495681_0060745 3300047470 Bacteria 1743
104 Ga0496101_0007474 3300048904 Bacteria 7083
105 Ga0496101_0434025 3300048904 Bacteria 1036
106 Ga0496101_0603854 3300048904 Bacteria 867
107 Ga0496102_0006153 3300048905 Bacteria 10230
108 Ga0496102_0187084 3300048905 Bacteria 1952
109 Ga0496103_0016701 3300048906 Bacteria 4383
110 Ga0496104_0004522 3300048907 Bacteria 12122
111 Ga0496105_0129977 3300048908 Bacteria 2076
112 Ga0496106_0001695 3300048909 Bacteria 16483
113 Ga0496106_0002625 3300048909 Bacteria 13369
114 Ga0496107_0017183 3300048910 Bacteria 5088
115 Ga0496108_0373847 3300048911 Bacteria 1244
116 Ga0496109_0023801 3300048912 Bacteria 5436
117 Ga0496110_0015315 3300048913 Bacteria 6378
118 Ga0496110_0091756 3300048913 Bacteria 2717
119 Ga0496111_0001365 3300048914 Bacteria 13827
120 Ga0496112_0007695 3300048915 Bacteria 9583
121 Ga0496112_0330530 3300048915 Bacteria 1468
122 Ga0496113_0002817 3300048916 Bacteria 10225
123 Ga0496114_0003570 3300048917 Bacteria 11949
124 Ga0496114_0005490 3300048917 Bacteria 9925
125 Ga0496117_0004226 3300048920 Bacteria 16032
126 Ga0496118_0117859 3300048921 Bacteria 1740
127 Ga0496122_0000430 3300048925 Bacteria 88467
128 Ga0496122_0025932 3300048925 Bacteria 5074
129 Ga0496122_0104322 3300048925 Bacteria 1884
130 Ga0496123_0000807 3300048926 Bacteria 50548
131 Ga0496123_0031925 3300048926 Bacteria 3823
132 Ga0496124_0000836 3300048927 Bacteria 50145
133 Ga0496124_0008372 3300048927 Bacteria 10821
134 Ga0496124_0012370 3300048927 Bacteria 8427
135 Ga0496124_0362976 3300048927 Bacteria 1020
136 Ga0496126_0028965 3300048929 Bacteria 5267
137 Ga0496126_0047382 3300048929 Bacteria 3935
138 Ga0496126_0142553 3300048929 Bacteria 2061
139 Ga0501034_0055765 3300049571 Bacteria 3976
140 Ga0501037_0002688 3300049573 Bacteria 12834
141 Ga0501047_0029300 3300049581 Bacteria 5309
142 Ga0501048_0007760 3300049582 Bacteria 8135
143 Ga0501070_0010194 3300049586 Bacteria 7951
144 Ga0501035_0134702 3300049822 Bacteria 2152
145 Ga0501044_0185656 3300049823 Bacteria 2044
146 nmdc:mga00v17_11018_c1 3300050491 Bacteria 4956
147 nmdc:mga0yw44_235571_c1 3300050492 Bacteria 1216
148 Ga0500556_0000911 3300053104 Bacteria 16352
149 Ga0500616_0000076 3300053153 Bacteria 216836
150 Ga0500616_0000322 3300053153 Bacteria 68577

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037853 Ga0436364_1165181 Ga0436364_1165181_350_976 199
2 3300048920 Ga0496117_0004226 Ga0496117_0004226_14862_15569 200
3 3300048926 Ga0496123_0031925 Ga0496123_0031925_3052_3759 200
4 3300053153 Ga0500616_0000076 Ga0500616_0000076_170614_171321 201
5 3300041512 Ga0451853_0838011 Ga0451853_0838011_31_756 214
6 3300044694 Ga0466963_0123002 Ga0466963_0123002_1103_1774 214
7 iso_pu_bacteria 2919042368 2919045870 217
8 iso_pu_bacteria 2852643534 2852643865 218
9 3300035115 Ga0373941_0051763 Ga0373941_0051763_115_837 219
10 3300026121 Ga0207683_10058518 Ga0207683_100585182 220
11 iso_pu_bacteria 2974302888 2974302947 220
12 3300021384 Ga0213876_10099065 Ga0213876_100990653 221
13 3300039437 Ga0436365_1885895 Ga0436365_1885895_17545_18237 221
14 3300048904 Ga0496101_0434025 Ga0496101_0434025_28_720 221
15 3300048927 Ga0496124_0008372 Ga0496124_0008372_1604_2296 221
16 iso_pu_bacteria 2844852863 2844854136 221
17 3300005435 Ga0070714_100130974 Ga0070714_1001309742 222
18 3300006028 Ga0070717_10230091 Ga0070717_102300912 222
19 3300044694 Ga0466963_0593130 Ga0466963_0593130_19_714 222
20 3300044719 Ga0466971_0155272 Ga0466971_0155272_55_750 222
21 3300044842 Ga0466957_0031829 Ga0466957_0031829_290_985 222
22 3300044901 Ga0466960_0010574 Ga0466960_0010574_2246_2941 222
23 3300045976 Ga0466967_0000089 Ga0466967_0000089_9303_9998 222
24 3300045976 Ga0466967_0026849 Ga0466967_0026849_977_1672 222
25 3300045976 Ga0466967_0046279 Ga0466967_0046279_231_926 222
26 3300048913 Ga0496110_0091756 Ga0496110_0091756_873_1586 222
27 3300049571 Ga0501034_0055765 Ga0501034_0055765_1359_2054 222
28 3300049573 Ga0501037_0002688 Ga0501037_0002688_11788_12483 222
29 3300049581 Ga0501047_0029300 Ga0501047_0029300_1359_2054 222
30 3300049582 Ga0501048_0007760 Ga0501048_0007760_5530_6225 222
31 3300049586 Ga0501070_0010194 Ga0501070_0010194_5332_6027 222
32 3300049822 Ga0501035_0134702 Ga0501035_0134702_929_1624 222
33 3300049823 Ga0501044_0185656 Ga0501044_0185656_271_966 222
34 iso_pu_bacteria 2946041624 2946045262 222
35 iso_pu_bacteria 8057345674 8057349206 222
36 3300005331 Ga0070670_100007027 Ga0070670_1000070275 223
37 3300005335 Ga0070666_10050819 Ga0070666_100508193 223
38 3300005364 Ga0070673_100259016 Ga0070673_1002590162 223
39 3300005535 Ga0070684_100775890 Ga0070684_1007758901 223
40 3300005543 Ga0070672_100007473 Ga0070672_1000074735 223
41 3300005841 Ga0068863_100785488 Ga0068863_1007854881 223
42 3300009011 Ga0105251_10018187 Ga0105251_100181873 223
43 3300009036 Ga0105244_10002224 Ga0105244_100022247 223
44 3300009148 Ga0105243_10008822 Ga0105243_100088225 223
45 3300013105 Ga0157369_10090765 Ga0157369_100907652 223
46 3300013306 Ga0163162_10037693 Ga0163162_100376932 223
47 3300013308 Ga0157375_10089600 Ga0157375_100896002 223
48 3300025315 Ga0207697_10020354 Ga0207697_100203542 223
49 3300025728 Ga0207655_1003632 Ga0207655_10036327 223
50 3300025735 Ga0207713_1027827 Ga0207713_10278272 223
51 3300025893 Ga0207682_10009946 Ga0207682_100099463 223
52 3300025903 Ga0207680_10028155 Ga0207680_100281552 223
53 3300025907 Ga0207645_10028221 Ga0207645_100282214 223
54 3300025923 Ga0207681_10013172 Ga0207681_100131723 223
55 3300025925 Ga0207650_10013469 Ga0207650_100134696 223
56 3300025926 Ga0207659_10031540 Ga0207659_100315404 223
57 3300025940 Ga0207691_10003282 Ga0207691_100032827 223
58 3300025941 Ga0207711_10242573 Ga0207711_102425732 223
59 3300025960 Ga0207651_10028561 Ga0207651_100285612 223
60 3300025986 Ga0207658_10422195 Ga0207658_104221952 223
61 3300046558 Ga0495633_0122568 Ga0495633_0122568_200_913 223
62 3300046615 Ga0495656_0025659 Ga0495656_0025659_193_906 223
63 3300046674 Ga0495588_0001343 Ga0495588_0001343_37_750 223
64 3300046691 Ga0495670_0003582 Ga0495670_0003582_5701_6414 223
65 3300047318 Ga0495636_0008410 Ga0495636_0008410_293_1006 223
66 3300047445 Ga0495677_0034596 Ga0495677_0034596_12_725 223
67 3300047470 Ga0495681_0060745 Ga0495681_0060745_40_753 223
68 3300048904 Ga0496101_0007474 Ga0496101_0007474_3067_3780 223
69 3300048905 Ga0496102_0006153 Ga0496102_0006153_4791_5504 223
70 3300048906 Ga0496103_0016701 Ga0496103_0016701_421_1134 223
71 3300048907 Ga0496104_0004522 Ga0496104_0004522_8343_9056 223
72 3300048908 Ga0496105_0129977 Ga0496105_0129977_795_1508 223
73 3300048909 Ga0496106_0002625 Ga0496106_0002625_4852_5565 223
74 3300048910 Ga0496107_0017183 Ga0496107_0017183_421_1134 223
75 3300048912 Ga0496109_0023801 Ga0496109_0023801_1608_2321 223
76 3300048913 Ga0496110_0015315 Ga0496110_0015315_2422_3135 223
77 3300048914 Ga0496111_0001365 Ga0496111_0001365_7409_8122 223
78 3300048915 Ga0496112_0007695 Ga0496112_0007695_3838_4551 223
79 3300048916 Ga0496113_0002817 Ga0496113_0002817_5944_6657 223
80 3300048917 Ga0496114_0005490 Ga0496114_0005490_6097_6810 223
81 3300048927 Ga0496124_0012370 Ga0496124_0012370_6669_7382 223
82 iso_pu_bacteria 2852663356 2852664015 223
83 iso_pu_bacteria 8056037122 8056040046 223
84 3300005564 Ga0070664_100286973 Ga0070664_1002869733 224
85 3300013296 Ga0157374_10022154 Ga0157374_100221543 224
86 iso_pu_bacteria 2565956761 2566996993 224
87 iso_pu_bacteria 2643221724 2644680864 224
88 iso_pu_bacteria 2728369380 2730230704 224
89 iso_pu_bacteria 2738541308 2738888934 224
90 iso_pu_bacteria 2808606357 2808831017 224
91 iso_pu_bacteria 2808606360 2808852279 224
92 iso_pu_bacteria 2808606370 2808893544 224
93 iso_pu_bacteria 2811994880 2812364967 224
94 iso_pu_bacteria 2857723135 2857725921 224
95 iso_pu_bacteria 2945920336 2945920540 224
96 iso_pu_bacteria 2953998280 2954000591 224
97 iso_pu_bacteria 2977264416 2977267294 224
98 iso_pu_bacteria 8056054917 8056058290 224
99 3300037312 Ga0395899_0012832 Ga0395899_0012832_4250_4957 225
100 3300037466 Ga0395898_0009776 Ga0395898_0009776_5018_5725 225
101 3300038443 Ga0395901_0190902 Ga0395901_0190902_531_1238 225
102 3300030521 Ga0307511_10228261 Ga0307511_102282611 226
103 iso_pu_bacteria 2904776348 2904777775 226
104 iso_pu_bacteria 8054107350 8054112077 226
105 3300006051 Ga0075364_10014205 Ga0075364_100142056 227
106 3300013306 Ga0163162_10078455 Ga0163162_100784552 227
107 3300031824 Ga0307413_10278928 Ga0307413_102789281 227
108 3300031901 Ga0307406_10289520 Ga0307406_102895201 227
109 3300031995 Ga0307409_100492875 Ga0307409_1004928751 227
110 3300046519 Ga0495632_0000015 Ga0495632_0000015_47708_48433 227
111 3300048905 Ga0496102_0187084 Ga0496102_0187084_557_1282 227
112 3300048909 Ga0496106_0001695 Ga0496106_0001695_2687_3412 227
113 3300048925 Ga0496122_0104322 Ga0496122_0104322_864_1574 227
114 3300050491 nmdc:mga00v17_11018_c1 nmdc:mga00v17_11018_c1_110_820 227
115 3300050492 nmdc:mga0yw44_235571_c1 nmdc:mga0yw44_235571_c1_187_897 227
116 3300053104 Ga0500556_0000911 Ga0500556_0000911_9409_10134 227
117 3300053153 Ga0500616_0000322 Ga0500616_0000322_3244_3969 227
118 3300006058 Ga0075432_10003666 Ga0075432_100036662 228
119 3300006186 Ga0075369_10086208 Ga0075369_100862082 228
120 3300009036 Ga0105244_10000643 Ga0105244_100006434 228
121 3300011119 Ga0105246_10060399 Ga0105246_100603992 228
122 3300013105 Ga0157369_10287094 Ga0157369_102870942 228
123 3300025303 Ga0209051_1018889 Ga0209051_10188894 228
124 3300025937 Ga0207669_10066391 Ga0207669_100663912 228
125 3300031730 Ga0307516_10006936 Ga0307516_100069361 228
126 3300031901 Ga0307406_10001096 Ga0307406_100010967 228
127 3300031901 Ga0307406_10123532 Ga0307406_101235322 228
128 3300031911 Ga0307412_10032846 Ga0307412_100328461 228
129 3300031995 Ga0307409_100054995 Ga0307409_1000549953 228
130 3300032002 Ga0307416_100220106 Ga0307416_1002201062 228
131 3300032004 Ga0307414_10023630 Ga0307414_100236302 228
132 3300032004 Ga0307414_10184611 Ga0307414_101846111 228
133 3300032126 Ga0307415_100094161 Ga0307415_1000941613 228
134 3300033179 Ga0307507_10001166 Ga0307507_100011666 228
135 3300041404 Ga0439436_0000456 Ga0439436_0000456_698_1411 228
136 3300041407 Ga0439447_050184 Ga0439447_050184_83_796 228
137 3300041410 Ga0439461_0048071 Ga0439461_0048071_207_920 228
138 3300042007 Ga0439449_0014695 Ga0439449_0014695_234_947 228
139 3300042012 Ga0439455_0062653 Ga0439455_0062653_146_859 228
140 3300044656 Ga0466969_0016770 Ga0466969_0016770_3004_3717 228
141 3300044693 Ga0466961_0161409 Ga0466961_0161409_266_979 228
142 3300045049 Ga0466959_0079441 Ga0466959_0079441_775_1488 228
143 3300048915 Ga0496112_0330530 Ga0496112_0330530_646_1359 228
144 3300048921 Ga0496118_0117859 Ga0496118_0117859_987_1700 228
145 3300048925 Ga0496122_0000430 Ga0496122_0000430_54825_55538 228
146 3300048925 Ga0496122_0025932 Ga0496122_0025932_822_1535 228
147 3300048926 Ga0496123_0000807 Ga0496123_0000807_16908_17621 228
148 3300048927 Ga0496124_0000836 Ga0496124_0000836_26410_27123 228
149 3300048927 Ga0496124_0362976 Ga0496124_0362976_17_730 228
150 3300048929 Ga0496126_0028965 Ga0496126_0028965_1560_2273 228
151 3300048929 Ga0496126_0047382 Ga0496126_0047382_3046_3759 228
152 iso_pu_bacteria 2945941187 2945941838 228
153 3300048929 Ga0496126_0142553 Ga0496126_0142553_927_1643 229
154 3300025914 Ga0207671_10005300 Ga0207671_100053007 230
155 iso_pu_bacteria 2738541272 2738698097 230
156 iso_pu_bacteria 2738543027 2739328431 230
157 3300009177 Ga0105248_10000713 Ga0105248_100007133 232
158 3300011119 Ga0105246_10001935 Ga0105246_100019354 232
159 3300025941 Ga0207711_10000340 Ga0207711_1000034034 232
160 3300026088 Ga0207641_10382942 Ga0207641_103829422 232
161 3300048904 Ga0496101_0603854 Ga0496101_0603854_29_754 232
162 3300048911 Ga0496108_0373847 Ga0496108_0373847_141_866 232
163 3300048917 Ga0496114_0003570 Ga0496114_0003570_9255_9980 232
164 3300003752 Ga0055539_1000006 Ga0055539_1000006294 234
165 3300003756 Ga0055533_1000002 Ga0055533_1000002378 234
166 3300003759 Ga0055525_1000022 Ga0055525_1000022173 234
167 3300025225 Ga0209566_100013 Ga0209566_100013410 234
168 3300025226 Ga0209674_100001 Ga0209674_1000013185 234
169 3300025230 Ga0209563_100001 Ga0209563_1000013185 234
170 3300025253 Ga0209677_100001 Ga0209677_1000013185 234
171 3300031548 Ga0307408_100139180 Ga0307408_1001391802 234
172 3300031852 Ga0307410_10099112 Ga0307410_100991122 234
173 3300031901 Ga0307406_10031704 Ga0307406_100317041 234
174 3300031911 Ga0307412_10153242 Ga0307412_101532422 234
175 3300032004 Ga0307414_10036785 Ga0307414_100367853 234
176 3300032005 Ga0307411_10197994 Ga0307411_101979941 234

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

7

188

0.92

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

13

207

0.88

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

9

114

0.8

PF13460

NAD_binding_10

NAD(P)H-binding

13

103

0.79

PF08659

KR

KR domain

7

177

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
5u4s-assembly1.cif.gz_B crystal structure of a short chain dehydrogenase from burkholderia cenocepacia j2315 in complex with nadp. 0.8815 3 224
4m8s-assembly1.cif.gz_B crystal structure of 3-ketoacyl -(acyl carrier protein) reductase (fabg) from neisseria meningitidis 0.8724 3 201
5u4s-assembly1.cif.gz_A crystal structure of a short chain dehydrogenase from burkholderia cenocepacia j2315 in complex with nadp. 0.8708 3 224
3i1j-assembly1.cif.gz_B structure of a putative short chain dehydrogenase from pseudomonas syringae 0.8689 4 200
6t77-assembly1.cif.gz_A crystal structure of klebsiella pneumoniae fabg(nadph-dependent) nadp-complex at 1.75 a resolution 0.8676 3 205
ID Description Score Start End Superfamily
af_O53324_1_231_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9147 1 221 3.40.50.720
af_Q55CK8_13_289_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8816 4 219 3.40.50.720
af_O07749_1_255_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8789 7 213 3.40.50.720
af_A0A0P0VCB4_1_152_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8787 92 200 3.40.50.720
af_Q8N3Y7_32_292_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8777 3 223 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A0K2R8W8-F1-model_v4 deleted 0.966 66 155
AF-A0A0X3SFB9-F1-model_v4 Short-chain dehydrogenase 0.9648 63 224 GO:0016491
AF-A0A1H0C3Y7-F1-model_v4 Short chain dehydrogenase 0.963 102 224 GO:0005829
GO:0016491
AF-A0A059X152-F1-model_v4 Short chain dehydrogenase 0.9616 104 223
AF-A0A1H0RBN5-F1-model_v4 Short chain dehydrogenase 0.9561 76 221 GO:0016491

Feature Viewer

pLDDT pTM Quality
91.94 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map