F268240

General Info

Members Datasets Scaffolds Average Seq Length
176 111 176 286

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10128583|Ga0105237_101285832
Length 307
Sequence MIEQAQTNDDGGRSSARPFPGLRDKEVQALEQRANDIRKSIIEMLVEAGSGHTAGPLGMADVFTALYFHVLKQDPANPAWPERDRLVLSNGHICPVLYATMAHAGYFPISELKTLRKFGSRLQGHPHREFLPMLETSSGPLGSGLSQAVGMALADRIDRGRSSDRFIYCLMSDGELDEGQSWEAAMLAGKEKLRNLIAIIDRNNIQIDGFTDDVMPLEPLREKWESWNWHVQEISGHNFAEIIGAIDQAKAIFEKPSMIIAHTIPGKGVKEFERDFHWHGKPPNKEQAEMALAELRTLGGKIRSEHE

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
33 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
49 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
75 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
76 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
77 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
78 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
79 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
80 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
81 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
82 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
83 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
84 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
85 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
86 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
87 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
88 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
89 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
90 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
91 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
92 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
93 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
94 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
95 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
96 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
97 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
98 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
99 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
100 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
101 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
102 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
103 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
104 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
107 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
108 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
109 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
110 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
111 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.3
Metatranscriptomes 1.7
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.7
Nodule 0
Rhizoplane 0
Rhizosphere 98.3
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100092874 3300005329 Bacteria 2834
2 Ga0070683_100176096 3300005329 Bacteria 2030
3 Ga0070683_100303740 3300005329 Unclassified 1518
4 Ga0070670_100005962 3300005331 Bacteria 10308
5 Ga0068869_100039768 3300005334 Bacteria 3359
6 Ga0070680_100009594 3300005336 Bacteria 7439
7 Ga0070680_100101917 3300005336 Bacteria 2383
8 Ga0068868_100481949 3300005338 Unclassified 1084
9 Ga0070691_10202523 3300005341 Unclassified 1043
10 Ga0070661_100089178 3300005344 Bacteria 2283
11 Ga0070692_10098747 3300005345 Bacteria 1598
12 Ga0070675_100127382 3300005354 Bacteria 2167
13 Ga0070709_10025301 3300005434 Archaea 3506
14 Ga0070709_10170070 3300005434 Bacteria 1522
15 Ga0070714_100013735 3300005435 Bacteria 6494
16 Ga0070713_100006630 3300005436 Bacteria 8050
17 Ga0070713_100289366 3300005436 Bacteria 1505
18 Ga0070694_100407012 3300005444 Unclassified 1066
19 Ga0070708_100070367 3300005445 Archaea 3147
20 Ga0070708_100085585 3300005445 Archaea 2862
21 Ga0070681_10034013 3300005458 Bacteria 5118
22 Ga0070681_10054727 3300005458 Bacteria 3976
23 Ga0070707_100000400 3300005468 Archaea 42804
24 Ga0070707_100018168 3300005468 Bacteria 6616
25 Ga0070707_100137902 3300005468 Archaea 2373
26 Ga0070707_100149565 3300005468 Archaea 2273
27 Ga0070699_100004722 3300005518 Bacteria 12052
28 Ga0070679_100000050 3300005530 Bacteria 88045
29 Ga0070679_100000752 3300005530 Bacteria 28053
30 Ga0070684_100007166 3300005535 Bacteria 8664
31 Ga0070684_100066807 3300005535 Bacteria 3157
32 Ga0070684_100094471 3300005535 Bacteria 2663
33 Ga0070684_100098832 3300005535 Bacteria 2604
34 Ga0070697_100006366 3300005536 Archaea 9138
35 Ga0070697_100064067 3300005536 Bacteria 3002
36 Ga0070696_100132771 3300005546 Unclassified 1813
37 Ga0070693_100023163 3300005547 Bacteria 3315
38 Ga0070704_100000002 3300005549 Bacteria 162543
39 Ga0070704_100001032 3300005549 Bacteria 14351
40 Ga0068855_100043037 3300005563 Bacteria 5351
41 Ga0068855_100061165 3300005563 Bacteria 4401
42 Ga0070664_100163537 3300005564 Bacteria 1970
43 Ga0068856_100002881 3300005614 Bacteria 17596
44 Ga0070702_100025960 3300005615 Bacteria 3144
45 Ga0068859_100055741 3300005617 Bacteria 3977
46 Ga0068864_100003146 3300005618 Bacteria 13641
47 Ga0068858_100097634 3300005842 Bacteria 2739
48 Ga0081455_10155618 3300005937 Bacteria 1757
49 Ga0068865_100004326 3300006881 Bacteria 8575
50 Ga0097620_100055744 3300006931 Bacteria 3977
51 Ga0099794_10002678 3300007265 Archaea 6632
52 Ga0099794_10037475 3300007265 Bacteria 2295
53 Ga0099794_10054315 3300007265 Bacteria 1933
54 Ga0105240_10077965 3300009093 Unclassified 4081
55 Ga0105245_10000570 3300009098 Bacteria 33601
56 Ga0105241_10444708 3300009174 Unclassified 1145
57 Ga0105248_10065434 3300009177 Bacteria 4082
58 Ga0105237_10128583 3300009545 Unclassified 2528
59 Ga0105238_10256472 3300009551 Unclassified 1728
60 Ga0105239_10000003 3300010375 Bacteria 606801
61 Ga0157370_10009286 3300013104 Bacteria 10533
62 Ga0157370_10084445 3300013104 Bacteria 2984
63 Ga0157370_10096107 3300013104 Bacteria 2780
64 Ga0157370_10171721 3300013104 Bacteria 2015
65 Ga0157370_10400105 3300013104 Unclassified 1264
66 Ga0157369_10063463 3300013105 Unclassified 3979
67 Ga0157374_10540053 3300013296 Unclassified 1173
68 Ga0157372_10113058 3300013307 Bacteria 3112
69 Ga0157372_10152654 3300013307 Bacteria 2666
70 Ga0157372_10163756 3300013307 Bacteria 2571
71 Ga0157372_10185997 3300013307 Unclassified 2405
72 Ga0157372_10510918 3300013307 Unclassified 1401
73 Ga0157372_10555166 3300013307 Bacteria 1339
74 Ga0206356_11274551 3300020070 Unclassified 1696
75 Ga0206352_10337490 3300020078 Bacteria 1210
76 Ga0154015_1066787 3300020610 Bacteria 1784
77 Ga0207699_10175200 3300025906 Unclassified 1438
78 Ga0207707_10009941 3300025912 Bacteria 8249
79 Ga0207707_10010281 3300025912 Bacteria 8120
80 Ga0207695_10143941 3300025913 Unclassified 2330
81 Ga0207671_10094701 3300025914 Bacteria 2254
82 Ga0207671_10408878 3300025914 Bacteria 1079
83 Ga0207663_10297594 3300025916 Unclassified 1204
84 Ga0207660_10000703 3300025917 Bacteria 22314
85 Ga0207660_10012635 3300025917 Bacteria 5530
86 Ga0207660_10106838 3300025917 Unclassified 2099
87 Ga0207662_10133368 3300025918 Unclassified 1568
88 Ga0207649_10064289 3300025920 Unclassified 2319
89 Ga0207652_10004771 3300025921 Bacteria 10992
90 Ga0207652_10006781 3300025921 Bacteria 9234
91 Ga0207646_10000003 3300025922 Bacteria 537256
92 Ga0207646_10113869 3300025922 Archaea 2429
93 Ga0207694_10035119 3300025924 Bacteria 3845
94 Ga0207659_10027352 3300025926 Bacteria 3861
95 Ga0207700_10084140 3300025928 Unclassified 2493
96 Ga0207664_10008538 3300025929 Bacteria 7152
97 Ga0207664_10012087 3300025929 Bacteria 6165
98 Ga0207704_10002306 3300025938 Bacteria 8575
99 Ga0207689_10000178 3300025942 Bacteria 55729
100 Ga0207661_10036303 3300025944 Bacteria 3846
101 Ga0207661_10062478 3300025944 Unclassified 3013
102 Ga0207661_10264357 3300025944 Unclassified 1533
103 Ga0207679_10207996 3300025945 Bacteria 1639
104 Ga0207667_10067899 3300025949 Unclassified 3714
105 Ga0207703_10077614 3300026035 Bacteria 2758
106 Ga0207702_10004994 3300026078 Bacteria 11655
107 Ga0207641_10448538 3300026088 Unclassified 1246
108 Ga0207676_10012599 3300026095 Bacteria 6064
109 Ga0207674_10054574 3300026116 Bacteria 4067
110 Ga0209588_1004072 3300027671 Archaea 4095
111 Ga0209588_1014231 3300027671 Bacteria 2434
112 Ga0265319_1018840 3300028563 Bacteria 2591
113 Ga0265319_1020540 3300028563 Bacteria 2445
114 Ga0265334_10009311 3300028573 Bacteria 4155
115 Ga0265318_10014380 3300028577 Bacteria 3325
116 Ga0265323_10023151 3300028653 Unclassified 2369
117 Ga0265336_10032782 3300028666 Bacteria 1610
118 Ga0265336_10056620 3300028666 Bacteria 1178
119 Ga0265338_10000163 3300028800 Bacteria 121431
120 Ga0265338_10000264 3300028800 Bacteria 95378
121 Ga0265338_10002012 3300028800 Bacteria 31523
122 Ga0265338_10003052 3300028800 Bacteria 24076
123 Ga0265338_10043376 3300028800 Unclassified 4173
124 Ga0265338_10060441 3300028800 Bacteria 3330
125 Ga0265338_10087992 3300028800 Unclassified 2579
126 Ga0265338_10090631 3300028800 Unclassified 2530
127 Ga0265338_10113131 3300028800 Bacteria 2181
128 Ga0265324_10039726 3300029957 Unclassified 1631
129 Ga0265330_10001342 3300031235 Bacteria 14385
130 Ga0265330_10041541 3300031235 Unclassified 2039
131 Ga0265320_10025494 3300031240 Bacteria 3107
132 Ga0265320_10140249 3300031240 Bacteria 1095
133 Ga0265340_10001453 3300031247 Bacteria 13577
134 Ga0265331_10001523 3300031250 Bacteria 17068
135 Ga0265327_10007642 3300031251 Bacteria 8283
136 Ga0265327_10017578 3300031251 Bacteria 4479
137 Ga0265316_10000096 3300031344 Bacteria 95536
138 Ga0265316_10003875 3300031344 Bacteria 15002
139 Ga0265316_10057163 3300031344 Bacteria 3044
140 Ga0265316_10067676 3300031344 Unclassified 2761
141 Ga0265316_10076022 3300031344 Bacteria 2581
142 Ga0265316_10262650 3300031344 Bacteria 1266
143 Ga0265313_10003628 3300031595 Bacteria 12394
144 Ga0265314_10036236 3300031711 Bacteria 3587
145 Ga0265314_10098432 3300031711 Unclassified 1886
146 Ga0265342_10000953 3300031712 Bacteria 28804
147 Ga0265342_10152966 3300031712 Bacteria 1280
148 Ga0373934_0023527 3300035086 Bacteria 2380
149 Ga0373937_0054201 3300036401 Bacteria 3679
150 Ga0316582_0519853 3300036647 Bacteria 820
151 Ga0451577_0000056 3300042876 Bacteria 273200
152 Ga0453683_0337617 3300044673 Unclassified 967
153 Ga0466964_0056142 3300044706 Unclassified 1628
154 Ga0453684_0000451 3300044712 Bacteria 165980
155 Ga0453684_0011100 3300044712 Bacteria 15200
156 Ga0453684_0031690 3300044712 Bacteria 7422
157 Ga0451576_0010667 3300045051 Bacteria 10528
158 Ga0451576_0020431 3300045051 Bacteria 7213
159 Ga0451576_0024904 3300045051 Bacteria 6457
160 Ga0451576_0059644 3300045051 Bacteria 3983
161 Ga0466967_0089764 3300045976 Bacteria 2791
162 Ga0466967_0175264 3300045976 Bacteria 2020
163 Ga0495587_0020834 3300046536 Bacteria 4044
164 Ga0495645_0001531 3300046543 Bacteria 15614
165 Ga0495667_0017000 3300046559 Bacteria 4911
166 Ga0495623_0070291 3300046679 Bacteria 2181
167 Ga0495675_0019742 3300047444 Bacteria 4282
168 Ga0501034_0008709 3300049571 Bacteria 10686
169 Ga0501034_0685921 3300049571 Unclassified 924
170 Ga0501047_0177522 3300049581 Bacteria 1997
171 Ga0501073_0007965 3300049589 Bacteria 7864
172 Ga0501249_000062 3300049679 Bacteria 39027
173 Ga0501083_0227838 3300049744 Bacteria 1214
174 Ga0500556_0005758 3300053104 Bacteria 3507
175 Ga0500652_028818 3300053131 Bacteria 2161
176 Ga0500616_0000039 3300053153 Bacteria 383915

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044673 Ga0453683_0337617 Ga0453683_0337617_16_720 233
2 3300009093 Ga0105240_10077965 Ga0105240_100779655 245
3 3300036647 Ga0316582_0519853 Ga0316582_0519853_21_803 246
4 3300025928 Ga0207700_10084140 Ga0207700_100841403 248
5 3300006881 Ga0068865_100004326 Ga0068865_1000043266 267
6 3300025938 Ga0207704_10002306 Ga0207704_100023066 267
7 3300028563 Ga0265319_1018840 Ga0265319_10188402 273
8 3300028800 Ga0265338_10087992 Ga0265338_100879923 273
9 3300029957 Ga0265324_10039726 Ga0265324_100397261 273
10 3300031240 Ga0265320_10025494 Ga0265320_100254942 273
11 3300031240 Ga0265320_10140249 Ga0265320_101402492 273
12 3300031344 Ga0265316_10057163 Ga0265316_100571633 273
13 3300005445 Ga0070708_100070367 Ga0070708_1000703673 274
14 3300005445 Ga0070708_100085585 Ga0070708_1000855852 274
15 3300005468 Ga0070707_100000400 Ga0070707_10000040039 274
16 3300005468 Ga0070707_100018168 Ga0070707_1000181685 274
17 3300005468 Ga0070707_100137902 Ga0070707_1001379022 274
18 3300005468 Ga0070707_100149565 Ga0070707_1001495653 274
19 3300005518 Ga0070699_100004722 Ga0070699_10000472214 274
20 3300005536 Ga0070697_100006366 Ga0070697_1000063666 274
21 3300005536 Ga0070697_100064067 Ga0070697_1000640673 274
22 3300007265 Ga0099794_10002678 Ga0099794_100026787 274
23 3300007265 Ga0099794_10037475 Ga0099794_100374753 274
24 3300007265 Ga0099794_10054315 Ga0099794_100543151 274
25 3300025922 Ga0207646_10000003 Ga0207646_10000003172 274
26 3300025922 Ga0207646_10113869 Ga0207646_101138694 274
27 3300027671 Ga0209588_1004072 Ga0209588_10040722 274
28 3300027671 Ga0209588_1014231 Ga0209588_10142313 274
29 3300044712 Ga0453684_0011100 Ga0453684_0011100_4757_5614 276
30 3300031251 Ga0265327_10017578 Ga0265327_100175786 277
31 3300028666 Ga0265336_10056620 Ga0265336_100566201 278
32 3300028800 Ga0265338_10002012 Ga0265338_1000201222 278
33 3300031247 Ga0265340_10001453 Ga0265340_100014536 278
34 3300031251 Ga0265327_10007642 Ga0265327_100076429 278
35 3300031344 Ga0265316_10076022 Ga0265316_100760222 278
36 3300031344 Ga0265316_10262650 Ga0265316_102626501 278
37 3300031595 Ga0265313_10003628 Ga0265313_100036285 278
38 3300042876 Ga0451577_0000056 Ga0451577_0000056_128144_128989 278
39 3300044712 Ga0453684_0000451 Ga0453684_0000451_95266_96111 278
40 3300044712 Ga0453684_0031690 Ga0453684_0031690_4757_5605 278
41 3300045051 Ga0451576_0010667 Ga0451576_0010667_4894_5736 278
42 3300045051 Ga0451576_0020431 Ga0451576_0020431_2572_3417 278
43 3300028653 Ga0265323_10023151 Ga0265323_100231511 279
44 3300031235 Ga0265330_10001342 Ga0265330_100013428 279
45 3300031344 Ga0265316_10067676 Ga0265316_100676761 279
46 3300045051 Ga0451576_0059644 Ga0451576_0059644_2687_3532 279
47 3300010375 Ga0105239_10000003 Ga0105239_10000003181 281
48 3300025914 Ga0207671_10408878 Ga0207671_104088782 281
49 3300031344 Ga0265316_10000096 Ga0265316_1000009643 282
50 3300031712 Ga0265342_10000953 Ga0265342_1000095318 282
51 3300005546 Ga0070696_100132771 Ga0070696_1001327712 283
52 3300005549 Ga0070704_100001032 Ga0070704_1000010329 284
53 3300028800 Ga0265338_10090631 Ga0265338_100906312 284
54 3300025929 Ga0207664_10012087 Ga0207664_100120873 285
55 3300028563 Ga0265319_1020540 Ga0265319_10205401 285
56 3300045051 Ga0451576_0024904 Ga0451576_0024904_252_1112 285
57 3300005336 Ga0070680_100009594 Ga0070680_1000095943 286
58 3300005458 Ga0070681_10034013 Ga0070681_100340133 286
59 3300005530 Ga0070679_100000050 Ga0070679_10000005052 286
60 3300005535 Ga0070684_100007166 Ga0070684_1000071665 286
61 3300005535 Ga0070684_100066807 Ga0070684_1000668072 286
62 3300005549 Ga0070704_100000002 Ga0070704_10000000213 286
63 3300005937 Ga0081455_10155618 Ga0081455_101556182 286
64 3300009551 Ga0105238_10256472 Ga0105238_102564722 286
65 3300025917 Ga0207660_10000703 Ga0207660_100007037 286
66 3300025921 Ga0207652_10006781 Ga0207652_100067814 286
67 3300028800 Ga0265338_10000264 Ga0265338_1000026478 286
68 3300049581 Ga0501047_0177522 Ga0501047_0177522_98_961 286
69 3300005329 Ga0070683_100092874 Ga0070683_1000928742 287
70 3300005329 Ga0070683_100176096 Ga0070683_1001760963 287
71 3300005329 Ga0070683_100303740 Ga0070683_1003037402 287
72 3300005331 Ga0070670_100005962 Ga0070670_1000059622 287
73 3300005334 Ga0068869_100039768 Ga0068869_1000397682 287
74 3300005336 Ga0070680_100101917 Ga0070680_1001019173 287
75 3300005338 Ga0068868_100481949 Ga0068868_1004819491 287
76 3300005341 Ga0070691_10202523 Ga0070691_102025231 287
77 3300005344 Ga0070661_100089178 Ga0070661_1000891782 287
78 3300005345 Ga0070692_10098747 Ga0070692_100987472 287
79 3300005354 Ga0070675_100127382 Ga0070675_1001273822 287
80 3300005434 Ga0070709_10025301 Ga0070709_100253012 287
81 3300005434 Ga0070709_10170070 Ga0070709_101700702 287
82 3300005435 Ga0070714_100013735 Ga0070714_1000137358 287
83 3300005436 Ga0070713_100006630 Ga0070713_1000066303 287
84 3300005436 Ga0070713_100289366 Ga0070713_1002893662 287
85 3300005444 Ga0070694_100407012 Ga0070694_1004070121 287
86 3300005458 Ga0070681_10054727 Ga0070681_100547273 287
87 3300005530 Ga0070679_100000752 Ga0070679_10000075215 287
88 3300005535 Ga0070684_100094471 Ga0070684_1000944712 287
89 3300005535 Ga0070684_100098832 Ga0070684_1000988322 287
90 3300005547 Ga0070693_100023163 Ga0070693_1000231632 287
91 3300005563 Ga0068855_100043037 Ga0068855_1000430373 287
92 3300005563 Ga0068855_100061165 Ga0068855_1000611654 287
93 3300005564 Ga0070664_100163537 Ga0070664_1001635372 287
94 3300005614 Ga0068856_100002881 Ga0068856_1000028815 287
95 3300005615 Ga0070702_100025960 Ga0070702_1000259602 287
96 3300005617 Ga0068859_100055741 Ga0068859_1000557412 287
97 3300005618 Ga0068864_100003146 Ga0068864_1000031467 287
98 3300005842 Ga0068858_100097634 Ga0068858_1000976342 287
99 3300006931 Ga0097620_100055744 Ga0097620_1000557442 287
100 3300009098 Ga0105245_10000570 Ga0105245_1000057035 287
101 3300009174 Ga0105241_10444708 Ga0105241_104447081 287
102 3300009177 Ga0105248_10065434 Ga0105248_100654342 287
103 3300009545 Ga0105237_10128583 Ga0105237_101285832 287
104 3300013104 Ga0157370_10009286 Ga0157370_100092864 287
105 3300013104 Ga0157370_10084445 Ga0157370_100844452 287
106 3300013104 Ga0157370_10096107 Ga0157370_100961072 287
107 3300013104 Ga0157370_10171721 Ga0157370_101717212 287
108 3300013104 Ga0157370_10400105 Ga0157370_104001052 287
109 3300013105 Ga0157369_10063463 Ga0157369_100634632 287
110 3300013296 Ga0157374_10540053 Ga0157374_105400531 287
111 3300013307 Ga0157372_10113058 Ga0157372_101130582 287
112 3300013307 Ga0157372_10152654 Ga0157372_101526543 287
113 3300013307 Ga0157372_10163756 Ga0157372_101637562 287
114 3300013307 Ga0157372_10185997 Ga0157372_101859972 287
115 3300013307 Ga0157372_10510918 Ga0157372_105109182 287
116 3300013307 Ga0157372_10555166 Ga0157372_105551661 287
117 3300020070 Ga0206356_11274551 Ga0206356_112745512 287
118 3300020078 Ga0206352_10337490 Ga0206352_103374901 287
119 3300020610 Ga0154015_1066787 Ga0154015_10667873 287
120 3300025906 Ga0207699_10175200 Ga0207699_101752002 287
121 3300025912 Ga0207707_10009941 Ga0207707_100099418 287
122 3300025912 Ga0207707_10010281 Ga0207707_100102814 287
123 3300025913 Ga0207695_10143941 Ga0207695_101439413 287
124 3300025914 Ga0207671_10094701 Ga0207671_100947013 287
125 3300025916 Ga0207663_10297594 Ga0207663_102975941 287
126 3300025917 Ga0207660_10012635 Ga0207660_100126353 287
127 3300025917 Ga0207660_10106838 Ga0207660_101068382 287
128 3300025918 Ga0207662_10133368 Ga0207662_101333682 287
129 3300025920 Ga0207649_10064289 Ga0207649_100642893 287
130 3300025921 Ga0207652_10004771 Ga0207652_100047714 287
131 3300025924 Ga0207694_10035119 Ga0207694_100351192 287
132 3300025926 Ga0207659_10027352 Ga0207659_100273522 287
133 3300025929 Ga0207664_10008538 Ga0207664_100085382 287
134 3300025942 Ga0207689_10000178 Ga0207689_1000017849 287
135 3300025944 Ga0207661_10036303 Ga0207661_100363033 287
136 3300025944 Ga0207661_10062478 Ga0207661_100624783 287
137 3300025944 Ga0207661_10264357 Ga0207661_102643572 287
138 3300025945 Ga0207679_10207996 Ga0207679_102079962 287
139 3300025949 Ga0207667_10067899 Ga0207667_100678992 287
140 3300026035 Ga0207703_10077614 Ga0207703_100776143 287
141 3300026078 Ga0207702_10004994 Ga0207702_100049942 287
142 3300026088 Ga0207641_10448538 Ga0207641_104485382 287
143 3300026095 Ga0207676_10012599 Ga0207676_100125992 287
144 3300026116 Ga0207674_10054574 Ga0207674_100545742 287
145 3300028573 Ga0265334_10009311 Ga0265334_100093117 287
146 3300028577 Ga0265318_10014380 Ga0265318_100143805 287
147 3300028666 Ga0265336_10032782 Ga0265336_100327822 287
148 3300028800 Ga0265338_10000163 Ga0265338_1000016380 287
149 3300028800 Ga0265338_10003052 Ga0265338_100030526 287
150 3300028800 Ga0265338_10043376 Ga0265338_100433765 287
151 3300028800 Ga0265338_10060441 Ga0265338_100604411 287
152 3300028800 Ga0265338_10113131 Ga0265338_101131312 287
153 3300031235 Ga0265330_10041541 Ga0265330_100415412 287
154 3300031250 Ga0265331_10001523 Ga0265331_1000152313 287
155 3300031344 Ga0265316_10003875 Ga0265316_100038759 287
156 3300031711 Ga0265314_10036236 Ga0265314_100362361 287
157 3300031711 Ga0265314_10098432 Ga0265314_100984322 287
158 3300031712 Ga0265342_10152966 Ga0265342_101529662 287
159 3300035086 Ga0373934_0023527 Ga0373934_0023527_1393_2256 287
160 3300036401 Ga0373937_0054201 Ga0373937_0054201_94_957 287
161 3300044706 Ga0466964_0056142 Ga0466964_0056142_340_1206 287
162 3300045976 Ga0466967_0089764 Ga0466967_0089764_1847_2710 287
163 3300045976 Ga0466967_0175264 Ga0466967_0175264_1142_2005 287
164 3300046536 Ga0495587_0020834 Ga0495587_0020834_2030_2893 287
165 3300046543 Ga0495645_0001531 Ga0495645_0001531_11964_12827 287
166 3300046559 Ga0495667_0017000 Ga0495667_0017000_3861_4724 287
167 3300046679 Ga0495623_0070291 Ga0495623_0070291_255_1118 287
168 3300047444 Ga0495675_0019742 Ga0495675_0019742_1454_2317 287
169 3300049571 Ga0501034_0008709 Ga0501034_0008709_7528_8400 287
170 3300049571 Ga0501034_0685921 Ga0501034_0685921_25_891 287
171 3300049589 Ga0501073_0007965 Ga0501073_0007965_1665_2573 287
172 3300049679 Ga0501249_000062 Ga0501249_000062_27000_27905 287
173 3300049744 Ga0501083_0227838 Ga0501083_0227838_98_979 287
174 3300053104 Ga0500556_0005758 Ga0500556_0005758_138_1034 287
175 3300053131 Ga0500652_028818 Ga0500652_028818_428_1294 287
176 3300053153 Ga0500616_0000039 Ga0500616_0000039_373039_373908 287

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00456

Transketolase_N

Transketolase, thiamine diphosphate binding domain

30

299

0.94

PF13292

DXP_synthase_N

1-deoxy-D-xylulose-5-phosphate synthase

16

214

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
6yak-assembly1.cif.gz_CCC split gene transketolase, active alpha2beta2 heterotetramer 0.9751 9 284
4kxw-assembly1.cif.gz_A human transketolase in covalent complex with donor ketose d-xylulose-5-phosphate, crystal 2 0.9494 1 277
6ha3-assembly1.cif.gz_A human transketolase variant e160q in covalent complex with donor ketose d-fructose-6-phosphate 0.9489 1 277
3ooy-assembly1.cif.gz_A crystal structure of human transketolase (tkt) 0.9487 4 277
3upt-assembly1.cif.gz_B crystal structure of a transketolase from burkholderia pseudomallei bound to tpp, calcium and ribose-5-phosphate 0.9468 11 276
ID Description Score Start End Superfamily
af_Q58094_1_274_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9615 3 276 3.40.50.970
af_Q6PHI8_1_298_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9537 2 277 3.40.50.970
af_A0A1D6P5P4_1_115_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.946 158 269 3.40.50.970
af_Q58094_1_274_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.941 3 276 3.40.50.970
4c7vA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9349 10 276 3.40.50.970
ID Description Score Start End GO Terms
AF-A0A0G1T995-F1-model_v4 Transketolase N-terminal domain-containing protein 0.9917 146 286
AF-A0A3E3DTY4-F1-model_v4 Transketolase 0.9885 147 276
AF-A0A800DIR4-F1-model_v4 Transketolase 0.9884 157 275
AF-A0A0F9GTF7-F1-model_v4 Transketolase N-terminal domain-containing protein 0.9879 134 275
AF-X1MKK0-F1-model_v4 Transketolase N-terminal domain-containing protein 0.9859 166 275

Feature Viewer

pLDDT pTM Quality
90.88 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map