F268037

General Info

Members Datasets Scaffolds Average Seq Length
176 121 352 240

Family's Representative Sequence

Representative Sequence 3300006038|Ga0075365_10001978|Ga0075365_100019788
Length 264
Sequence MSVSTSGRLPTPLGIGRYASDVSLAGVVHPLLLGVDYLDPDWLLGHFGGAFIWVALAIVFVECGLFFPFLPGDTLLFALGLFIAGDKYTLFGIENRVAELVLSIGLLTFAAFLGNVAGYEIGRKIGPPLYKRDGRIMKRKYLDQTSAFFDKHGNKALVIGRFVPFVRTYITVVAGVTMMDRRRFFVWSAVGAALWVTSITLLGFFLGRKFPTLADNIDYAVLAILAFSIIPFVYEWVKHRRHSHKDGEPPVAPAPEPAEAADQL

Samples

Sample ID Description Type Environment
1 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
11 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
12 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
13 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
14 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
15 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
16 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
17 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
18 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
19 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
20 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
21 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
22 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
23 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
24 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
25 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
26 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
28 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
29 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
30 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
31 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
32 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
33 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
56 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
57 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
59 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
60 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
61 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
62 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
63 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
64 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
65 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
66 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
67 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
68 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
69 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
70 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
71 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
72 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
73 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
74 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
75 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
76 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
77 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
78 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
79 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
80 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
81 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
82 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
83 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
84 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
85 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
86 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
87 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
88 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
92 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
93 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
94 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
95 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
96 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
97 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
98 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
99 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
100 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
101 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
102 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
103 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
104 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
105 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
106 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
107 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
108 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
109 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
110 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
111 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
112 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
113 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
114 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
115 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
116 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
117 2643221641 Nocardioides sp. Root122 Isolate Unclassified
118 2739367898 Nocardioides sp. CF479 Isolate Unclassified
119 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
120 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
121 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.16
Metatranscriptomes 0
Isolates 2.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.16
Nodule 0.57
Rhizoplane 3.41
Rhizosphere 71.02
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075365_10001978 3300006038 Bacteria 9687
2 LJQas_1001054 3300000549 Bacteria 4203
3 Ga0070658_10078757 3300005327 Bacteria 2706
4 Ga0070658_10448430 3300005327 Bacteria 1111
5 Ga0070683_100708652 3300005329 Bacteria 964
6 Ga0070677_10142806 3300005333 Bacteria 1106
7 Ga0070660_100049479 3300005339 Bacteria 3231
8 Ga0070689_100201896 3300005340 Bacteria 1624
9 Ga0070659_100390320 3300005366 Bacteria 1174
10 Ga0070667_100114641 3300005367 Bacteria 2340
11 Ga0070663_100405160 3300005455 Bacteria 1116
12 Ga0068853_100036738 3300005539 Bacteria 4166
13 Ga0068853_100833449 3300005539 Bacteria 884
14 Ga0068855_100088021 3300005563 Bacteria 3588
15 Ga0068852_100127864 3300005616 Bacteria 2336
16 Ga0068864_100466053 3300005618 Bacteria 1210
17 Ga0068861_100075221 3300005719 Bacteria 2628
18 Ga0068858_100353257 3300005842 Bacteria 1408
19 Ga0068860_100000955 3300005843 Bacteria 31984
20 Ga0081539_10030893 3300005985 Bacteria 3313
21 Ga0075365_10014582 3300006038 Bacteria 4732
22 Ga0075365_10121671 3300006038 Bacteria 1801
23 Ga0075365_10129378 3300006038 Bacteria 1746
24 Ga0075368_10002863 3300006042 Bacteria 5696
25 Ga0075363_100003066 3300006048 Bacteria 7007
26 Ga0075363_100022579 3300006048 Bacteria 3182
27 Ga0075363_100061670 3300006048 Bacteria 2021
28 Ga0075363_100306825 3300006048 Bacteria 922
29 Ga0075364_10038921 3300006051 Bacteria 3082
30 Ga0075364_10208708 3300006051 Bacteria 1324
31 Ga0075432_10046485 3300006058 Bacteria 1524
32 Ga0075362_10070893 3300006177 Bacteria 1591
33 Ga0075367_10011779 3300006178 Bacteria 4641
34 Ga0075367_10016815 3300006178 Bacteria 4001
35 Ga0075367_10315097 3300006178 Bacteria 985
36 Ga0075370_10006196 3300006353 Bacteria 6002
37 Ga0111539_10068998 3300009094 Bacteria 4174
38 Ga0105243_10013547 3300009148 Bacteria 6169
39 Ga0105243_10119084 3300009148 Bacteria 2223
40 Ga0105243_10138980 3300009148 Bacteria 2070
41 Ga0105243_10381971 3300009148 Bacteria 1303
42 Ga0105241_10222420 3300009174 Bacteria 1588
43 Ga0105238_10249514 3300009551 Bacteria 1753
44 Ga0105239_10059493 3300010375 Bacteria 4193
45 Ga0105239_10093506 3300010375 Bacteria 3320
46 Ga0157370_10213966 3300013104 Bacteria 1786
47 Ga0163163_10064656 3300014325 Bacteria 3630
48 Ga0207697_10066154 3300025315 Bacteria 1510
49 Ga0207688_10018802 3300025901 Bacteria 3759
50 Ga0207647_10011224 3300025904 Bacteria 6290
51 Ga0207645_10412711 3300025907 Bacteria 909
52 Ga0207643_10002779 3300025908 Bacteria 9449
53 Ga0207705_10115986 3300025909 Bacteria 1982
54 Ga0207657_10052957 3300025919 Bacteria 3519
55 Ga0207659_10168196 3300025926 Bacteria 1727
56 Ga0207687_10110512 3300025927 Bacteria 2039
57 Ga0207690_10018106 3300025932 Bacteria 4316
58 Ga0207690_10532070 3300025932 Bacteria 954
59 Ga0207686_10348635 3300025934 Bacteria 1114
60 Ga0207709_10045796 3300025935 Bacteria 2651
61 Ga0207669_10038772 3300025937 Bacteria 2747
62 Ga0207704_10120856 3300025938 Bacteria 1792
63 Ga0207691_10001057 3300025940 Bacteria 27344
64 Ga0207667_10106668 3300025949 Bacteria 2890
65 Ga0207651_10347850 3300025960 Bacteria 1247
66 Ga0207640_10363360 3300025981 Bacteria 1167
67 Ga0207658_10072974 3300025986 Bacteria 2604
68 Ga0207678_10160048 3300026067 Bacteria 1923
69 Ga0207708_10000622 3300026075 Bacteria 27260
70 Ga0207708_10030272 3300026075 Bacteria 4104
71 Ga0207675_100076879 3300026118 Bacteria 3126
72 Ga0209813_10000915 3300027866 Bacteria 6639
73 Ga0209813_10006630 3300027866 Bacteria 2866
74 Ga0207428_10080150 3300027907 Bacteria 2551
75 Ga0268264_10000249 3300028381 Bacteria 101309
76 Ga0316181_1085546 3300030744 Bacteria 846
77 Ga0307408_100630930 3300031548 Bacteria 956
78 Ga0307410_10428576 3300031852 Bacteria 1074
79 Ga0307407_10020592 3300031903 Bacteria 3384
80 Ga0307412_10134285 3300031911 Bacteria 1803
81 Ga0307409_100220380 3300031995 Bacteria 1712
82 Ga0307409_100259461 3300031995 Bacteria 1594
83 Ga0307409_100788262 3300031995 Bacteria 957
84 Ga0307416_100034099 3300032002 Bacteria 3869
85 Ga0307416_100052398 3300032002 Bacteria 3267
86 Ga0307416_100823560 3300032002 Bacteria 1025
87 Ga0307416_101079863 3300032002 Bacteria 907
88 Ga0307414_10097243 3300032004 Bacteria 2205
89 Ga0307414_10635128 3300032004 Bacteria 961
90 Ga0307411_10301708 3300032005 Bacteria 1285
91 Ga0307415_100093208 3300032126 Bacteria 2186
92 Ga0395900_0132892 3300037418 Bacteria 2550
93 Ga0451797_0923978 3300041453 Bacteria 1003
94 Ga0451853_1841444 3300041512 Bacteria 1037
95 Ga0450907_003945 3300042146 Bacteria 2587
96 Ga0439434_0028204 3300042435 Bacteria 1699
97 Ga0466972_0056672 3300044658 Bacteria 1884
98 Ga0466972_0098065 3300044658 Bacteria 1388
99 Ga0466965_0020849 3300044683 Bacteria 3154
100 Ga0466965_0054835 3300044683 Bacteria 1983
101 Ga0466966_0027499 3300044684 Bacteria 3709
102 Ga0466966_0190399 3300044684 Bacteria 1243
103 Ga0466961_0167285 3300044693 Bacteria 1368
104 Ga0466963_0061348 3300044694 Bacteria 2513
105 Ga0466963_0077856 3300044694 Bacteria 2241
106 Ga0466964_0007558 3300044706 Bacteria 4066
107 Ga0466971_0065888 3300044719 Bacteria 1640
108 Ga0466970_0026233 3300044765 Bacteria 3054
109 Ga0466970_0042684 3300044765 Bacteria 2412
110 Ga0466957_0026927 3300044842 Bacteria 3413
111 Ga0466960_0000259 3300044901 Bacteria 18187
112 Ga0466960_0028504 3300044901 Bacteria 2555
113 Ga0466960_0083732 3300044901 Bacteria 1612
114 Ga0466967_0031925 3300045976 Bacteria 4440
115 Ga0466967_0365459 3300045976 Bacteria 1399
116 Ga0495586_0192660 3300046535 Bacteria 1155
117 Ga0496108_0200433 3300048911 Bacteria 1732
118 Ga0496110_0016003 3300048913 Bacteria 6255
119 Ga0496114_0006400 3300048917 Bacteria 9276
120 Ga0496114_0250105 3300048917 Bacteria 1560
121 Ga0496114_0542402 3300048917 Bacteria 1028
122 Ga0501031_0025121 3300049568 Bacteria 3886
123 Ga0501031_0053368 3300049568 Bacteria 2634
124 Ga0501031_0201749 3300049568 Bacteria 1298
125 Ga0501032_0526476 3300049569 Bacteria 754
126 Ga0501034_0309088 3300049571 Bacteria 1516
127 Ga0501034_0314518 3300049571 Bacteria 1500
128 Ga0501036_0036291 3300049572 Bacteria 4171
129 Ga0501036_0065341 3300049572 Bacteria 3080
130 Ga0501036_0079085 3300049572 Bacteria 2782
131 Ga0501039_0019658 3300049575 Bacteria 5179
132 Ga0501039_0038815 3300049575 Bacteria 3677
133 Ga0501068_0211981 3300049584 Bacteria 1230
134 Ga0501070_0238303 3300049586 Bacteria 1489
135 Ga0501071_0039966 3300049587 Bacteria 3357
136 Ga0501071_0262789 3300049587 Bacteria 1304
137 Ga0501072_0050360 3300049588 Bacteria 3279
138 Ga0501072_0386894 3300049588 Bacteria 1110
139 Ga0501077_0208721 3300049593 Bacteria 1241
140 Ga0501079_0227350 3300049741 Bacteria 1458
141 Ga0501080_0318307 3300049742 Bacteria 1409
142 Ga0501035_0268440 3300049822 Bacteria 1445
143 Ga0501045_0015860 3300049824 Bacteria 5344
144 Ga0501045_0094762 3300049824 Bacteria 2208
145 nmdc:mga03683_125398_c1 3300050489 Bacteria 1145
146 nmdc:mga03n38_16791_c1 3300050490 Bacteria 2856
147 nmdc:mga03n38_21766_c1 3300050490 Bacteria 2585
148 nmdc:mga03n38_47720_c1 3300050490 Bacteria 1897
149 nmdc:mga00v17_116098_c1 3300050491 Bacteria 1701
150 nmdc:mga00v17_180938_c1 3300050491 Bacteria 1360
151 nmdc:mga00v17_215535_c1 3300050491 Bacteria 1243
152 nmdc:mga00v17_295392_c1 3300050491 Bacteria 1052
153 nmdc:mga0yw44_123471_c1 3300050492 Bacteria 1670
154 nmdc:mga0yw44_18584_c1 3300050492 Bacteria 3812
155 nmdc:mga0yw44_192716_c1 3300050492 Bacteria 1345
156 nmdc:mga0yw44_1955_c1 3300050492 Bacteria 8542
157 nmdc:mga0yw44_457781_c1 3300050492 Bacteria 865
158 nmdc:mga0yw44_4678_c1 3300050492 Bacteria 6327
159 nmdc:mga0yw44_52863_c1 3300050492 Bacteria 2464
160 nmdc:mga06z11_1366_c1 3300050494 Bacteria 9033
161 nmdc:mga06z11_23287_c1 3300050494 Bacteria 2907
162 nmdc:mga04h51_965_c1 3300050495 Bacteria 6639
163 nmdc:mga07m45_13900_c1 3300050496 Bacteria 4279
164 nmdc:mga08y16_176909_c1 3300050511 Bacteria 2216
165 nmdc:mga0sz30_11033_c1 3300050516 Bacteria 3475
166 Ga0495619_0109826 3300053085 Bacteria 1884
167 Ga0500644_0000201 3300053088 Bacteria 36319
168 Ga0501084_0047176 3300054114 Bacteria 3608
169 Ga0501082_0073382 3300060353 Bacteria 2948
170 Ga0466962_0026882 3300061719 Bacteria 2762
171 Ga0530510_0025380 3300061734 Bacteria 4237
172 2644228338 2643221641 Bacteria 4490190
173 2740165851 2739367898 Bacteria 4367674
174 2855388798 2855386786 Bacteria 4752232
175 2857486207 2857481737 Bacteria 4761446
176 8054609657 8054609563 Bacteria 5170090
177 Ga0075365_10001978
178 LJQas_1001054
179 Ga0070658_10078757
180 Ga0070658_10448430
181 Ga0070683_100708652
182 Ga0070677_10142806
183 Ga0070660_100049479
184 Ga0070689_100201896
185 Ga0070659_100390320
186 Ga0070667_100114641
187 Ga0070663_100405160
188 Ga0068853_100036738
189 Ga0068853_100833449
190 Ga0068855_100088021
191 Ga0068852_100127864
192 Ga0068864_100466053
193 Ga0068861_100075221
194 Ga0068858_100353257
195 Ga0068860_100000955
196 Ga0081539_10030893
197 Ga0075365_10014582
198 Ga0075365_10121671
199 Ga0075365_10129378
200 Ga0075368_10002863
201 Ga0075363_100003066
202 Ga0075363_100022579
203 Ga0075363_100061670
204 Ga0075363_100306825
205 Ga0075364_10038921
206 Ga0075364_10208708
207 Ga0075432_10046485
208 Ga0075362_10070893
209 Ga0075367_10011779
210 Ga0075367_10016815
211 Ga0075367_10315097
212 Ga0075370_10006196
213 Ga0111539_10068998
214 Ga0105243_10013547
215 Ga0105243_10119084
216 Ga0105243_10138980
217 Ga0105243_10381971
218 Ga0105241_10222420
219 Ga0105238_10249514
220 Ga0105239_10059493
221 Ga0105239_10093506
222 Ga0157370_10213966
223 Ga0163163_10064656
224 Ga0207697_10066154
225 Ga0207688_10018802
226 Ga0207647_10011224
227 Ga0207645_10412711
228 Ga0207643_10002779
229 Ga0207705_10115986
230 Ga0207657_10052957
231 Ga0207659_10168196
232 Ga0207687_10110512
233 Ga0207690_10018106
234 Ga0207690_10532070
235 Ga0207686_10348635
236 Ga0207709_10045796
237 Ga0207669_10038772
238 Ga0207704_10120856
239 Ga0207691_10001057
240 Ga0207667_10106668
241 Ga0207651_10347850
242 Ga0207640_10363360
243 Ga0207658_10072974
244 Ga0207678_10160048
245 Ga0207708_10000622
246 Ga0207708_10030272
247 Ga0207675_100076879
248 Ga0209813_10000915
249 Ga0209813_10006630
250 Ga0207428_10080150
251 Ga0268264_10000249
252 Ga0316181_1085546
253 Ga0307408_100630930
254 Ga0307410_10428576
255 Ga0307407_10020592
256 Ga0307412_10134285
257 Ga0307409_100220380
258 Ga0307409_100259461
259 Ga0307409_100788262
260 Ga0307416_100034099
261 Ga0307416_100052398
262 Ga0307416_100823560
263 Ga0307416_101079863
264 Ga0307414_10097243
265 Ga0307414_10635128
266 Ga0307411_10301708
267 Ga0307415_100093208
268 Ga0395900_0132892
269 Ga0451797_0923978
270 Ga0451853_1841444
271 Ga0450907_003945
272 Ga0439434_0028204
273 Ga0466972_0056672
274 Ga0466972_0098065
275 Ga0466965_0020849
276 Ga0466965_0054835
277 Ga0466966_0027499
278 Ga0466966_0190399
279 Ga0466961_0167285
280 Ga0466963_0061348
281 Ga0466963_0077856
282 Ga0466964_0007558
283 Ga0466971_0065888
284 Ga0466970_0026233
285 Ga0466970_0042684
286 Ga0466957_0026927
287 Ga0466960_0000259
288 Ga0466960_0028504
289 Ga0466960_0083732
290 Ga0466967_0031925
291 Ga0466967_0365459
292 Ga0495586_0192660
293 Ga0496108_0200433
294 Ga0496110_0016003
295 Ga0496114_0006400
296 Ga0496114_0250105
297 Ga0496114_0542402
298 Ga0501031_0025121
299 Ga0501031_0053368
300 Ga0501031_0201749
301 Ga0501032_0526476
302 Ga0501034_0309088
303 Ga0501034_0314518
304 Ga0501036_0036291
305 Ga0501036_0065341
306 Ga0501036_0079085
307 Ga0501039_0019658
308 Ga0501039_0038815
309 Ga0501068_0211981
310 Ga0501070_0238303
311 Ga0501071_0039966
312 Ga0501071_0262789
313 Ga0501072_0050360
314 Ga0501072_0386894
315 Ga0501077_0208721
316 Ga0501079_0227350
317 Ga0501080_0318307
318 Ga0501035_0268440
319 Ga0501045_0015860
320 Ga0501045_0094762
321 nmdc:mga03683_125398_c1
322 nmdc:mga03n38_16791_c1
323 nmdc:mga03n38_21766_c1
324 nmdc:mga03n38_47720_c1
325 nmdc:mga00v17_116098_c1
326 nmdc:mga00v17_180938_c1
327 nmdc:mga00v17_215535_c1
328 nmdc:mga00v17_295392_c1
329 nmdc:mga0yw44_123471_c1
330 nmdc:mga0yw44_18584_c1
331 nmdc:mga0yw44_192716_c1
332 nmdc:mga0yw44_1955_c1
333 nmdc:mga0yw44_457781_c1
334 nmdc:mga0yw44_4678_c1
335 nmdc:mga0yw44_52863_c1
336 nmdc:mga06z11_1366_c1
337 nmdc:mga06z11_23287_c1
338 nmdc:mga04h51_965_c1
339 nmdc:mga07m45_13900_c1
340 nmdc:mga08y16_176909_c1
341 nmdc:mga0sz30_11033_c1
342 Ga0495619_0109826
343 Ga0500644_0000201
344 Ga0501084_0047176
345 Ga0501082_0073382
346 Ga0466962_0026882
347 Ga0530510_0025380
348 2644228338
349 2740165851
350 2855388798
351 2857486207
352 8054609657

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09335

VTT_dom

VTT domain

70

205

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
8j7w-assembly1.cif.gz_B cryo-em structure of hznt7-fab complex in zinc state 2, determined in heterogeneous conformations- one subunit in an inward-facing zinc-bound and the other in an outward-facing zinc-bound conformation 0.3112 37 192
7xgg-assembly2.cif.gz_D crystal structure of bcl-xl in complex with computationally designed inhibitor protein 0.3071 25 184
3te1-assembly1.cif.gz_B crystal structure of hsc t84a 0.3044 9 204
6s37-assembly1.cif.gz_B ligand binding domain of the p. putida receptor pcay_pp in complex with salicylic acid 0.3009 35 190
7pmw-assembly1.cif.gz_A hspept1 bound to ala-phe in the outward facing occluded conformation 0.2995 5 195
ID Description Score Start End Superfamily
af_P76352_330_491_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4176 7 215 1.20.1250.20
af_A0A0R0I6A5_242_405_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4136 8 218 1.20.1250.20
af_A0A1D6H4R6_249_412_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4094 10 218 1.20.1250.20
af_P76352_330_491_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4088 7 215 1.20.1250.20
af_A0A0R0I6A5_242_405_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3967 8 218 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A2G6HEZ8-F1-model_v4 VTT domain-containing protein 0.922 23 193 GO:0005886
AF-A0A6J6U9E9-F1-model_v4 Unannotated protein 0.9196 16 226 GO:0005886
AF-A0A150WSZ7-F1-model_v4 VTT domain-containing protein 0.9084 30 230 GO:0005886
AF-A0A365VMJ1-F1-model_v4 deleted 0.9059 37 189
AF-A0A495MXX8-F1-model_v4 deleted 0.9047 19 228

Map