F267863

General Info

Members Datasets Scaffolds Average Seq Length
176 112 176 94

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_100040801|Ga0070707_1000408012
Length 102
Sequence MKSTRKPRKPMPAEAIARLADQGSDVSRFFTNTGRMMLPGPIRRVNVDLASGMLEELDRAAKELNISRQAVIKTLIRQALDQQYRIRGMQRAKRSGKNIGRR

Samples

Sample ID Description Type Environment
1 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
4 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
5 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
24 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
25 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
26 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
27 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
28 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
30 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
31 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
32 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
35 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
36 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
39 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
40 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
43 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
44 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
45 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
46 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
68 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
69 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
70 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
71 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
72 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
73 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
74 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
75 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
76 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
77 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
78 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
79 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
80 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
81 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
82 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
83 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
84 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
85 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
86 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
87 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
88 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
89 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
90 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
91 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
92 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
93 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
94 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
95 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
96 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
97 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
98 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
99 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
100 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
101 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
102 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
103 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
104 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
105 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
106 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
107 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
108 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
109 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
110 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
111 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
112 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.73
Metatranscriptomes 2.27
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.14
Rhizosphere 96.59
Stem 0
Stem Tuber 0
Unclassified 2.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1000544 3300000546 Bacteria 6521
2 rootH2_10328375 3300003320 Unclassified 1476
3 Ga0068868_100646175 3300005338 Bacteria 941
4 Ga0070667_102216339 3300005367 Unclassified 517
5 Ga0070709_10511537 3300005434 Bacteria 914
6 Ga0070714_101063440 3300005435 Unclassified 788
7 Ga0070713_100026222 3300005436 Bacteria 4572
8 Ga0070713_100146946 3300005436 Bacteria 2093
9 Ga0070713_101500094 3300005436 Unclassified 654
10 Ga0070713_102471545 3300005436 Unclassified 502
11 Ga0070710_10026453 3300005437 Bacteria 3083
12 Ga0070711_100329738 3300005439 Unclassified 1221
13 Ga0070708_100030076 3300005445 Bacteria 4691
14 Ga0070708_100215576 3300005445 Bacteria 1799
15 Ga0070708_100725049 3300005445 Bacteria 935
16 Ga0070708_100774824 3300005445 Unclassified 902
17 Ga0070706_100005038 3300005467 Bacteria 12628
18 Ga0070706_100010946 3300005467 Bacteria 8423
19 Ga0070706_100252637 3300005467 Unclassified 1646
20 Ga0070706_100480195 3300005467 Unclassified 1156
21 Ga0070706_101068229 3300005467 Bacteria 743
22 Ga0070707_100014017 3300005468 Bacteria 7512
23 Ga0070707_100040801 3300005468 Bacteria 4441
24 Ga0070707_100100986 3300005468 Bacteria 2795
25 Ga0070707_100264924 3300005468 Bacteria 1671
26 Ga0070707_100471995 3300005468 Bacteria 1216
27 Ga0070698_100006713 3300005471 Bacteria 12484
28 Ga0070698_100078428 3300005471 Bacteria 3301
29 Ga0070699_100022642 3300005518 Bacteria 5416
30 Ga0070699_100098307 3300005518 Bacteria 2564
31 Ga0070699_100500422 3300005518 Bacteria 1104
32 Ga0070684_101494724 3300005535 Bacteria 636
33 Ga0070697_100199118 3300005536 Bacteria 1702
34 Ga0070697_100201875 3300005536 Unclassified 1690
35 Ga0068853_102253030 3300005539 Unclassified 528
36 Ga0070665_100147663 3300005548 Bacteria 2354
37 Ga0068855_100067507 3300005563 Unclassified 4165
38 Ga0068855_101319596 3300005563 Bacteria 746
39 Ga0068854_100129315 3300005578 Bacteria 1926
40 Ga0068856_100294577 3300005614 Bacteria 1640
41 Ga0068864_102085846 3300005618 Unclassified 573
42 Ga0068851_10053398 3300005834 Unclassified 2057
43 Ga0070717_10010807 3300006028 Bacteria 6905
44 Ga0070717_10015587 3300006028 Bacteria 5873
45 Ga0070717_10521051 3300006028 Unclassified 1075
46 Ga0070717_10937972 3300006028 Unclassified 788
47 Ga0070717_11121122 3300006028 Unclassified 716
48 Ga0070715_10047674 3300006163 Bacteria 1828
49 Ga0070715_10327437 3300006163 Unclassified 829
50 Ga0070716_100131286 3300006173 Bacteria 1584
51 Ga0070716_100184899 3300006173 Bacteria 1372
52 Ga0070716_100728042 3300006173 Unclassified 761
53 Ga0070716_100951233 3300006173 Bacteria 676
54 Ga0070712_100503352 3300006175 Bacteria 1016
55 Ga0070712_101729261 3300006175 Unclassified 547
56 Ga0097621_100473496 3300006237 Bacteria 1131
57 Ga0075434_100226201 3300006871 Unclassified 1890
58 Ga0075434_100816122 3300006871 Bacteria 949
59 Ga0075436_100206219 3300006914 Bacteria 1393
60 Ga0075436_100238962 3300006914 Bacteria 1292
61 Ga0075435_100843130 3300007076 Unclassified 798
62 Ga0099794_10012220 3300007265 Bacteria 3696
63 Ga0099794_10082632 3300007265 Bacteria 1586
64 Ga0099794_10381896 3300007265 Unclassified 735
65 Ga0099794_10727186 3300007265 Unclassified 529
66 Ga0105240_10177599 3300009093 Bacteria 2516
67 Ga0105248_12192193 3300009177 Unclassified 629
68 Ga0105238_10514385 3300009551 Bacteria 1199
69 Ga0105238_11677090 3300009551 Unclassified 666
70 Ga0105249_10841798 3300009553 Unclassified 983
71 Ga0105239_12962815 3300010375 Unclassified 554
72 Ga0157369_10028191 3300013105 Bacteria 6215
73 Ga0157369_10036968 3300013105 Bacteria 5349
74 Ga0157374_10605327 3300013296 Unclassified 1106
75 Ga0157374_10800367 3300013296 Unclassified 958
76 Ga0157378_10009073 3300013297 Bacteria 8657
77 Ga0157375_13450349 3300013308 Unclassified 526
78 Ga0157376_10012543 3300014969 Bacteria 6293
79 Ga0213872_10140451 3300021361 Bacteria 1060
80 Ga0224572_1003076 3300024225 Bacteria 2782
81 Ga0228598_1000021 3300024227 Bacteria 22072
82 Ga0228598_1077096 3300024227 Unclassified 668
83 Ga0207692_10359276 3300025898 Unclassified 900
84 Ga0207685_10040347 3300025905 Bacteria 1739
85 Ga0207699_10513240 3300025906 Unclassified 866
86 Ga0207684_10013482 3300025910 Bacteria 7071
87 Ga0207684_10034830 3300025910 Unclassified 4276
88 Ga0207684_10187731 3300025910 Bacteria 1782
89 Ga0207684_10222614 3300025910 Bacteria 1628
90 Ga0207684_10475693 3300025910 Unclassified 1072
91 Ga0207695_10630813 3300025913 Bacteria 953
92 Ga0207693_10047011 3300025915 Bacteria 3391
93 Ga0207693_10092212 3300025915 Bacteria 2374
94 Ga0207663_11335934 3300025916 Unclassified 577
95 Ga0207646_10000224 3300025922 Bacteria 77511
96 Ga0207646_10008287 3300025922 Bacteria 10432
97 Ga0207646_10097435 3300025922 Bacteria 2635
98 Ga0207646_10377871 3300025922 Bacteria 1280
99 Ga0207646_10398737 3300025922 Unclassified 1243
100 Ga0207646_10824872 3300025922 Unclassified 825
101 Ga0207700_10417190 3300025928 Unclassified 1178
102 Ga0207700_10854051 3300025928 Unclassified 814
103 Ga0207700_11212354 3300025928 Unclassified 673
104 Ga0207664_10658719 3300025929 Unclassified 941
105 Ga0207665_10008721 3300025939 Bacteria 6669
106 Ga0207665_10092285 3300025939 Unclassified 2100
107 Ga0207665_10177642 3300025939 Bacteria 1540
108 Ga0207665_10241197 3300025939 Bacteria 1332
109 Ga0207665_11053004 3300025939 Bacteria 648
110 Ga0207711_10863837 3300025941 Bacteria 842
111 Ga0207661_10116894 3300025944 Bacteria 2264
112 Ga0207667_10416629 3300025949 Unclassified 1367
113 Ga0207667_11468543 3300025949 Unclassified 654
114 Ga0207640_10109166 3300025981 Bacteria 1957
115 Ga0207677_10530872 3300026023 Bacteria 1022
116 Ga0207639_11305055 3300026041 Bacteria 681
117 Ga0207698_11006530 3300026142 Bacteria 844
118 Ga0209588_1046082 3300027671 Bacteria 1410
119 Ga0209588_1155716 3300027671 Unclassified 723
120 Ga0268266_10824100 3300028379 Bacteria 896
121 Ga0268264_10057960 3300028381 Bacteria 3241
122 Ga0265319_1261794 3300028563 Unclassified 527
123 Ga0265760_10041268 3300031090 Unclassified 1375
124 Ga0265760_10106317 3300031090 Bacteria 891
125 Ga0265760_10232373 3300031090 Unclassified 632
126 Ga0265320_10065527 3300031240 Bacteria 1724
127 Ga0265329_10115601 3300031242 Unclassified 859
128 Ga0265340_10333038 3300031247 Unclassified 671
129 Ga0265331_10580876 3300031250 Unclassified 506
130 Ga0265316_10968584 3300031344 Unclassified 593
131 Ga0373926_0010941 3300035083 Bacteria 3046
132 Ga0373923_0467981 3300035111 Unclassified 612
133 Ga0373954_0000077 3300035118 Bacteria 34839
134 Ga0373956_0108449 3300035119 Bacteria 1291
135 Ga0373956_0220150 3300035119 Viruses 901
136 Ga0373957_0011212 3300035120 Bacteria 2985
137 Ga0373955_0008432 3300035172 Bacteria 4787
138 Ga0373924_0220846 3300035410 Unclassified 837
139 Ga0373927_0012229 3300035695 Bacteria 5709
140 Ga0373937_0394707 3300036401 Unclassified 1312
141 Ga0373937_0517589 3300036401 Bacteria 1134
142 Ga0373937_1515610 3300036401 Unclassified 618
143 Ga0373925_0017606 3300037068 Bacteria 5183
144 Ga0373925_0543986 3300037068 Unclassified 955
145 Ga0400483_092428 3300039062 Bacteria 2349
146 Ga0400489_55386 3300039093 Bacteria 9002
147 Ga0436360_0321856 3300039438 Bacteria 1519
148 Ga0436361_0072831 3300039447 Bacteria 1085
149 Ga0436361_1037627 3300039447 Bacteria 1074
150 Ga0436363_1126979 3300039450 Bacteria 6834
151 Ga0436362_1167843 3300039453 Unclassified 658
152 Ga0451807_0197871 3300041486 Unclassified 779
153 Ga0466966_0040026 3300044684 Bacteria 3017
154 Ga0466966_0995656 3300044684 Bacteria 506
155 Ga0466963_1279045 3300044694 Bacteria 515
156 Ga0466967_0213610 3300045976 Bacteria 1830
157 Ga0495653_0264652 3300046463 Bacteria 1135
158 Ga0495580_0000603 3300046472 Bacteria 30353
159 Ga0495582_0492947 3300046473 Unclassified 708
160 Ga0495628_0021665 3300046516 Bacteria 5283
161 Ga0495630_1493899 3300046517 Unclassified 507
162 Ga0495666_0150007 3300046526 Bacteria 1084
163 Ga0495665_0116127 3300046531 Bacteria 1402
164 Ga0495623_0016117 3300046679 Bacteria 4829
165 Ga0495581_0681836 3300047315 Unclassified 593
166 Ga0495604_0023830 3300047317 Bacteria 4885
167 Ga0495672_0003912 3300047320 Bacteria 12502
168 Ga0495684_0032373 3300047471 Bacteria 4014
169 Ga0495602_0007881 3300048088 Bacteria 11134
170 Ga0496114_1611500 3300048917 Unclassified 537
171 nmdc:mga0n895_1079523_c1 3300050512 Unclassified 781
172 nmdc:mga0rr50_271011_c1 3300050513 Unclassified 1415
173 nmdc:mga08x19_193341_c1 3300050514 Bacteria 1393
174 nmdc:mga08x19_449407_c1 3300050514 Unclassified 907
175 Ga0495619_0994748 3300053085 Unclassified 561
176 Ga0587111_0193247 3300060346 Bacteria 573

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005467 Ga0070706_100252637 Ga0070706_1002526371 88
2 3300039062 Ga0400483_092428 Ga0400483_092428_934_1200 88
3 3300039093 Ga0400489_55386 Ga0400489_55386_7176_7442 88
4 3300005435 Ga0070714_101063440 Ga0070714_1010634401 89
5 3300025941 Ga0207711_10863837 Ga0207711_108638372 89
6 3300031242 Ga0265329_10115601 Ga0265329_101156012 89
7 3300031344 Ga0265316_10968584 Ga0265316_109685842 89
8 3300005548 Ga0070665_100147663 Ga0070665_1001476632 90
9 3300005563 Ga0068855_101319596 Ga0068855_1013195962 90
10 3300006163 Ga0070715_10327437 Ga0070715_103274372 90
11 3300006173 Ga0070716_100728042 Ga0070716_1007280422 90
12 3300009093 Ga0105240_10177599 Ga0105240_101775992 90
13 3300009551 Ga0105238_11677090 Ga0105238_116770901 90
14 3300009553 Ga0105249_10841798 Ga0105249_108417981 90
15 3300010375 Ga0105239_12962815 Ga0105239_129628151 90
16 3300025913 Ga0207695_10630813 Ga0207695_106308131 90
17 3300025939 Ga0207665_10092285 Ga0207665_100922853 90
18 3300025949 Ga0207667_11468543 Ga0207667_114685431 90
19 3300028379 Ga0268266_10824100 Ga0268266_108241002 90
20 3300028563 Ga0265319_1261794 Ga0265319_12617942 90
21 3300031240 Ga0265320_10065527 Ga0265320_100655272 90
22 3300047320 Ga0495672_0003912 Ga0495672_0003912_171_443 90
23 3300031090 Ga0265760_10232373 Ga0265760_102323731 91
24 3300035083 Ga0373926_0010941 Ga0373926_0010941_454_729 91
25 3300035695 Ga0373927_0012229 Ga0373927_0012229_1828_2103 91
26 3300037068 Ga0373925_0017606 Ga0373925_0017606_2128_2403 91
27 3300046526 Ga0495666_0150007 Ga0495666_0150007_690_965 91
28 3300005445 Ga0070708_100725049 Ga0070708_1007250492 92
29 3300005445 Ga0070708_100774824 Ga0070708_1007748242 92
30 3300005468 Ga0070707_100471995 Ga0070707_1004719952 92
31 3300005518 Ga0070699_100098307 Ga0070699_1000983073 92
32 3300009177 Ga0105248_12192193 Ga0105248_121921932 92
33 3300013297 Ga0157378_10009073 Ga0157378_100090731 92
34 3300013308 Ga0157375_13450349 Ga0157375_134503491 92
35 3300024227 Ga0228598_1077096 Ga0228598_10770961 92
36 3300025922 Ga0207646_10377871 Ga0207646_103778712 92
37 3300035111 Ga0373923_0467981 Ga0373923_0467981_134_412 92
38 3300036401 Ga0373937_0517589 Ga0373937_0517589_274_552 92
39 3300039438 Ga0436360_0321856 Ga0436360_0321856_597_875 92
40 3300039447 Ga0436361_1037627 Ga0436361_1037627_237_515 92
41 3300039453 Ga0436362_1167843 Ga0436362_1167843_57_335 92
42 3300046517 Ga0495630_1493899 Ga0495630_1493899_57_335 92
43 3300005367 Ga0070667_102216339 Ga0070667_1022163391 93
44 3300005434 Ga0070709_10511537 Ga0070709_105115371 93
45 3300005436 Ga0070713_100146946 Ga0070713_1001469462 93
46 3300005437 Ga0070710_10026453 Ga0070710_100264533 93
47 3300005439 Ga0070711_100329738 Ga0070711_1003297383 93
48 3300005445 Ga0070708_100030076 Ga0070708_1000300765 93
49 3300005467 Ga0070706_100480195 Ga0070706_1004801951 93
50 3300005468 Ga0070707_100100986 Ga0070707_1001009862 93
51 3300005563 Ga0068855_100067507 Ga0068855_1000675072 93
52 3300005614 Ga0068856_100294577 Ga0068856_1002945771 93
53 3300005618 Ga0068864_102085846 Ga0068864_1020858461 93
54 3300006028 Ga0070717_10937972 Ga0070717_109379721 93
55 3300006028 Ga0070717_11121122 Ga0070717_111211222 93
56 3300006163 Ga0070715_10047674 Ga0070715_100476742 93
57 3300006173 Ga0070716_100951233 Ga0070716_1009512331 93
58 3300006175 Ga0070712_101729261 Ga0070712_1017292612 93
59 3300013105 Ga0157369_10036968 Ga0157369_100369682 93
60 3300021361 Ga0213872_10140451 Ga0213872_101404512 93
61 3300024225 Ga0224572_1003076 Ga0224572_10030762 93
62 3300024227 Ga0228598_1000021 Ga0228598_10000214 93
63 3300025898 Ga0207692_10359276 Ga0207692_103592761 93
64 3300025905 Ga0207685_10040347 Ga0207685_100403472 93
65 3300025906 Ga0207699_10513240 Ga0207699_105132401 93
66 3300025910 Ga0207684_10475693 Ga0207684_104756931 93
67 3300025915 Ga0207693_10047011 Ga0207693_100470113 93
68 3300025916 Ga0207663_11335934 Ga0207663_113359341 93
69 3300025922 Ga0207646_10097435 Ga0207646_100974352 93
70 3300025928 Ga0207700_11212354 Ga0207700_112123541 93
71 3300025929 Ga0207664_10658719 Ga0207664_106587193 93
72 3300025939 Ga0207665_10008721 Ga0207665_100087213 93
73 3300025939 Ga0207665_11053004 Ga0207665_110530042 93
74 3300025949 Ga0207667_10416629 Ga0207667_104166292 93
75 3300037068 Ga0373925_0543986 Ga0373925_0543986_446_727 93
76 3300039447 Ga0436361_0072831 Ga0436361_0072831_619_900 93
77 3300044694 Ga0466963_1279045 Ga0466963_1279045_147_428 93
78 3300045976 Ga0466967_0213610 Ga0466967_0213610_1390_1671 93
79 3300046472 Ga0495580_0000603 Ga0495580_0000603_22797_23078 93
80 3300046473 Ga0495582_0492947 Ga0495582_0492947_64_345 93
81 3300046531 Ga0495665_0116127 Ga0495665_0116127_1019_1300 93
82 3300047315 Ga0495581_0681836 Ga0495581_0681836_68_349 93
83 3300060346 Ga0587111_0193247 Ga0587111_0193247_23_304 93
84 3300003320 rootH2_10328375 rootH2_103283752 94
85 3300005338 Ga0068868_100646175 Ga0068868_1006461751 94
86 3300005436 Ga0070713_100026222 Ga0070713_1000262223 94
87 3300005436 Ga0070713_101500094 Ga0070713_1015000941 94
88 3300005436 Ga0070713_102471545 Ga0070713_1024715452 94
89 3300005445 Ga0070708_100215576 Ga0070708_1002155763 94
90 3300005467 Ga0070706_100005038 Ga0070706_10000503816 94
91 3300005467 Ga0070706_100010946 Ga0070706_1000109461 94
92 3300005467 Ga0070706_101068229 Ga0070706_1010682292 94
93 3300005468 Ga0070707_100014017 Ga0070707_1000140179 94
94 3300005468 Ga0070707_100264924 Ga0070707_1002649243 94
95 3300005471 Ga0070698_100006713 Ga0070698_10000671314 94
96 3300005471 Ga0070698_100078428 Ga0070698_1000784283 94
97 3300005518 Ga0070699_100022642 Ga0070699_1000226423 94
98 3300005535 Ga0070684_101494724 Ga0070684_1014947241 94
99 3300005536 Ga0070697_100199118 Ga0070697_1001991183 94
100 3300005536 Ga0070697_100201875 Ga0070697_1002018753 94
101 3300005539 Ga0068853_102253030 Ga0068853_1022530302 94
102 3300005578 Ga0068854_100129315 Ga0068854_1001293152 94
103 3300005834 Ga0068851_10053398 Ga0068851_100533982 94
104 3300006028 Ga0070717_10010807 Ga0070717_100108079 94
105 3300006028 Ga0070717_10521051 Ga0070717_105210512 94
106 3300006173 Ga0070716_100131286 Ga0070716_1001312862 94
107 3300006173 Ga0070716_100184899 Ga0070716_1001848992 94
108 3300006175 Ga0070712_100503352 Ga0070712_1005033522 94
109 3300006237 Ga0097621_100473496 Ga0097621_1004734962 94
110 3300006871 Ga0075434_100816122 Ga0075434_1008161221 94
111 3300006914 Ga0075436_100206219 Ga0075436_1002062191 94
112 3300006914 Ga0075436_100238962 Ga0075436_1002389622 94
113 3300007076 Ga0075435_100843130 Ga0075435_1008431301 94
114 3300007265 Ga0099794_10012220 Ga0099794_100122206 94
115 3300007265 Ga0099794_10082632 Ga0099794_100826322 94
116 3300007265 Ga0099794_10381896 Ga0099794_103818962 94
117 3300007265 Ga0099794_10727186 Ga0099794_107271861 94
118 3300009551 Ga0105238_10514385 Ga0105238_105143852 94
119 3300013105 Ga0157369_10028191 Ga0157369_100281912 94
120 3300013296 Ga0157374_10800367 Ga0157374_108003671 94
121 3300014969 Ga0157376_10012543 Ga0157376_100125432 94
122 3300025910 Ga0207684_10013482 Ga0207684_100134828 94
123 3300025910 Ga0207684_10187731 Ga0207684_101877314 94
124 3300025910 Ga0207684_10222614 Ga0207684_102226142 94
125 3300025915 Ga0207693_10092212 Ga0207693_100922124 94
126 3300025922 Ga0207646_10000224 Ga0207646_1000022447 94
127 3300025922 Ga0207646_10008287 Ga0207646_100082876 94
128 3300025928 Ga0207700_10417190 Ga0207700_104171902 94
129 3300025928 Ga0207700_10854051 Ga0207700_108540512 94
130 3300025939 Ga0207665_10177642 Ga0207665_101776422 94
131 3300025939 Ga0207665_10241197 Ga0207665_102411973 94
132 3300025944 Ga0207661_10116894 Ga0207661_101168941 94
133 3300025981 Ga0207640_10109166 Ga0207640_101091662 94
134 3300026023 Ga0207677_10530872 Ga0207677_105308721 94
135 3300026041 Ga0207639_11305055 Ga0207639_113050552 94
136 3300026142 Ga0207698_11006530 Ga0207698_110065302 94
137 3300027671 Ga0209588_1046082 Ga0209588_10460822 94
138 3300027671 Ga0209588_1155716 Ga0209588_11557161 94
139 3300028381 Ga0268264_10057960 Ga0268264_100579602 94
140 3300031090 Ga0265760_10106317 Ga0265760_101063173 94
141 3300031247 Ga0265340_10333038 Ga0265340_103330382 94
142 3300031250 Ga0265331_10580876 Ga0265331_105808762 94
143 3300035119 Ga0373956_0220150 Ga0373956_0220150_123_407 94
144 3300036401 Ga0373937_1515610 Ga0373937_1515610_230_520 94
145 3300039450 Ga0436363_1126979 Ga0436363_1126979_5453_5737 94
146 3300041486 Ga0451807_0197871 Ga0451807_0197871_409_696 94
147 3300044684 Ga0466966_0040026 Ga0466966_0040026_881_1165 94
148 3300044684 Ga0466966_0995656 Ga0466966_0995656_146_430 94
149 3300046516 Ga0495628_0021665 Ga0495628_0021665_2206_2490 94
150 3300048917 Ga0496114_1611500 Ga0496114_1611500_195_479 94
151 3300050512 nmdc:mga0n895_1079523_c1 nmdc:mga0n895_1079523_c1_53_337 94
152 3300050513 nmdc:mga0rr50_271011_c1 nmdc:mga0rr50_271011_c1_630_914 94
153 3300050514 nmdc:mga08x19_193341_c1 nmdc:mga08x19_193341_c1_168_452 94
154 3300050514 nmdc:mga08x19_449407_c1 nmdc:mga08x19_449407_c1_257_541 94
155 3300005518 Ga0070699_100500422 Ga0070699_1005004222 95
156 3300013296 Ga0157374_10605327 Ga0157374_106053272 95
157 3300031090 Ga0265760_10041268 Ga0265760_100412682 95
158 3300005468 Ga0070707_100040801 Ga0070707_1000408012 98
159 3300025910 Ga0207684_10034830 Ga0207684_100348302 98
160 3300025922 Ga0207646_10398737 Ga0207646_103987372 98
161 3300025922 Ga0207646_10824872 Ga0207646_108248722 98
162 3300035118 Ga0373954_0000077 Ga0373954_0000077_29667_29987 98
163 3300035119 Ga0373956_0108449 Ga0373956_0108449_813_1133 98
164 3300035120 Ga0373957_0011212 Ga0373957_0011212_1791_2111 98
165 3300035172 Ga0373955_0008432 Ga0373955_0008432_941_1261 98
166 3300035410 Ga0373924_0220846 Ga0373924_0220846_204_524 98
167 3300036401 Ga0373937_0394707 Ga0373937_0394707_326_646 98
168 3300046463 Ga0495653_0264652 Ga0495653_0264652_491_811 98
169 3300046679 Ga0495623_0016117 Ga0495623_0016117_2836_3156 98
170 3300047317 Ga0495604_0023830 Ga0495604_0023830_254_574 98
171 3300047471 Ga0495684_0032373 Ga0495684_0032373_3633_3953 98
172 3300048088 Ga0495602_0007881 Ga0495602_0007881_3696_4016 98
173 3300053085 Ga0495619_0994748 Ga0495619_0994748_19_339 98
174 3300000546 LJNas_1000544 LJNas_10005445 99
175 3300006028 Ga0070717_10015587 Ga0070717_100155872 99
176 3300006871 Ga0075434_100226201 Ga0075434_1002262012 99

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01402

RHH_1

Ribbon-helix-helix protein, copG family

44

82

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1s7o-assembly1.cif.gz_C crystal structure of putative dna binding protein sp_1288 from streptococcus pygenes 0.9446 55 71
7etr-assembly1.cif.gz_B crystal structure of so_1444-so_1445 complex from shewanella oneidensis 0.9043 41 86
2ay0-assembly2.cif.gz_C structure of the lys9met mutant of the e. coli proline utilization a (puta) dna-binding domain. 0.8997 39 80
6iya-assembly2.cif.gz_C structure of the dna binding domain of antitoxin copaso 0.8976 41 81
2ay0-assembly3.cif.gz_E structure of the lys9met mutant of the e. coli proline utilization a (puta) dna-binding domain. 0.8968 39 80
ID Description Score Start End Superfamily
1s7oA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9495 55 71 1.10.10.10
1p94A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant;Met repressor-like 0.8681 40 81 1.10.1220.10
1p94B00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant;Met repressor-like 0.8603 40 79 1.10.1220.10
2hzaA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant;Met repressor-like 0.8459 41 84 1.10.1220.10
2hzvG01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant;Met repressor-like 0.8407 41 84 1.10.1220.10
ID Description Score Start End GO Terms
AF-A0A7C1LXP4-F1-model_v4 Uncharacterized protein 0.9034 39 79
AF-A0A3T1A4V8-F1-model_v4 deleted 0.8823 40 78
AF-A0A2V7UTM3-F1-model_v4 Ribbon-helix-helix protein CopG domain-containing protein 0.8692 38 84 GO:0006355
AF-A0A0F9Q708-F1-model_v4 Uncharacterized protein 0.8607 36 76
AF-A0A1I0PZI0-F1-model_v4 Ribbon-helix-helix protein, copG family 0.8218 38 78

Feature Viewer

pLDDT pTM Quality
85.33 0.51 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map