F267378

General Info

Members Datasets Scaffolds Average Seq Length
175 143 350 245

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8054920844|8054922850
Length 284
Sequence SPADDVTAGVASSGRRAESGKRVDRAEFCPLACGAMTSSEVWDEETAGRYDTTFAEKFAPEVLDPAVDFLTRLAGSGAALEFAIGTGRVAIPLVARGVPVTGIELSASMVAQLRRKADEETLPVIVGDMTTTTVPGEFSLVFLVWNSISNLRAQAEQVDCFRNAARHLGPGGRFVIELWTPPVRRLPPGQRAVPVSTGDRHLVLDTYDLATQQCTSRHYWHEADGTVRYDSGSFRYVWPAECDLMAQLAGLELENRYADWDGSPFISDSESHISVWRKPLAGRA

Samples

Sample ID Description Type Environment
1 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
23 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
24 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
27 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
28 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
29 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
30 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
31 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
32 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
35 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
40 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
41 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
45 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
46 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
73 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
75 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
76 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
77 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
78 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
79 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
80 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
81 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
82 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
83 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
84 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
85 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
86 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
87 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
88 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
89 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
90 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
91 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
92 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
93 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
94 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
95 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
96 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
97 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
98 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
99 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
100 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
101 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
102 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
103 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
104 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
105 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
106 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
107 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
108 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
109 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
111 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
112 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
113 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
114 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
116 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
117 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
118 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
119 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
120 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
121 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
122 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
123 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
124 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
125 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
126 8054920844 Frankia tisae Agncl-8 Isolate Nodule
127 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
128 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
129 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
130 2619618881 Frankia sp. ACN1ag Isolate Unclassified
131 2619619003 Frankia sp. CpI1-P Isolate Nodule
132 2626541554 Frankia sp. AvcI.1 Isolate Nodule
133 2643221641 Nocardioides sp. Root122 Isolate Unclassified
134 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
135 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
136 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
137 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
138 2862574272 Streptomyces sp. AcE210 Isolate Nodule
139 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
140 3001889506 Janibacter sp. YIM B02568 Isolate Unclassified
141 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
142 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule
143 8054913762 Frankia gtarii Agncl-10 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 88.57
Metatranscriptomes 1.14
Isolates 10.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.57
Nodule 3.43
Rhizoplane 9.14
Rhizosphere 78.29
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10005459 3300001991 Bacteria 2124
2 JGI24735J21928_10013749 3300002067 Bacteria 2539
3 JGI24744J21845_10006005 3300002077 Bacteria 2518
4 JGI25160J50197_1007258 3300003354 Bacteria 4357
5 Ga0070683_100204540 3300005329 Bacteria 1875
6 Ga0070682_100179997 3300005337 Bacteria 1476
7 Ga0070682_100197912 3300005337 Bacteria 1415
8 Ga0070660_100320775 3300005339 Bacteria 1273
9 Ga0070691_10076527 3300005341 Bacteria 1632
10 Ga0070687_100144523 3300005343 Bacteria 1389
11 Ga0070692_10018144 3300005345 Bacteria 3378
12 Ga0070674_100044613 3300005356 Bacteria 3024
13 Ga0070700_100005976 3300005441 Bacteria 6471
14 Ga0070700_100216866 3300005441 Bacteria 1353
15 Ga0070681_10055640 3300005458 Bacteria 3938
16 Ga0070681_10410594 3300005458 Bacteria 1266
17 Ga0068867_100100078 3300005459 Bacteria 2213
18 Ga0070679_100002852 3300005530 Bacteria 15697
19 Ga0070679_100159324 3300005530 Bacteria 2231
20 Ga0070679_100542796 3300005530 Bacteria 1106
21 Ga0070684_100075425 3300005535 Bacteria 2975
22 Ga0070684_100235950 3300005535 Bacteria 1670
23 Ga0070672_100013818 3300005543 Bacteria 5709
24 Ga0068855_100229669 3300005563 Bacteria 2078
25 Ga0068856_100094444 3300005614 Bacteria 2977
26 Ga0070702_100020493 3300005615 Bacteria 3465
27 Ga0068852_100025484 3300005616 Bacteria 4792
28 Ga0068852_100124880 3300005616 Bacteria 2361
29 Ga0068866_10063623 3300005718 Bacteria 1924
30 Ga0068861_100015403 3300005719 Bacteria 5386
31 Ga0068861_100139615 3300005719 Bacteria 1976
32 Ga0068870_10075090 3300005840 Bacteria 1854
33 Ga0068863_100021453 3300005841 Bacteria 6164
34 Ga0081538_10005530 3300005981 Bacteria 11350
35 Ga0075365_10059631 3300006038 Bacteria 2544
36 Ga0070712_100470744 3300006175 Bacteria 1049
37 Ga0075367_10305802 3300006178 Bacteria 1001
38 Ga0075430_100264733 3300006846 Bacteria 1423
39 Ga0075431_100103662 3300006847 Bacteria 2936
40 Ga0075431_100202728 3300006847 Bacteria 2029
41 Ga0111539_10074424 3300009094 Bacteria 4001
42 Ga0105245_10012305 3300009098 Bacteria 7444
43 Ga0105243_10003326 3300009148 Bacteria 13049
44 Ga0105241_10171824 3300009174 Bacteria 1791
45 Ga0105248_10171447 3300009177 Bacteria 2446
46 Ga0105237_10149070 3300009545 Bacteria 2335
47 Ga0105238_10124230 3300009551 Bacteria 2560
48 Ga0157370_10759817 3300013104 Bacteria 883
49 Ga0157369_10027776 3300013105 Bacteria 6268
50 Ga0157369_10647990 3300013105 Bacteria 1089
51 Ga0157372_10192116 3300013307 Bacteria 2365
52 Ga0157372_10420442 3300013307 Bacteria 1558
53 Ga0157375_10491300 3300013308 Bacteria 1392
54 Ga0163163_10017478 3300014325 Bacteria 6690
55 Ga0157380_10010753 3300014326 Bacteria 6595
56 Ga0157380_10484159 3300014326 Bacteria 1197
57 Ga0157377_10000924 3300014745 Bacteria 12270
58 Ga0206354_10740708 3300020081 Bacteria 1403
59 Ga0206353_11341319 3300020082 Bacteria 2278
60 Ga0207697_10141138 3300025315 Bacteria 1045
61 Ga0207692_10129686 3300025898 Bacteria 1422
62 Ga0207710_10183138 3300025900 Bacteria 1028
63 Ga0207688_10024792 3300025901 Bacteria 3290
64 Ga0207647_10014890 3300025904 Bacteria 5347
65 Ga0207705_10129853 3300025909 Bacteria 1875
66 Ga0207671_10212674 3300025914 Bacteria 1513
67 Ga0207662_10168261 3300025918 Bacteria 1404
68 Ga0207657_10076294 3300025919 Bacteria 2828
69 Ga0207652_10014081 3300025921 Bacteria 6474
70 Ga0207652_10146828 3300025921 Bacteria 2111
71 Ga0207652_10489079 3300025921 Bacteria 1108
72 Ga0207659_10050452 3300025926 Bacteria 2956
73 Ga0207709_10007137 3300025935 Bacteria 6237
74 Ga0207670_10141977 3300025936 Bacteria 1772
75 Ga0207669_10108326 3300025937 Bacteria 1855
76 Ga0207704_10027649 3300025938 Bacteria 3133
77 Ga0207691_10011755 3300025940 Bacteria 8403
78 Ga0207711_10120928 3300025941 Bacteria 2337
79 Ga0207661_10055877 3300025944 Bacteria 3168
80 Ga0207679_10246007 3300025945 Bacteria 1518
81 Ga0207708_10001682 3300026075 Bacteria 16389
82 Ga0207708_10055430 3300026075 Bacteria 3022
83 Ga0207702_10162322 3300026078 Bacteria 2041
84 Ga0207648_10012401 3300026089 Bacteria 7980
85 Ga0207675_100003492 3300026118 Bacteria 15345
86 Ga0207675_100077826 3300026118 Bacteria 3107
87 Ga0207698_10018977 3300026142 Bacteria 4696
88 Ga0207428_10054444 3300027907 Bacteria 3187
89 Ga0268265_10283369 3300028380 Bacteria 1484
90 Ga0307409_100112861 3300031995 Bacteria 2283
91 Ga0307416_100694642 3300032002 Bacteria 1106
92 Ga0307415_100150479 3300032126 Bacteria 1791
93 Ga0307415_100176922 3300032126 Bacteria 1670
94 Ga0395899_0002694 3300037312 Bacteria 14318
95 Ga0395898_0043467 3300037466 Bacteria 4427
96 Ga0395901_0117587 3300038443 Bacteria 2793
97 Ga0451853_3599943 3300041512 Bacteria 2073
98 Ga0466961_0437957 3300044693 Bacteria 791
99 Ga0466963_0115291 3300044694 Bacteria 1846
100 Ga0466963_0127839 3300044694 Bacteria 1753
101 Ga0466963_0440762 3300044694 Bacteria 919
102 Ga0466960_0159168 3300044901 Bacteria 1211
103 Ga0466967_0050147 3300045976 Bacteria 3654
104 Ga0466967_0128933 3300045976 Bacteria 2346
105 Ga0466967_0380019 3300045976 Bacteria 1371
106 Ga0495603_0001648 3300046455 Bacteria 13087
107 Ga0495629_0309043 3300046459 Bacteria 1082
108 Ga0495662_0000225 3300046476 Bacteria 23820
109 Ga0495594_0122557 3300046499 Bacteria 1470
110 Ga0495606_0001260 3300046507 Bacteria 35320
111 Ga0495630_0268258 3300046517 Bacteria 1304
112 Ga0495668_0000752 3300046616 Bacteria 38263
113 Ga0495625_0000265 3300046660 Bacteria 81480
114 Ga0495635_0389727 3300046663 Bacteria 926
115 Ga0495657_0001297 3300046675 Bacteria 21747
116 Ga0495613_0002582 3300046689 Bacteria 13614
117 Ga0495649_0031801 3300046694 Bacteria 2909
118 Ga0495600_0347024 3300046809 Bacteria 930
119 Ga0495676_0079600 3300047321 Bacteria 2490
120 Ga0495680_0437400 3300047322 Bacteria 897
121 Ga0495626_0001019 3300048091 Bacteria 24092
122 Ga0496104_0397220 3300048907 Bacteria 1291
123 Ga0496104_0894435 3300048907 Bacteria 793
124 Ga0496105_0085696 3300048908 Bacteria 2603
125 Ga0496105_0404340 3300048908 Bacteria 1083
126 Ga0496108_0304335 3300048911 Bacteria 1389
127 Ga0496108_0340277 3300048911 Bacteria 1309
128 Ga0496108_0360402 3300048911 Bacteria 1269
129 Ga0496110_0283584 3300048913 Bacteria 1508
130 Ga0496111_0072267 3300048914 Bacteria 2511
131 Ga0496111_0195074 3300048914 Bacteria 1505
132 Ga0496111_0251368 3300048914 Bacteria 1312
133 Ga0496112_0102895 3300048915 Bacteria 2826
134 Ga0496112_0220763 3300048915 Bacteria 1851
135 Ga0496113_0036400 3300048916 Bacteria 3606
136 Ga0496113_0123023 3300048916 Bacteria 2030
137 Ga0496114_0443132 3300048917 Bacteria 1150
138 Ga0501034_0025570 3300049571 Bacteria 6011
139 Ga0501034_0036809 3300049571 Bacteria 4956
140 Ga0501067_0171683 3300049583 Bacteria 1208
141 Ga0501067_0199339 3300049583 Bacteria 1115
142 Ga0501068_0096351 3300049584 Bacteria 1830
143 Ga0501069_0212560 3300049585 Bacteria 1123
144 Ga0501072_0013452 3300049588 Bacteria 6264
145 Ga0501035_0019978 3300049822 Bacteria 6154
146 Ga0501045_0128715 3300049824 Bacteria 1882
147 nmdc:mga0yw44_37081_c1 3300050492 Bacteria 2877
148 nmdc:mga0qj67_130918_c1 3300050509 Bacteria 2032
149 nmdc:mga06r32_60749_c1 3300050510 Bacteria 3637
150 nmdc:mga06r32_93239_c1 3300050510 Bacteria 2945
151 nmdc:mga08y16_16592_c1 3300050511 Bacteria 7746
152 Ga0495601_0020158 3300053077 Bacteria 4071
153 Ga0495619_0296096 3300053085 Bacteria 1121
154 Ga0500644_0000003 3300053088 Bacteria 199121
155 Ga0500556_0000484 3300053104 Bacteria 27762
156 Ga0500593_000291 3300053117 Bacteria 20290
157 Ga0500568_0073230 3300053139 Bacteria 1309
158 8054922850 8054920844 Bacteria 7068637
159 2552107618 2551306166 Bacteria 9731570
160 2579853824 2579778521 Bacteria 7624758
161 2585301855 2582581312 Bacteria 7308206
162 2619857347 2619618881 Bacteria 7521104
163 2620350128 2619619003 Bacteria 7619552
164 2626633952 2626541554 Bacteria 7741902
165 2644229738 2643221641 Bacteria 4490190
166 2808847198 2808606359 Bacteria 9866990
167 2819425563 2818991318 Bacteria 5266538
168 2833711672 2833709550 Bacteria 4008291
169 2857484767 2857481737 Bacteria 4761446
170 2862581245 2862574272 Bacteria 10567477
171 2887484972 2887478801 Bacteria 8972725
172 3001889518 3001889506 Bacteria 2975194
173 8001788631 8001781756 Bacteria 9586736
174 8054611886 8054609563 Bacteria 5170090
175 8054916505 8054913762 Bacteria 7713009
176 JGI24743J22301_10005459
177 JGI24735J21928_10013749
178 JGI24744J21845_10006005
179 JGI25160J50197_1007258
180 Ga0070683_100204540
181 Ga0070682_100179997
182 Ga0070682_100197912
183 Ga0070660_100320775
184 Ga0070691_10076527
185 Ga0070687_100144523
186 Ga0070692_10018144
187 Ga0070674_100044613
188 Ga0070700_100005976
189 Ga0070700_100216866
190 Ga0070681_10055640
191 Ga0070681_10410594
192 Ga0068867_100100078
193 Ga0070679_100002852
194 Ga0070679_100159324
195 Ga0070679_100542796
196 Ga0070684_100075425
197 Ga0070684_100235950
198 Ga0070672_100013818
199 Ga0068855_100229669
200 Ga0068856_100094444
201 Ga0070702_100020493
202 Ga0068852_100025484
203 Ga0068852_100124880
204 Ga0068866_10063623
205 Ga0068861_100015403
206 Ga0068861_100139615
207 Ga0068870_10075090
208 Ga0068863_100021453
209 Ga0081538_10005530
210 Ga0075365_10059631
211 Ga0070712_100470744
212 Ga0075367_10305802
213 Ga0075430_100264733
214 Ga0075431_100103662
215 Ga0075431_100202728
216 Ga0111539_10074424
217 Ga0105245_10012305
218 Ga0105243_10003326
219 Ga0105241_10171824
220 Ga0105248_10171447
221 Ga0105237_10149070
222 Ga0105238_10124230
223 Ga0157370_10759817
224 Ga0157369_10027776
225 Ga0157369_10647990
226 Ga0157372_10192116
227 Ga0157372_10420442
228 Ga0157375_10491300
229 Ga0163163_10017478
230 Ga0157380_10010753
231 Ga0157380_10484159
232 Ga0157377_10000924
233 Ga0206354_10740708
234 Ga0206353_11341319
235 Ga0207697_10141138
236 Ga0207692_10129686
237 Ga0207710_10183138
238 Ga0207688_10024792
239 Ga0207647_10014890
240 Ga0207705_10129853
241 Ga0207671_10212674
242 Ga0207662_10168261
243 Ga0207657_10076294
244 Ga0207652_10014081
245 Ga0207652_10146828
246 Ga0207652_10489079
247 Ga0207659_10050452
248 Ga0207709_10007137
249 Ga0207670_10141977
250 Ga0207669_10108326
251 Ga0207704_10027649
252 Ga0207691_10011755
253 Ga0207711_10120928
254 Ga0207661_10055877
255 Ga0207679_10246007
256 Ga0207708_10001682
257 Ga0207708_10055430
258 Ga0207702_10162322
259 Ga0207648_10012401
260 Ga0207675_100003492
261 Ga0207675_100077826
262 Ga0207698_10018977
263 Ga0207428_10054444
264 Ga0268265_10283369
265 Ga0307409_100112861
266 Ga0307416_100694642
267 Ga0307415_100150479
268 Ga0307415_100176922
269 Ga0395899_0002694
270 Ga0395898_0043467
271 Ga0395901_0117587
272 Ga0451853_3599943
273 Ga0466961_0437957
274 Ga0466963_0115291
275 Ga0466963_0127839
276 Ga0466963_0440762
277 Ga0466960_0159168
278 Ga0466967_0050147
279 Ga0466967_0128933
280 Ga0466967_0380019
281 Ga0495603_0001648
282 Ga0495629_0309043
283 Ga0495662_0000225
284 Ga0495594_0122557
285 Ga0495606_0001260
286 Ga0495630_0268258
287 Ga0495668_0000752
288 Ga0495625_0000265
289 Ga0495635_0389727
290 Ga0495657_0001297
291 Ga0495613_0002582
292 Ga0495649_0031801
293 Ga0495600_0347024
294 Ga0495676_0079600
295 Ga0495680_0437400
296 Ga0495626_0001019
297 Ga0496104_0397220
298 Ga0496104_0894435
299 Ga0496105_0085696
300 Ga0496105_0404340
301 Ga0496108_0304335
302 Ga0496108_0340277
303 Ga0496108_0360402
304 Ga0496110_0283584
305 Ga0496111_0072267
306 Ga0496111_0195074
307 Ga0496111_0251368
308 Ga0496112_0102895
309 Ga0496112_0220763
310 Ga0496113_0036400
311 Ga0496113_0123023
312 Ga0496114_0443132
313 Ga0501034_0025570
314 Ga0501034_0036809
315 Ga0501067_0171683
316 Ga0501067_0199339
317 Ga0501068_0096351
318 Ga0501069_0212560
319 Ga0501072_0013452
320 Ga0501035_0019978
321 Ga0501045_0128715
322 nmdc:mga0yw44_37081_c1
323 nmdc:mga0qj67_130918_c1
324 nmdc:mga06r32_60749_c1
325 nmdc:mga06r32_93239_c1
326 nmdc:mga08y16_16592_c1
327 Ga0495601_0020158
328 Ga0495619_0296096
329 Ga0500644_0000003
330 Ga0500556_0000484
331 Ga0500593_000291
332 Ga0500568_0073230
333 8054922850
334 2552107618
335 2579853824
336 2585301855
337 2619857347
338 2620350128
339 2626633952
340 2644229738
341 2808847198
342 2819425563
343 2833711672
344 2857484767
345 2862581245
346 2887484972
347 3001889518
348 8001788631
349 8054611886
350 8054916505

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13649

Methyltransf_25

Methyltransferase domain

79

172

0.92

PF08241

Methyltransf_11

Methyltransferase domain

80

176

0.91

PF08242

Methyltransf_12

Methyltransferase domain

80

174

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hgy-assembly1.cif.gz_E structure of the ccbj methyltransferase from streptomyces caelestis 0.8932 30 239
3cgg-assembly2.cif.gz_B crystal structure of tehb-like sam-dependent methyltransferase (np_600671.1) from corynebacterium glutamicum atcc 13032 kitasato at 2.00 a resolution 0.8798 8 239
7wzf-assembly1.cif.gz_A structural and mechanism analysis of yunm 0.8793 12 237
3cgg-assembly2.cif.gz_B crystal structure of tehb-like sam-dependent methyltransferase (np_600671.1) from corynebacterium glutamicum atcc 13032 kitasato at 2.00 a resolution 0.8709 8 239
3ths-assembly1.cif.gz_B crystal structure of rat native liver glycine n-methyltransferase complexed with 5-methyltetrahydrofolate pentaglutamate 0.8389 24 241
ID Description Score Start End Superfamily
4hgzB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.912 30 241 3.40.50.150
3d2lA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8892 12 239 3.40.50.150
4hgzB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8807 30 241 3.40.50.150
3cggB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8758 8 239 3.40.50.150
af_P9WKL5_23_210_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.871 42 149 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A1C6RA79-F1-model_v4 SAM-dependent methyltransferase 0.9832 30 240 GO:0008168
GO:0032259
AF-A0A4R0JC25-F1-model_v4 GNAT family N-acetyltransferase 0.9742 6 241 GO:0016747
AF-D9XIG6-F1-model_v4 Methyltransferase 0.9617 6 204 GO:0008168
GO:0009058
GO:0032259
AF-A0A1I4U0Q1-F1-model_v4 Methyltransferase domain-containing protein 0.9606 9 240 GO:0008168
GO:0032259
AF-A0A7W0PYD9-F1-model_v4 Class I SAM-dependent methyltransferase 0.9589 5 241 GO:0008168
GO:0032259

Map