F266811

General Info

Members Datasets Scaffolds Average Seq Length
175 136 350 148

Family's Representative Sequence

Representative Sequence 3300044656|Ga0466969_0265377|Ga0466969_0265377_182_685
Length 167
Sequence MGDDGPGRVQVTAEGAELMEPRLKGAMSPDLMTAIQHLHKAIAAGGVDRRLLSLVHLRASQINGCAPCVFATVSGAKKAGETDERLHHVVAWRETPFFTEEERAALALTEAATRIQDGAPGVTDEVWDAAADHFTGEQLGAITLEIAMTNFFNRINHTIREQAGKTW

Samples

Sample ID Description Type Environment
1 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
9 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
10 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
11 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
12 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
13 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
14 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
15 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
16 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
17 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
18 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
19 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
20 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
21 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
22 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
23 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
24 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
25 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
26 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
27 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
28 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
29 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
30 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
31 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
32 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
33 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
34 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
35 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
36 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
37 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
55 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
56 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
57 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
58 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
59 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
60 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
61 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
62 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
63 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
64 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
65 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
66 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
67 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
68 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
69 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
70 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
71 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
72 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
73 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
74 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
75 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
76 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
77 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
78 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
79 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
80 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
81 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
82 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
83 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
84 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
85 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
86 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
87 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
88 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
89 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
90 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
91 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
92 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
93 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
94 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
95 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
96 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
97 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
98 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
99 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
101 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
110 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
112 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
113 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
114 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
115 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
116 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
117 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
118 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
119 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
120 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
121 2643221578 Streptomyces sp. Root63 Isolate Unclassified
122 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
123 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
124 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
125 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
126 2862574272 Streptomyces sp. AcE210 Isolate Nodule
127 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
128 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
129 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
130 2891562705 Microbispora tritici MT50 Isolate Unclassified
131 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
132 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
133 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
134 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
135 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
136 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 84
Metatranscriptomes 1.14
Isolates 14.86

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.14
Nodule 0.57
Rhizoplane 1.14
Rhizosphere 77.14
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466969_0265377 3300044656 Bacteria 778
2 rootH2_10169653 3300003320 Bacteria 1552
3 Ga0070658_10171681 3300005327 Bacteria 1822
4 Ga0070692_10394319 3300005345 Bacteria 872
5 Ga0070668_100007247 3300005347 Bacteria 8224
6 Ga0070714_100002685 3300005435 Bacteria 13107
7 Ga0070714_101929498 3300005435 Bacteria 576
8 Ga0070713_100067961 3300005436 Bacteria 3002
9 Ga0070663_100041428 3300005455 Bacteria 3230
10 Ga0070679_101417602 3300005530 Bacteria 641
11 Ga0068853_100143569 3300005539 Bacteria 2144
12 Ga0068853_100181857 3300005539 Bacteria 1907
13 Ga0070665_100025720 3300005548 Bacteria 5929
14 Ga0070665_100171748 3300005548 Bacteria 2169
15 Ga0068855_100009579 3300005563 Bacteria 11688
16 Ga0068854_100002714 3300005578 Bacteria 10977
17 Ga0068856_100047945 3300005614 Bacteria 4209
18 Ga0068852_100824668 3300005616 Bacteria 942
19 Ga0068861_100695372 3300005719 Bacteria 944
20 Ga0068862_100360943 3300005844 Bacteria 1350
21 Ga0081539_10002173 3300005985 Bacteria 28814
22 Ga0068871_100229738 3300006358 Bacteria 1610
23 Ga0105251_10026402 3300009011 Bacteria 2957
24 Ga0105240_10014856 3300009093 Bacteria 10614
25 Ga0105245_11073685 3300009098 Bacteria 851
26 Ga0105247_10000479 3300009101 Bacteria 33400
27 Ga0105241_10436360 3300009174 Bacteria 1156
28 Ga0105248_10064469 3300009177 Bacteria 4113
29 Ga0105248_11919204 3300009177 Bacteria 672
30 Ga0105237_10122822 3300009545 Bacteria 2591
31 Ga0105237_10683655 3300009545 Bacteria 1033
32 Ga0105238_10085596 3300009551 Bacteria 3140
33 Ga0105239_10261793 3300010375 Bacteria 1944
34 Ga0157370_10964215 3300013104 Bacteria 773
35 Ga0157369_10490489 3300013105 Bacteria 1271
36 Ga0157374_10367372 3300013296 Bacteria 1432
37 Ga0157372_10144015 3300013307 Bacteria 2748
38 Ga0157372_10998366 3300013307 Bacteria 969
39 Ga0163163_10039816 3300014325 Bacteria 4588
40 Ga0157379_10005479 3300014968 Bacteria 10897
41 Ga0197907_11494585 3300020069 Bacteria 528
42 Ga0206356_11796562 3300020070 Bacteria 731
43 Ga0207710_10000137 3300025900 Bacteria 86612
44 Ga0207705_10144505 3300025909 Bacteria 1779
45 Ga0207654_10036679 3300025911 Bacteria 2741
46 Ga0207695_10048732 3300025913 Bacteria 4472
47 Ga0207671_10000488 3300025914 Bacteria 53807
48 Ga0207671_10936918 3300025914 Bacteria 684
49 Ga0207652_11064016 3300025921 Bacteria 709
50 Ga0207694_10001572 3300025924 Bacteria 19329
51 Ga0207694_10056651 3300025924 Bacteria 3044
52 Ga0207700_10162234 3300025928 Bacteria 1857
53 Ga0207664_10063230 3300025929 Bacteria 2957
54 Ga0207664_10232111 3300025929 Bacteria 1604
55 Ga0207711_10001547 3300025941 Bacteria 21290
56 Ga0207711_10821421 3300025941 Bacteria 865
57 Ga0207667_10017785 3300025949 Bacteria 7994
58 Ga0207668_10213847 3300025972 Bacteria 1543
59 Ga0207640_10027621 3300025981 Bacteria 3460
60 Ga0207678_10077529 3300026067 Bacteria 2847
61 Ga0207702_11365412 3300026078 Bacteria 703
62 Ga0207698_10408032 3300026142 Bacteria 1300
63 Ga0268266_10011308 3300028379 Bacteria 7768
64 Ga0268266_10520467 3300028379 Bacteria 1137
65 Ga0307517_10223533 3300028786 Bacteria 1140
66 Ga0307515_10000044 3300028794 Bacteria 303041
67 Ga0307515_10023695 3300028794 Bacteria 10740
68 Ga0307515_10056405 3300028794 Bacteria 5710
69 Ga0307513_10780484 3300031456 Bacteria 661
70 Ga0307509_10198278 3300031507 Bacteria 1848
71 Ga0307509_10374425 3300031507 Bacteria 1139
72 Ga0307408_101381097 3300031548 Bacteria 663
73 Ga0307514_10263506 3300031649 Bacteria 1006
74 Ga0307516_10000741 3300031730 Bacteria 44424
75 Ga0307507_10158653 3300033179 Bacteria 1678
76 Ga0373950_0017691 3300034818 Bacteria 1231
77 Ga0373932_0010317 3300035112 Bacteria 2259
78 Ga0373942_0002931 3300035207 Bacteria 4043
79 Ga0373925_0296744 3300037068 Bacteria 1304
80 Ga0436364_0305623 3300037853 Bacteria 1092
81 Ga0439438_040496 3300041405 Bacteria 1211
82 Ga0439447_110102 3300041407 Bacteria 632
83 Ga0451807_2751497 3300041486 Bacteria 891
84 Ga0451833_1029960 3300041491 Bacteria 652
85 Ga0439449_0137622 3300042007 Bacteria 908
86 Ga0466969_0046077 3300044656 Bacteria 2163
87 Ga0466961_0145901 3300044693 Bacteria 1480
88 Ga0466968_0233814 3300044735 Bacteria 869
89 Ga0466970_0125663 3300044765 Bacteria 1406
90 Ga0466970_0223222 3300044765 Bacteria 1052
91 Ga0466957_0937208 3300044842 Bacteria 620
92 Ga0466959_0491209 3300045049 Bacteria 830
93 Ga0495617_033062 3300046452 Bacteria 1736
94 Ga0495603_0029758 3300046455 Bacteria 3292
95 Ga0495603_0275932 3300046455 Bacteria 967
96 Ga0495585_0079300 3300046492 Bacteria 1781
97 Ga0495585_0124508 3300046492 Bacteria 1361
98 Ga0495585_0170019 3300046492 Bacteria 1126
99 Ga0495594_0011926 3300046499 Bacteria 4521
100 Ga0495607_0463548 3300046501 Bacteria 567
101 Ga0495583_0116952 3300046506 Bacteria 1125
102 Ga0495666_0026562 3300046526 Bacteria 2853
103 Ga0495652_0631154 3300046529 Bacteria 727
104 Ga0495640_0081347 3300046533 Bacteria 2153
105 Ga0495609_0017450 3300046538 Bacteria 3334
106 Ga0495622_0025774 3300046557 Bacteria 2746
107 Ga0495633_0535889 3300046558 Bacteria 527
108 Ga0495611_0029252 3300046648 Bacteria 2415
109 Ga0495625_0144282 3300046660 Bacteria 1604
110 Ga0495660_0055645 3300046810 Bacteria 2141
111 Ga0495604_0106657 3300047317 Bacteria 2049
112 Ga0495676_0381982 3300047321 Bacteria 937
113 Ga0495683_0118807 3300047323 Bacteria 1256
114 Ga0495687_028690 3300047443 Bacteria 2585
115 Ga0496105_0233070 3300048908 Bacteria 1496
116 Ga0496119_0010202 3300048922 Bacteria 7928
117 Ga0496120_0007789 3300048923 Bacteria 7911
118 Ga0501031_0326526 3300049568 Bacteria 994
119 Ga0501032_0098085 3300049569 Bacteria 1942
120 Ga0501032_0100023 3300049569 Bacteria 1921
121 Ga0501033_0032465 3300049570 Bacteria 3922
122 Ga0501033_0464157 3300049570 Bacteria 878
123 Ga0501034_0051477 3300049571 Bacteria 4152
124 Ga0501034_0500864 3300049571 Bacteria 1128
125 Ga0501034_1293232 3300049571 Bacteria 606
126 Ga0501036_0032659 3300049572 Bacteria 4400
127 Ga0501036_0114402 3300049572 Bacteria 2280
128 Ga0501037_0785501 3300049573 Bacteria 629
129 Ga0501038_0218125 3300049574 Bacteria 1523
130 Ga0501043_0041921 3300049579 Bacteria 3596
131 Ga0501043_0218298 3300049579 Bacteria 1476
132 Ga0501043_0338247 3300049579 Bacteria 1145
133 Ga0501047_0017689 3300049581 Bacteria 6829
134 Ga0501047_0062083 3300049581 Bacteria 3605
135 Ga0501047_0083855 3300049581 Bacteria 3063
136 Ga0501047_0537699 3300049581 Bacteria 993
137 Ga0501048_0165022 3300049582 Bacteria 1568
138 Ga0501072_1256108 3300049588 Bacteria 575
139 Ga0501035_0011863 3300049822 Bacteria 8068
140 Ga0501035_0398961 3300049822 Bacteria 1144
141 Ga0501044_0025860 3300049823 Bacteria 6222
142 Ga0501044_0193766 3300049823 Bacteria 1993
143 nmdc:mga06r32_16138_c1 3300050510 Bacteria 6802
144 nmdc:mga06r32_734137_c1 3300050510 Bacteria 951
145 Ga0495601_0585496 3300053077 Bacteria 717
146 Ga0495612_0002952 3300053078 Bacteria 7058
147 Ga0495619_0055232 3300053085 Bacteria 2630
148 Ga0500660_148697 3300053100 Bacteria 914
149 Ga0500573_0198604 3300053140 Bacteria 1066
150 2515721225 2515154129 Bacteria 5584369
151 2516086001 2515154202 Bacteria 5471270
152 2585300237 2582581312 Bacteria 7308206
153 2643901650 2643221578 Bacteria 9213798
154 2644407796 2643221673 Bacteria 9196637
155 2644440526 2643221678 Bacteria 9540101
156 2676479879 2675903059 Bacteria 8644972
157 2856742206 2856741275 Bacteria 8096094
158 2856743910 2856741275 Bacteria 8096094
159 2862575498 2862574272 Bacteria 10567477
160 2884698584 2884693830 Bacteria 11273186
161 2891398635 2891395885 Bacteria 9251614
162 2891398662 2891395885 Bacteria 9251614
163 2891401088 2891395885 Bacteria 9251614
164 2891402862 2891395885 Bacteria 9251614
165 2891554828 2891554331 Bacteria 8812224
166 2891559185 2891554331 Bacteria 8812224
167 2891560087 2891554331 Bacteria 8812224
168 2891566947 2891562705 Bacteria 8039471
169 2891568229 2891562705 Bacteria 8039471
170 2895438246 2895427314 Bacteria 13147766
171 2895451181 2895442618 Bacteria 11027144
172 2947226047 2947224130 Bacteria 9938529
173 2995471494 2995463766 Bacteria 8577691
174 3003005387 3002998708 Bacteria 11715108
175 8055070972 8055066027 Bacteria 9479577
176 Ga0466969_0265377
177 rootH2_10169653
178 Ga0070658_10171681
179 Ga0070692_10394319
180 Ga0070668_100007247
181 Ga0070714_100002685
182 Ga0070714_101929498
183 Ga0070713_100067961
184 Ga0070663_100041428
185 Ga0070679_101417602
186 Ga0068853_100143569
187 Ga0068853_100181857
188 Ga0070665_100025720
189 Ga0070665_100171748
190 Ga0068855_100009579
191 Ga0068854_100002714
192 Ga0068856_100047945
193 Ga0068852_100824668
194 Ga0068861_100695372
195 Ga0068862_100360943
196 Ga0081539_10002173
197 Ga0068871_100229738
198 Ga0105251_10026402
199 Ga0105240_10014856
200 Ga0105245_11073685
201 Ga0105247_10000479
202 Ga0105241_10436360
203 Ga0105248_10064469
204 Ga0105248_11919204
205 Ga0105237_10122822
206 Ga0105237_10683655
207 Ga0105238_10085596
208 Ga0105239_10261793
209 Ga0157370_10964215
210 Ga0157369_10490489
211 Ga0157374_10367372
212 Ga0157372_10144015
213 Ga0157372_10998366
214 Ga0163163_10039816
215 Ga0157379_10005479
216 Ga0197907_11494585
217 Ga0206356_11796562
218 Ga0207710_10000137
219 Ga0207705_10144505
220 Ga0207654_10036679
221 Ga0207695_10048732
222 Ga0207671_10000488
223 Ga0207671_10936918
224 Ga0207652_11064016
225 Ga0207694_10001572
226 Ga0207694_10056651
227 Ga0207700_10162234
228 Ga0207664_10063230
229 Ga0207664_10232111
230 Ga0207711_10001547
231 Ga0207711_10821421
232 Ga0207667_10017785
233 Ga0207668_10213847
234 Ga0207640_10027621
235 Ga0207678_10077529
236 Ga0207702_11365412
237 Ga0207698_10408032
238 Ga0268266_10011308
239 Ga0268266_10520467
240 Ga0307517_10223533
241 Ga0307515_10000044
242 Ga0307515_10023695
243 Ga0307515_10056405
244 Ga0307513_10780484
245 Ga0307509_10198278
246 Ga0307509_10374425
247 Ga0307408_101381097
248 Ga0307514_10263506
249 Ga0307516_10000741
250 Ga0307507_10158653
251 Ga0373950_0017691
252 Ga0373932_0010317
253 Ga0373942_0002931
254 Ga0373925_0296744
255 Ga0436364_0305623
256 Ga0439438_040496
257 Ga0439447_110102
258 Ga0451807_2751497
259 Ga0451833_1029960
260 Ga0439449_0137622
261 Ga0466969_0046077
262 Ga0466961_0145901
263 Ga0466968_0233814
264 Ga0466970_0125663
265 Ga0466970_0223222
266 Ga0466957_0937208
267 Ga0466959_0491209
268 Ga0495617_033062
269 Ga0495603_0029758
270 Ga0495603_0275932
271 Ga0495585_0079300
272 Ga0495585_0124508
273 Ga0495585_0170019
274 Ga0495594_0011926
275 Ga0495607_0463548
276 Ga0495583_0116952
277 Ga0495666_0026562
278 Ga0495652_0631154
279 Ga0495640_0081347
280 Ga0495609_0017450
281 Ga0495622_0025774
282 Ga0495633_0535889
283 Ga0495611_0029252
284 Ga0495625_0144282
285 Ga0495660_0055645
286 Ga0495604_0106657
287 Ga0495676_0381982
288 Ga0495683_0118807
289 Ga0495687_028690
290 Ga0496105_0233070
291 Ga0496119_0010202
292 Ga0496120_0007789
293 Ga0501031_0326526
294 Ga0501032_0098085
295 Ga0501032_0100023
296 Ga0501033_0032465
297 Ga0501033_0464157
298 Ga0501034_0051477
299 Ga0501034_0500864
300 Ga0501034_1293232
301 Ga0501036_0032659
302 Ga0501036_0114402
303 Ga0501037_0785501
304 Ga0501038_0218125
305 Ga0501043_0041921
306 Ga0501043_0218298
307 Ga0501043_0338247
308 Ga0501047_0017689
309 Ga0501047_0062083
310 Ga0501047_0083855
311 Ga0501047_0537699
312 Ga0501048_0165022
313 Ga0501072_1256108
314 Ga0501035_0011863
315 Ga0501035_0398961
316 Ga0501044_0025860
317 Ga0501044_0193766
318 nmdc:mga06r32_16138_c1
319 nmdc:mga06r32_734137_c1
320 Ga0495601_0585496
321 Ga0495612_0002952
322 Ga0495619_0055232
323 Ga0500660_148697
324 Ga0500573_0198604
325 2515721225
326 2516086001
327 2585300237
328 2643901650
329 2644407796
330 2644440526
331 2676479879
332 2856742206
333 2856743910
334 2862575498
335 2884698584
336 2891398635
337 2891398662
338 2891401088
339 2891402862
340 2891554828
341 2891559185
342 2891560087
343 2891566947
344 2891568229
345 2895438246
346 2895451181
347 2947226047
348 2995471494
349 3003005387
350 8055070972

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02627

CMD

Carboxymuconolactone decarboxylase family

29

111

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7xw1-assembly1.cif.gz_A the crystal structure of ahpd from pseudomonas aeruginosa 0.9424 9 137
2ijc-assembly2.cif.gz_I structure of a conserved protein of unknown function pa0269 from pseudomonas aeruginosa 0.9215 1 145
2ijc-assembly2.cif.gz_I structure of a conserved protein of unknown function pa0269 from pseudomonas aeruginosa 0.9095 1 145
7xw1-assembly1.cif.gz_A the crystal structure of ahpd from pseudomonas aeruginosa 0.8952 9 137
2oyo-assembly1.cif.gz_A crystal structure of uncharacterized peroxidase-related protein (yp_604910.1) from deinococcus geothermalis dsm 11300 at 1.51 a resolution 0.8909 30 142
ID Description Score Start End Superfamily
af_P76222_42_172_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9547 27 145 1.20.1290.10
2ijcF00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9425 9 137 1.20.1290.10
af_Q2FVE0_2_139_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9369 10 139 1.20.1290.10
2o4dA00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9277 9 145 1.20.1290.10
2gmyF00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8865 2 149 1.20.1290.10
ID Description Score Start End GO Terms
AF-A0A4R4SGD6-F1-model_v4 Carboxymuconolactone decarboxylase family protein 0.9991 34 116 GO:0051920
AF-A0A1G9G8Y8-F1-model_v4 Alkylhydroperoxidase AhpD family core domain-containing protein 0.9889 3 149 GO:0051920
AF-A0A2C9DJN7-F1-model_v4 AhpD family alkylhydroperoxidase like protein 0.9851 1 149 GO:0051920
AF-A0A540W604-F1-model_v4 Carboxymuconolactone decarboxylase family protein 0.9851 1 149 GO:0051920
AF-B5HJF3-F1-model_v4 Alkylhydroperoxidase 0.9841 15 149 GO:0051920

Map