F266568

General Info

Members Datasets Scaffolds Average Seq Length
175 126 175 239

Family's Representative Sequence

Representative Sequence 3300028800|Ga0265338_10235473|Ga0265338_102354731
Length 268
Sequence MAAKQRLDQRLTALGLVQSRSQAESFIKLGEVKVNGTVQTKPGFAVGENDEIQLTAKEQYVSRAALKLASVAQTLKINFQGKTVLDVGSSTGGFTDYALKHGATKVIAVEVGTDQLHPSLHGNPQIELHEQTDIRDVRPRHPEFISGPHSKSNGIPKPVRDDGVVEIDVPDIVVADVSFISLREILPAVAKLSTKQTQIVAMVKPQFEAVESSLKHKGVIKNDKMRRDILKDFEQWTQPRFIILDKADSAVAGSKGNQERFYLLKLAS

Samples

Sample ID Description Type Environment
1 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
10 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
11 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
12 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
13 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
14 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
15 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
16 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
17 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
18 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
19 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
20 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
21 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
22 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
23 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
24 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
25 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
26 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
27 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
29 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
33 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
34 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
35 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
36 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
37 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
38 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
41 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
42 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
47 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
67 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
68 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
69 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
70 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
71 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
72 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
73 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
74 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
75 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
76 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
77 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
78 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
79 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
80 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
81 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
82 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
83 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
84 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
85 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
86 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
87 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
88 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
89 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
90 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
91 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
94 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
95 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
96 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
97 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
98 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
99 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
100 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
101 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
102 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
103 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
104 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
105 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
106 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
107 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
108 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
109 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
110 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
111 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
112 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
113 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
114 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
115 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
116 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
117 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
118 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
119 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
120 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
121 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
122 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
123 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
124 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
125 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
126 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 27.43
Nodule 0
Rhizoplane 0.57
Rhizosphere 70.29
Stem 0
Stem Tuber 0
Unclassified 1.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10028420 3300003316 Bacteria 5136
2 rootH2_10287045 3300003320 Bacteria 1217
3 rootH1_10328544 3300003323 Unclassified 2476
4 Ga0070658_10000076 3300005327 Bacteria 95016
5 Ga0070683_100000380 3300005329 Bacteria 30907
6 Ga0070660_100000148 3300005339 Bacteria 45185
7 Ga0070668_100449640 3300005347 Unclassified 1107
8 Ga0070667_100000503 3300005367 Bacteria 39598
9 Ga0070679_100006731 3300005530 Bacteria 10719
10 Ga0070679_100043753 3300005530 Unclassified 4459
11 Ga0070679_100133284 3300005530 Unclassified 2465
12 Ga0070679_100299035 3300005530 Unclassified 1560
13 Ga0070684_100000280 3300005535 Bacteria 35451
14 Ga0070684_100013425 3300005535 Bacteria 6604
15 Ga0068853_100089775 3300005539 Bacteria 2700
16 Ga0068855_100000001 3300005563 Bacteria 818777
17 Ga0068855_100001316 3300005563 Bacteria 30782
18 Ga0068855_100017269 3300005563 Bacteria 8685
19 Ga0068855_100173746 3300005563 Bacteria 2439
20 Ga0068857_100000266 3300005577 Bacteria 35450
21 Ga0068854_100007645 3300005578 Bacteria 6913
22 Ga0068856_100000002 3300005614 Bacteria 372816
23 Ga0068856_100000441 3300005614 Bacteria 45741
24 Ga0068852_100000621 3300005616 Bacteria 23231
25 Ga0068864_100838212 3300005618 Bacteria 905
26 Ga0068860_100135216 3300005843 Bacteria 2367
27 Ga0081455_10000006 3300005937 Bacteria 323066
28 Ga0070717_10227524 3300006028 Unclassified 1641
29 Ga0075365_10005061 3300006038 Bacteria 7075
30 Ga0075364_10005269 3300006051 Bacteria 7507
31 Ga0075362_10018123 3300006177 Bacteria 2909
32 Ga0075367_10000017 3300006178 Bacteria 34198
33 Ga0075369_10000004 3300006186 Bacteria 154675
34 Ga0075366_10000095 3300006195 Bacteria 35412
35 Ga0075366_10018187 3300006195 Bacteria 4057
36 Ga0097621_100017864 3300006237 Bacteria 5401
37 Ga0097621_100112039 3300006237 Bacteria 2306
38 Ga0075370_10004175 3300006353 Bacteria 6969
39 Ga0068871_100803104 3300006358 Unclassified 867
40 Ga0105240_10000030 3300009093 Bacteria 321312
41 Ga0105245_10522576 3300009098 Unclassified 1206
42 Ga0105247_10451131 3300009101 Bacteria 927
43 Ga0105241_10000009 3300009174 Bacteria 258876
44 Ga0105237_10000001 3300009545 Bacteria 1009213
45 Ga0105238_10024039 3300009551 Bacteria 6213
46 Ga0105238_10040510 3300009551 Bacteria 4720
47 Ga0105249_10062105 3300009553 Bacteria 3430
48 Ga0105032_100012 3300009979 Bacteria 73994
49 Ga0105028_101565 3300009993 Bacteria 2406
50 Ga0105239_10041163 3300010375 Bacteria 5063
51 Ga0105246_10000177 3300011119 Bacteria 31075
52 Ga0157373_10009954 3300013100 Bacteria 7007
53 Ga0157370_10000232 3300013104 Bacteria 71177
54 Ga0157370_10001387 3300013104 Bacteria 29999
55 Ga0157370_10206406 3300013104 Bacteria 1822
56 Ga0157369_10000003 3300013105 Bacteria 507337
57 Ga0157369_10000227 3300013105 Bacteria 77626
58 Ga0157369_10000826 3300013105 Bacteria 39569
59 Ga0157369_10001538 3300013105 Bacteria 28252
60 Ga0157369_10068429 3300013105 Unclassified 3815
61 Ga0157369_10138712 3300013105 Bacteria 2573
62 Ga0157369_10161422 3300013105 Bacteria 2366
63 Ga0157378_10113851 3300013297 Bacteria 2484
64 Ga0157372_10000007 3300013307 Bacteria 340690
65 Ga0157372_10000096 3300013307 Bacteria 91282
66 Ga0157376_10000223 3300014969 Bacteria 39568
67 Ga0207705_10000019 3300025909 Bacteria 317770
68 Ga0207654_10000002 3300025911 Bacteria 1460142
69 Ga0207695_10000009 3300025913 Bacteria 1034276
70 Ga0207671_10000003 3300025914 Bacteria 1065461
71 Ga0207657_10000547 3300025919 Bacteria 40133
72 Ga0207652_10018148 3300025921 Bacteria 5767
73 Ga0207652_10073716 3300025921 Bacteria 2971
74 Ga0207694_10064726 3300025924 Bacteria 2850
75 Ga0207661_10001467 3300025944 Bacteria 15941
76 Ga0207667_10000003 3300025949 Bacteria 822935
77 Ga0207667_10015416 3300025949 Bacteria 8685
78 Ga0207667_10024352 3300025949 Bacteria 6646
79 Ga0207667_10728993 3300025949 Unclassified 992
80 Ga0207712_10005969 3300025961 Bacteria 7682
81 Ga0207668_10479669 3300025972 Unclassified 1066
82 Ga0207640_10013201 3300025981 Bacteria 4729
83 Ga0207658_10015037 3300025986 Bacteria 5306
84 Ga0207639_10050602 3300026041 Bacteria 3156
85 Ga0207702_10000001 3300026078 Bacteria 895738
86 Ga0207702_10000079 3300026078 Bacteria 110210
87 Ga0207676_10690211 3300026095 Bacteria 988
88 Ga0207674_10000486 3300026116 Bacteria 52406
89 Ga0207698_10000820 3300026142 Bacteria 18049
90 Ga0268264_10338174 3300028381 Bacteria 1429
91 Ga0265337_1000048 3300028556 Bacteria 53749
92 Ga0265337_1000298 3300028556 Bacteria 26553
93 Ga0265326_10001696 3300028558 Bacteria 7622
94 Ga0265319_1007955 3300028563 Bacteria 4699
95 Ga0265334_10000039 3300028573 Bacteria 100608
96 Ga0265334_10104669 3300028573 Bacteria 1021
97 Ga0265338_10000003 3300028800 Bacteria 733923
98 Ga0265338_10002586 3300028800 Bacteria 26752
99 Ga0265338_10006376 3300028800 Bacteria 15057
100 Ga0265338_10009618 3300028800 Bacteria 11484
101 Ga0265338_10014791 3300028800 Bacteria 8637
102 Ga0265338_10028070 3300028800 Bacteria 5625
103 Ga0265338_10235473 3300028800 Bacteria 1359
104 Ga0316179_1028359 3300030734 Bacteria 22140
105 Ga0316183_1005108 3300030742 Unclassified 1368
106 Ga0316183_1172979 3300030742 Bacteria 6723
107 Ga0316182_1014140 3300030745 Bacteria 16354
108 Ga0316182_1188782 3300030745 Bacteria 15742
109 Ga0265320_10007451 3300031240 Bacteria 6789
110 Ga0265327_10000025 3300031251 Bacteria 380054
111 Ga0265327_10000260 3300031251 Bacteria 104663
112 Ga0265313_10005264 3300031595 Bacteria 9577
113 Ga0395899_0003114 3300037312 Bacteria 13213
114 Ga0395900_0016132 3300037418 Bacteria 7609
115 Ga0395900_0051907 3300037418 Unclassified 4223
116 Ga0395898_0023510 3300037466 Bacteria 6226
117 Ga0395905_0038571 3300037471 Bacteria 4483
118 Ga0395901_0016381 3300038443 Bacteria 7547
119 Ga0395901_0518505 3300038443 Bacteria 1211
120 Ga0439436_0045988 3300041404 Unclassified 1241
121 Ga0439438_031801 3300041405 Bacteria 1401
122 Ga0439461_0020626 3300041410 Unclassified 1306
123 Ga0439442_016370 3300042002 Bacteria 1529
124 Ga0439452_059408 3300042010 Unclassified 859
125 Ga0439434_0028397 3300042435 Bacteria 1693
126 Ga0495588_0000594 3300046674 Bacteria 17175
127 Ga0495672_0155452 3300047320 Bacteria 1182
128 Ga0495672_0157352 3300047320 Unclassified 1172
129 Ga0496115_0000001 3300048918 Bacteria 367230
130 Ga0501034_0001207 3300049571 Bacteria 35479
131 Ga0501037_0000001 3300049573 Bacteria 753276
132 Ga0501038_0101143 3300049574 Bacteria 2400
133 Ga0501080_0097404 3300049742 Bacteria 2731
134 Ga0501083_0020784 3300049744 Bacteria 4564
135 Ga0501276_000101 3300049773 Bacteria 4370
136 nmdc:mga03683_2317_c2 3300050489 Bacteria 5479
137 nmdc:mga00v17_344458_c1 3300050491 Bacteria 969
138 nmdc:mga00v17_8308_c1 3300050491 Bacteria 3310
139 nmdc:mga0yw44_114_c1 3300050492 Bacteria 28261
140 nmdc:mga0k408_32_c1 3300050493 Bacteria 81544
141 nmdc:mga0k408_498_c1 3300050493 Bacteria 21546
142 nmdc:mga0k408_5559_c1 3300050493 Bacteria 6705
143 nmdc:mga06z11_203_c1 3300050494 Bacteria 23857
144 nmdc:mga04h51_87980_c1 3300050495 Unclassified 1113
145 nmdc:mga07m45_3765_c1 3300050496 Bacteria 7337
146 nmdc:mga0sz30_2_c1 3300050516 Bacteria 626403
147 Ga0500610_0002569 3300053079 Bacteria 6742
148 Ga0500610_0032330 3300053079 Bacteria 2662
149 Ga0500643_002224 3300053087 Bacteria 10249
150 Ga0500643_007896 3300053087 Bacteria 4237
151 Ga0500644_0001390 3300053088 Bacteria 6453
152 Ga0500644_0011032 3300053088 Bacteria 2459
153 Ga0500646_0000010 3300053090 Bacteria 91525
154 Ga0500583_0000199 3300053092 Bacteria 22979
155 Ga0500583_0037797 3300053092 Unclassified 2170
156 Ga0500651_0000043 3300053093 Bacteria 86502
157 Ga0500651_0024508 3300053093 Unclassified 3783
158 Ga0500641_0000001 3300053096 Bacteria 1115973
159 Ga0500650_0001096 3300053098 Bacteria 7820
160 Ga0500555_000002 3300053103 Bacteria 1314346
161 Ga0500556_0000192 3300053104 Bacteria 49900
162 Ga0500562_000002 3300053108 Bacteria 977234
163 Ga0500593_000001 3300053117 Bacteria 784404
164 Ga0500594_0000019 3300053118 Bacteria 56688
165 Ga0500594_0000028 3300053118 Bacteria 50845
166 Ga0500614_000001 3300053123 Bacteria 1274484
167 Ga0500621_120143 3300053126 Bacteria 1018
168 Ga0500628_000005 3300053129 Bacteria 201423
169 Ga0500642_0010990 3300053130 Unclassified 3218
170 Ga0500652_000001 3300053131 Bacteria 946868
171 Ga0500652_000012 3300053131 Bacteria 155076
172 Ga0500589_000003 3300053147 Bacteria 220717
173 Ga0500616_0024645 3300053153 Bacteria 3341
174 Ga0500620_030501 3300053155 Bacteria 1702
175 Ga0500649_000006 3300053722 Bacteria 116211

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300010375 Ga0105239_10041163 Ga0105239_100411635 196
2 3300042010 Ga0439452_059408 Ga0439452_059408_201_836 199
3 3300047320 Ga0495672_0155452 Ga0495672_0155452_343_1017 211
4 3300053079 Ga0500610_0032330 Ga0500610_0032330_636_1358 213
5 3300053088 Ga0500644_0011032 Ga0500644_0011032_1271_1993 213
6 3300003323 rootH1_10328544 rootH1_103285442 214
7 3300009098 Ga0105245_10522576 Ga0105245_105225761 216
8 3300046674 Ga0495588_0000594 Ga0495588_0000594_6535_7224 216
9 3300053123 Ga0500614_000001 Ga0500614_000001_996174_996863 216
10 3300053722 Ga0500649_000006 Ga0500649_000006_89738_90427 216
11 3300009553 Ga0105249_10062105 Ga0105249_100621053 218
12 3300005843 Ga0068860_100135216 Ga0068860_1001352162 219
13 3300006353 Ga0075370_10004175 Ga0075370_100041758 219
14 3300028381 Ga0268264_10338174 Ga0268264_103381742 219
15 3300050491 nmdc:mga00v17_344458_c1 nmdc:mga00v17_344458_c1_257_955 219
16 3300050496 nmdc:mga07m45_3765_c1 nmdc:mga07m45_3765_c1_3688_4413 219
17 3300013104 Ga0157370_10206406 Ga0157370_102064062 220
18 3300013105 Ga0157369_10000003 Ga0157369_1000000354 220
19 3300053087 Ga0500643_002224 Ga0500643_002224_7933_8655 220
20 3300053103 Ga0500555_000002 Ga0500555_000002_1234702_1235424 220
21 3300053131 Ga0500652_000012 Ga0500652_000012_51983_52705 220
22 3300005539 Ga0068853_100089775 Ga0068853_1000897752 222
23 3300026041 Ga0207639_10050602 Ga0207639_100506025 222
24 3300028563 Ga0265319_1007955 Ga0265319_10079555 223
25 3300028800 Ga0265338_10009618 Ga0265338_100096185 223
26 3300031240 Ga0265320_10007451 Ga0265320_100074515 223
27 3300037312 Ga0395899_0003114 Ga0395899_0003114_4237_4959 224
28 3300037418 Ga0395900_0016132 Ga0395900_0016132_4237_4959 224
29 3300037466 Ga0395898_0023510 Ga0395898_0023510_2689_3411 224
30 3300037471 Ga0395905_0038571 Ga0395905_0038571_3496_4218 224
31 3300038443 Ga0395901_0016381 Ga0395901_0016381_4051_4773 224
32 3300005329 Ga0070683_100000380 Ga0070683_10000038020 226
33 3300005347 Ga0070668_100449640 Ga0070668_1004496402 226
34 3300005535 Ga0070684_100000280 Ga0070684_1000002809 226
35 3300005614 Ga0068856_100000002 Ga0068856_100000002333 226
36 3300006051 Ga0075364_10005269 Ga0075364_100052696 226
37 3300006178 Ga0075367_10000017 Ga0075367_100000173 226
38 3300006186 Ga0075369_10000004 Ga0075369_10000004105 226
39 3300006195 Ga0075366_10000095 Ga0075366_1000009534 226
40 3300013297 Ga0157378_10113851 Ga0157378_101138513 226
41 3300025944 Ga0207661_10001467 Ga0207661_1000146711 226
42 3300025961 Ga0207712_10005969 Ga0207712_100059697 226
43 3300025972 Ga0207668_10479669 Ga0207668_104796691 226
44 3300026078 Ga0207702_10000001 Ga0207702_1000000199 226
45 3300049773 Ga0501276_000101 Ga0501276_000101_1827_2546 226
46 3300050491 nmdc:mga00v17_8308_c1 nmdc:mga00v17_8308_c1_1689_2408 226
47 3300050493 nmdc:mga0k408_32_c1 nmdc:mga0k408_32_c1_24012_24731 226
48 3300050494 nmdc:mga06z11_203_c1 nmdc:mga06z11_203_c1_1257_1976 226
49 3300050516 nmdc:mga0sz30_2_c1 nmdc:mga0sz30_2_c1_124056_124775 226
50 3300053079 Ga0500610_0002569 Ga0500610_0002569_633_1352 226
51 3300053093 Ga0500651_0024508 Ga0500651_0024508_2768_3487 226
52 3300053104 Ga0500556_0000192 Ga0500556_0000192_9855_10571 226
53 3300053126 Ga0500621_120143 Ga0500621_120143_261_980 226
54 3300053130 Ga0500642_0010990 Ga0500642_0010990_1207_1926 226
55 3300053147 Ga0500589_000003 Ga0500589_000003_53006_53725 226
56 3300005530 Ga0070679_100299035 Ga0070679_1002990352 227
57 3300005535 Ga0070684_100013425 Ga0070684_1000134255 227
58 3300005563 Ga0068855_100173746 Ga0068855_1001737462 227
59 3300005577 Ga0068857_100000266 Ga0068857_10000026617 227
60 3300005614 Ga0068856_100000441 Ga0068856_10000044118 227
61 3300005616 Ga0068852_100000621 Ga0068852_1000006213 227
62 3300005618 Ga0068864_100838212 Ga0068864_1008382122 227
63 3300006237 Ga0097621_100017864 Ga0097621_1000178648 227
64 3300009551 Ga0105238_10040510 Ga0105238_100405103 227
65 3300011119 Ga0105246_10000177 Ga0105246_1000017717 227
66 3300013100 Ga0157373_10009954 Ga0157373_100099548 227
67 3300013104 Ga0157370_10001387 Ga0157370_1000138731 227
68 3300013105 Ga0157369_10000826 Ga0157369_1000082631 227
69 3300014969 Ga0157376_10000223 Ga0157376_1000022330 227
70 3300025924 Ga0207694_10064726 Ga0207694_100647263 227
71 3300025949 Ga0207667_10728993 Ga0207667_107289932 227
72 3300026078 Ga0207702_10000079 Ga0207702_1000007952 227
73 3300026095 Ga0207676_10690211 Ga0207676_106902111 227
74 3300026116 Ga0207674_10000486 Ga0207674_1000048624 227
75 3300026142 Ga0207698_10000820 Ga0207698_1000082018 227
76 3300031251 Ga0265327_10000025 Ga0265327_1000002539 227
77 3300031251 Ga0265327_10000260 Ga0265327_1000026088 227
78 3300049742 Ga0501080_0097404 Ga0501080_0097404_452_1174 227
79 3300050495 nmdc:mga04h51_87980_c1 nmdc:mga04h51_87980_c1_282_1004 227
80 3300053117 Ga0500593_000001 Ga0500593_000001_223608_224330 227
81 3300005327 Ga0070658_10000076 Ga0070658_1000007613 228
82 3300005339 Ga0070660_100000148 Ga0070660_10000014834 228
83 3300005367 Ga0070667_100000503 Ga0070667_10000050313 228
84 3300005530 Ga0070679_100006731 Ga0070679_1000067313 228
85 3300005530 Ga0070679_100043753 Ga0070679_1000437533 228
86 3300006038 Ga0075365_10005061 Ga0075365_100050617 228
87 3300006177 Ga0075362_10018123 Ga0075362_100181233 228
88 3300006237 Ga0097621_100112039 Ga0097621_1001120392 228
89 3300006358 Ga0068871_100803104 Ga0068871_1008031041 228
90 3300009093 Ga0105240_10000030 Ga0105240_10000030321 228
91 3300009101 Ga0105247_10451131 Ga0105247_104511312 228
92 3300009545 Ga0105237_10000001 Ga0105237_1000000154 228
93 3300009551 Ga0105238_10024039 Ga0105238_100240394 228
94 3300013104 Ga0157370_10000232 Ga0157370_1000023257 228
95 3300013105 Ga0157369_10068429 Ga0157369_100684292 228
96 3300013307 Ga0157372_10000007 Ga0157372_1000000754 228
97 3300025909 Ga0207705_10000019 Ga0207705_10000019270 228
98 3300025913 Ga0207695_10000009 Ga0207695_1000000955 228
99 3300025914 Ga0207671_10000003 Ga0207671_1000000355 228
100 3300025919 Ga0207657_10000547 Ga0207657_1000054718 228
101 3300025921 Ga0207652_10018148 Ga0207652_1001814810 228
102 3300025921 Ga0207652_10073716 Ga0207652_100737164 228
103 3300025986 Ga0207658_10015037 Ga0207658_100150372 228
104 3300028573 Ga0265334_10104669 Ga0265334_101046692 228
105 3300028800 Ga0265338_10002586 Ga0265338_100025863 228
106 3300028800 Ga0265338_10006376 Ga0265338_100063764 228
107 3300028800 Ga0265338_10028070 Ga0265338_100280705 228
108 3300028800 Ga0265338_10235473 Ga0265338_102354731 228
109 3300038443 Ga0395901_0518505 Ga0395901_0518505_439_1161 228
110 3300047320 Ga0495672_0157352 Ga0495672_0157352_155_880 228
111 3300050489 nmdc:mga03683_2317_c2 nmdc:mga03683_2317_c2_1966_2691 228
112 3300050492 nmdc:mga0yw44_114_c1 nmdc:mga0yw44_114_c1_25067_25792 228
113 3300050493 nmdc:mga0k408_498_c1 nmdc:mga0k408_498_c1_14709_15434 228
114 3300053088 Ga0500644_0001390 Ga0500644_0001390_2800_3525 228
115 3300053092 Ga0500583_0037797 Ga0500583_0037797_597_1319 228
116 3300053118 Ga0500594_0000019 Ga0500594_0000019_35164_35889 228
117 3300053129 Ga0500628_000005 Ga0500628_000005_109637_110362 228
118 3300005937 Ga0081455_10000006 Ga0081455_10000006216 229
119 3300006028 Ga0070717_10227524 Ga0070717_102275242 229
120 3300013105 Ga0157369_10001538 Ga0157369_1000153823 229
121 3300013105 Ga0157369_10138712 Ga0157369_101387122 229
122 3300013105 Ga0157369_10161422 Ga0157369_101614222 229
123 3300028556 Ga0265337_1000298 Ga0265337_10002989 229
124 3300028558 Ga0265326_10001696 Ga0265326_100016969 229
125 3300028573 Ga0265334_10000039 Ga0265334_1000003954 229
126 3300028800 Ga0265338_10000003 Ga0265338_10000003770 229
127 3300030742 Ga0316183_1005108 Ga0316183_10051082 229
128 3300030745 Ga0316182_1188782 Ga0316182_11887824 229
129 3300031595 Ga0265313_10005264 Ga0265313_100052647 229
130 3300041404 Ga0439436_0045988 Ga0439436_0045988_148_873 229
131 3300041405 Ga0439438_031801 Ga0439438_031801_486_1211 229
132 3300041410 Ga0439461_0020626 Ga0439461_0020626_154_879 229
133 3300042002 Ga0439442_016370 Ga0439442_016370_465_1190 229
134 3300042435 Ga0439434_0028397 Ga0439434_0028397_343_1068 229
135 3300049571 Ga0501034_0001207 Ga0501034_0001207_34079_34804 229
136 3300003320 rootH2_10287045 rootH2_102870451 230
137 3300005563 Ga0068855_100000001 Ga0068855_100000001830 230
138 3300005563 Ga0068855_100001316 Ga0068855_10000131621 230
139 3300006195 Ga0075366_10018187 Ga0075366_100181874 230
140 3300009174 Ga0105241_10000009 Ga0105241_10000009205 230
141 3300013105 Ga0157369_10000227 Ga0157369_1000022769 230
142 3300025911 Ga0207654_10000002 Ga0207654_1000000272 230
143 3300025949 Ga0207667_10000003 Ga0207667_10000003813 230
144 3300025949 Ga0207667_10024352 Ga0207667_100243522 230
145 3300037418 Ga0395900_0051907 Ga0395900_0051907_1740_2474 230
146 3300049573 Ga0501037_0000001 Ga0501037_0000001_701356_702084 230
147 3300049574 Ga0501038_0101143 Ga0501038_0101143_1596_2324 230
148 3300050493 nmdc:mga0k408_5559_c1 nmdc:mga0k408_5559_c1_1735_2460 230
149 3300053087 Ga0500643_007896 Ga0500643_007896_1361_2092 230
150 3300053093 Ga0500651_0000043 Ga0500651_0000043_58776_59507 230
151 3300053108 Ga0500562_000002 Ga0500562_000002_300253_300987 230
152 3300053118 Ga0500594_0000028 Ga0500594_0000028_26998_27729 230
153 3300053153 Ga0500616_0024645 Ga0500616_0024645_2531_3259 230
154 3300005530 Ga0070679_100133284 Ga0070679_1001332842 231
155 3300030734 Ga0316179_1028359 Ga0316179_10283592 231
156 3300030742 Ga0316183_1172979 Ga0316183_11729794 231
157 3300030745 Ga0316182_1014140 Ga0316182_101414010 231
158 3300049744 Ga0501083_0020784 Ga0501083_0020784_3239_3994 231
159 3300053090 Ga0500646_0000010 Ga0500646_0000010_40813_41541 231
160 3300053092 Ga0500583_0000199 Ga0500583_0000199_11574_12302 231
161 3300053096 Ga0500641_0000001 Ga0500641_0000001_711923_712651 231
162 3300053098 Ga0500650_0001096 Ga0500650_0001096_4497_5225 231
163 3300053131 Ga0500652_000001 Ga0500652_000001_768777_769505 231
164 3300053155 Ga0500620_030501 Ga0500620_030501_456_1184 231
165 3300009993 Ga0105028_101565 Ga0105028_1015652 232
166 3300013307 Ga0157372_10000096 Ga0157372_1000009653 233
167 3300005563 Ga0068855_100017269 Ga0068855_1000172697 234
168 3300005578 Ga0068854_100007645 Ga0068854_1000076452 234
169 3300009979 Ga0105032_100012 Ga0105032_10001228 234
170 3300025949 Ga0207667_10015416 Ga0207667_100154167 234
171 3300025981 Ga0207640_10013201 Ga0207640_100132012 234
172 3300028556 Ga0265337_1000048 Ga0265337_100004859 238
173 3300028800 Ga0265338_10014791 Ga0265338_100147916 238
174 3300048918 Ga0496115_0000001 Ga0496115_0000001_363125_363895 238
175 3300003316 rootH1_10028420 rootH1_100284202 239

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01479

S4

S4 domain

5

52

0.98

PF01728

FtsJ

FtsJ-like methyltransferase

60

266

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5opt-assembly1.cif.gz_b structure of ksrp in context of trypanosoma cruzi 40s 0.9581 5 49
4v73-assembly1.cif.gz_AD e. coli 70s-fmetval-trnaval-trnafmet complex in hybrid pre-translocation state (pre5a) 0.9474 5 53
8ced-assembly1.cif.gz_F rnase r bound to a 30s degradation intermediate (state i - head-turning) 0.9471 5 53
6hb6-assembly1.cif.gz_A crystal structure of e. coli tyrrs in complex with 5'-o-(n-l-tyrosyl)sulfamoyl-uridine 0.9442 4 46
7r81-assembly1.cif.gz_K2 structure of the translating neurospora crassa ribosome arrested by cycloheximide 0.9428 5 53
ID Description Score Start End Superfamily
af_Q8I5D3_12_67_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.951 4 54 3.10.290.10
af_O60063_95_238_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9367 5 53 3.10.290.10
af_P0AAS7_1_70_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9324 3 53 3.10.290.10
af_Q9LSV5_49_110_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9289 2 58 3.10.290.10
af_A0A1D6JNZ0_152_214_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9228 3 54 3.10.290.10
ID Description Score Start End GO Terms
AF-A0A4Q5NGB9-F1-model_v4 deleted 0.9255 137 228
AF-A0A7W4HSB4-F1-model_v4 TlyA family RNA methyltransferase 0.9102 1 228 GO:0003723
GO:0008168
GO:0032259
AF-A0A4Q5NGB9-F1-model_v4 deleted 0.8977 137 228
AF-A0A8A6L6Y6-F1-model_v4 deleted 0.8824 2 228
AF-A0A7W4HSB4-F1-model_v4 TlyA family RNA methyltransferase 0.8661 1 228 GO:0003723
GO:0008168
GO:0032259

Feature Viewer

pLDDT pTM Quality
84.12 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map