F266353

General Info

Members Datasets Scaffolds Average Seq Length
175 111 350 342

Family's Representative Sequence

Representative Sequence 3300013297|Ga0157378_10357672|Ga0157378_103576721
Length 392
Sequence MTTLPTTMPAVVFRGKGDLQVEDLPVPEVGDDDVLIEVSHCGVCGSDLHMILDGWGRPGSVEGHEWSGVVIAVGDAVKEWKVGDHIVGGPSPRCGECEMCRTGHPSLCSQRGTPGMGGGDHQGAYARYIRQRENEIRRIPEGLSLREAALAEPLAVALHGITNSNVQPGERVLVLGAGPIGALTIAALGAMGVEGIKVSEPSPLRQELARKLGAAVVIGPDDLEVPGPFDPGHIVDDAVDVVLECSGHGSAMEAGLGQLKRRGRLVLVGAGMAAPKFDPNRILLNELVITGAFCYDADGFDRSLELLASGKLPLADLIDPVDEQVPLCAHAQARVARHQLVEQRGPWGPSKLACMHGNGDRVDTVGVGVCQHRSTTHDQCRLSSPHRAEDGE

Samples

Sample ID Description Type Environment
1 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
2 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
3 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
4 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
5 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
6 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
7 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
8 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
9 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
10 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
11 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
12 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
13 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
14 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
15 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
16 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
17 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
18 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
19 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
20 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
21 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
22 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
25 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
27 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
28 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
29 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
30 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
31 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
32 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
33 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
34 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
35 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
36 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
37 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
38 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
39 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
40 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
41 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
42 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
43 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
44 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
45 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
46 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
47 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
48 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
49 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
50 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
51 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
52 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
53 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
54 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
55 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
56 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
57 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
58 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
59 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
60 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
61 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
62 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
63 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
64 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
65 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
66 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
67 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
68 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
69 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
70 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
71 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
72 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
73 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
74 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
75 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
76 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
77 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
78 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
79 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
80 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
81 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
82 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
83 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
84 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
85 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
86 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
87 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
88 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
89 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
90 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
91 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
92 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
93 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
94 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
95 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
96 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
97 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
98 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
99 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
100 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
101 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
102 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
103 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
104 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
105 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
106 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
107 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
108 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
109 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
110 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
111 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.14
Nodule 0
Rhizoplane 4.57
Rhizosphere 93.14
Stem 0
Stem Tuber 0
Unclassified 8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157378_10357672 3300013297 Bacteria 1428
2 Ga0070708_100001898 3300005445 Bacteria 16073
3 Ga0070704_100111961 3300005549 Bacteria 2079
4 Ga0068859_100560209 3300005617 Unclassified 1237
5 Ga0070712_100053065 3300006175 Bacteria 2830
6 Ga0075428_100000048 3300006844 Bacteria 96714
7 Ga0075428_100019130 3300006844 Bacteria 7574
8 Ga0075428_100054300 3300006844 Bacteria 4391
9 Ga0075430_100003926 3300006846 Bacteria 12539
10 Ga0075430_100078502 3300006846 Bacteria 2767
11 Ga0075430_100128731 3300006846 Bacteria 2110
12 Ga0075431_100037061 3300006847 Bacteria 5024
13 Ga0075431_100109578 3300006847 Bacteria 2850
14 Ga0075434_100290620 3300006871 Bacteria 1654
15 Ga0075429_100020725 3300006880 Bacteria 5706
16 Ga0075429_100101375 3300006880 Bacteria 2513
17 Ga0097620_100560121 3300006931 Unclassified 1237
18 Ga0075435_100244497 3300007076 Unclassified 1527
19 Ga0111539_10054767 3300009094 Bacteria 4744
20 Ga0111539_10183594 3300009094 Bacteria 2443
21 Ga0111539_10395585 3300009094 Bacteria 1609
22 Ga0105245_10003895 3300009098 Bacteria 13267
23 Ga0114129_10002474 3300009147 Bacteria 25654
24 Ga0114129_10060597 3300009147 Bacteria 5291
25 Ga0114129_10084410 3300009147 Bacteria 4410
26 Ga0114129_10170708 3300009147 Bacteria 2965
27 Ga0105241_10359648 3300009174 Bacteria 1266
28 Ga0105238_10087844 3300009551 Bacteria 3095
29 Ga0105249_10044320 3300009553 Bacteria 4046
30 Ga0157374_10155699 3300013296 Bacteria 2224
31 Ga0163162_10465393 3300013306 Bacteria 1396
32 Ga0213876_10060960 3300021384 Bacteria 1990
33 Ga0207684_10138908 3300025910 Bacteria 2088
34 Ga0207679_10270065 3300025945 Bacteria 1454
35 Ga0207675_100359041 3300026118 Bacteria 1429
36 Ga0268266_10302022 3300028379 Bacteria 1494
37 Ga0265319_1047373 3300028563 Bacteria 1431
38 Ga0265334_10007429 3300028573 Bacteria 4701
39 Ga0265338_10000152 3300028800 Bacteria 126250
40 Ga0265338_10000241 3300028800 Bacteria 101431
41 Ga0265325_10004019 3300031241 Bacteria 9392
42 Ga0265325_10009866 3300031241 Bacteria 5560
43 Ga0265339_10001713 3300031249 Bacteria 16154
44 Ga0265339_10002518 3300031249 Bacteria 13082
45 Ga0265316_10063240 3300031344 Bacteria 2870
46 Ga0265316_10140498 3300031344 Bacteria 1814
47 Ga0265313_10000266 3300031595 Bacteria 57212
48 Ga0265313_10001145 3300031595 Bacteria 25330
49 Ga0265314_10077636 3300031711 Bacteria 2202
50 Ga0307413_10017336 3300031824 Bacteria 3748
51 Ga0307409_100001185 3300031995 Bacteria 12482
52 Ga0307416_100031981 3300032002 Bacteria 3969
53 Ga0307415_100023194 3300032126 Bacteria 3848
54 Ga0373943_0005483 3300035170 Bacteria 5707
55 Ga0373955_0104328 3300035172 Unclassified 1631
56 Ga0373961_0048436 3300035241 Unclassified 1252
57 Ga0373935_0118691 3300035692 Bacteria 1764
58 Ga0373933_0089159 3300035724 Bacteria 1901
59 Ga0373933_0092607 3300035724 Bacteria 1867
60 Ga0373933_0141512 3300035724 Bacteria 1519
61 Ga0373937_0057473 3300036401 Bacteria 3574
62 Ga0373937_0099807 3300036401 Bacteria 2693
63 Ga0436365_0529345 3300039437 Bacteria 33749
64 Ga0436360_1265353 3300039438 Bacteria 2723
65 Ga0436362_0256593 3300039453 Bacteria 2757
66 Ga0436362_0837403 3300039453 Bacteria 6108
67 Ga0466967_0027439 3300045976 Bacteria 4737
68 Ga0466967_0070474 3300045976 Bacteria 3128
69 Ga0466967_0546382 3300045976 Unclassified 1140
70 Ga0495592_0162588 3300046454 Unclassified 1535
71 Ga0495629_0045990 3300046459 Bacteria 3062
72 Ga0495651_0013374 3300046462 Bacteria 6348
73 Ga0495608_0027422 3300046511 Bacteria 3875
74 Ga0495618_0120896 3300046514 Unclassified 1677
75 Ga0495628_0140443 3300046516 Bacteria 1844
76 Ga0495630_0015562 3300046517 Bacteria 5556
77 Ga0495630_0108484 3300046517 Bacteria 2103
78 Ga0495652_0155817 3300046529 Bacteria 1779
79 Ga0495586_0009383 3300046535 Bacteria 5207
80 Ga0495587_0032683 3300046536 Bacteria 3144
81 Ga0495645_0136288 3300046543 Bacteria 1717
82 Ga0495645_0253132 3300046543 Bacteria 1170
83 Ga0495667_0010724 3300046559 Bacteria 6197
84 Ga0495634_0002689 3300046642 Bacteria 14612
85 Ga0495657_0004485 3300046675 Bacteria 11160
86 Ga0495623_0023087 3300046679 Bacteria 4016
87 Ga0495647_0020665 3300046681 Bacteria 2366
88 Ga0495613_0000400 3300046689 Bacteria 37128
89 Ga0495624_0060389 3300046690 Bacteria 2377
90 Ga0495604_0053055 3300047317 Bacteria 3137
91 Ga0495604_0241834 3300047317 Bacteria 1234
92 Ga0495674_0055449 3300047319 Bacteria 3476
93 Ga0495674_0470085 3300047319 Unclassified 1009
94 Ga0495672_0015492 3300047320 Bacteria 5174
95 Ga0495680_0016493 3300047322 Bacteria 6342
96 Ga0495680_0069053 3300047322 Bacteria 2698
97 Ga0495614_0020911 3300048089 Bacteria 2828
98 Ga0496105_0060168 3300048908 Bacteria 3134
99 Ga0496108_0062343 3300048911 Bacteria 3140
100 Ga0496109_0045343 3300048912 Bacteria 3989
101 Ga0496110_0122622 3300048913 Bacteria 2343
102 Ga0496112_0004367 3300048915 Bacteria 11964
103 Ga0496112_0122154 3300048915 Bacteria 2575
104 Ga0496113_0191224 3300048916 Bacteria 1625
105 Ga0496114_0176749 3300048917 Bacteria 1863
106 Ga0501032_0046524 3300049569 Bacteria 2933
107 Ga0501034_0003188 3300049571 Bacteria 18862
108 Ga0501034_0019612 3300049571 Bacteria 6914
109 Ga0501036_0264356 3300049572 Bacteria 1441
110 Ga0501037_0031364 3300049573 Bacteria 3924
111 Ga0501037_0060394 3300049573 Bacteria 2765
112 Ga0501040_0010209 3300049576 Bacteria 6140
113 Ga0501046_0005969 3300049580 Bacteria 10840
114 Ga0501048_0009510 3300049582 Bacteria 7295
115 Ga0501067_0109855 3300049583 Bacteria 1533
116 Ga0501068_0114400 3300049584 Bacteria 1679
117 Ga0501068_0214294 3300049584 Unclassified 1223
118 Ga0501069_0000025 3300049585 Bacteria 109731
119 Ga0501069_0001755 3300049585 Bacteria 10818
120 Ga0501070_0000026 3300049586 Bacteria 150349
121 Ga0501070_0000325 3300049586 Bacteria 43267
122 Ga0501070_0015329 3300049586 Bacteria 6449
123 Ga0501070_0037759 3300049586 Bacteria 4031
124 Ga0501070_0081674 3300049586 Bacteria 2675
125 Ga0501070_0126495 3300049586 Bacteria 2112
126 Ga0501070_0201281 3300049586 Bacteria 1635
127 Ga0501071_0016129 3300049587 Bacteria 5136
128 Ga0501071_0178494 3300049587 Bacteria 1591
129 Ga0501072_0005431 3300049588 Bacteria 9704
130 Ga0501072_0130478 3300049588 Bacteria 2003
131 Ga0501072_0132248 3300049588 Bacteria 1989
132 Ga0501073_0001818 3300049589 Bacteria 15876
133 Ga0501073_0022200 3300049589 Bacteria 4573
134 Ga0501073_0022945 3300049589 Bacteria 4488
135 Ga0501074_0030869 3300049590 Bacteria 3882
136 Ga0501075_0003862 3300049591 Bacteria 10092
137 Ga0501077_0004368 3300049593 Bacteria 8577
138 Ga0501079_0010444 3300049741 Bacteria 7059
139 Ga0501079_0122822 3300049741 Bacteria 2020
140 Ga0501079_0139469 3300049741 Bacteria 1888
141 Ga0501080_0000096 3300049742 Bacteria 59454
142 Ga0501080_0001092 3300049742 Bacteria 22354
143 Ga0501080_0003656 3300049742 Bacteria 13569
144 Ga0501080_0022445 3300049742 Bacteria 5847
145 Ga0501080_0156363 3300049742 Bacteria 2106
146 Ga0501081_0010236 3300049743 Bacteria 6122
147 Ga0501081_0103385 3300049743 Bacteria 2016
148 Ga0501083_0003618 3300049744 Bacteria 10841
149 Ga0501083_0077577 3300049744 Bacteria 2204
150 Ga0501044_0000201 3300049823 Bacteria 75685
151 nmdc:mga0yw44_23068_c1 3300050492 Bacteria 3501
152 nmdc:mga05p37_11559_c1 3300050507 Bacteria 10516
153 nmdc:mga05p37_3375_c1 3300050507 Bacteria 18635
154 nmdc:mga05p37_528311_c1 3300050507 Unclassified 1348
155 nmdc:mga05p37_67191_c1 3300050507 Bacteria 4410
156 nmdc:mga09592_170300_c1 3300050508 Bacteria 1883
157 nmdc:mga09592_9639_c1 3300050508 Bacteria 7847
158 nmdc:mga0qj67_131869_c1 3300050509 Bacteria 2024
159 nmdc:mga0qj67_8546_c1 3300050509 Bacteria 7601
160 nmdc:mga06r32_26263_c1 3300050510 Bacteria 5428
161 nmdc:mga06r32_43811_c1 3300050510 Bacteria 4259
162 nmdc:mga08y16_170250_c1 3300050511 Unclassified 2262
163 nmdc:mga08y16_98057_c1 3300050511 Bacteria 3052
164 nmdc:mga0n895_466472_c1 3300050512 Bacteria 1274
165 nmdc:mga0n895_477254_c1 3300050512 Unclassified 1258
166 Ga0495595_0024924 3300053084 Bacteria 2645
167 Ga0495595_0066068 3300053084 Unclassified 1702
168 Ga0495619_0007457 3300053085 Bacteria 6930
169 Ga0495619_0032023 3300053085 Bacteria 3410
170 Ga0495619_0099571 3300053085 Bacteria 1977
171 Ga0500616_0001415 3300053153 Bacteria 23131
172 Ga0501084_0000675 3300054114 Bacteria 26009
173 Ga0501084_0001982 3300054114 Bacteria 16341
174 Ga0501084_0005517 3300054114 Bacteria 10386
175 Ga0501082_0531647 3300060353 Bacteria 1028
176 Ga0157378_10357672
177 Ga0070708_100001898
178 Ga0070704_100111961
179 Ga0068859_100560209
180 Ga0070712_100053065
181 Ga0075428_100000048
182 Ga0075428_100019130
183 Ga0075428_100054300
184 Ga0075430_100003926
185 Ga0075430_100078502
186 Ga0075430_100128731
187 Ga0075431_100037061
188 Ga0075431_100109578
189 Ga0075434_100290620
190 Ga0075429_100020725
191 Ga0075429_100101375
192 Ga0097620_100560121
193 Ga0075435_100244497
194 Ga0111539_10054767
195 Ga0111539_10183594
196 Ga0111539_10395585
197 Ga0105245_10003895
198 Ga0114129_10002474
199 Ga0114129_10060597
200 Ga0114129_10084410
201 Ga0114129_10170708
202 Ga0105241_10359648
203 Ga0105238_10087844
204 Ga0105249_10044320
205 Ga0157374_10155699
206 Ga0163162_10465393
207 Ga0213876_10060960
208 Ga0207684_10138908
209 Ga0207679_10270065
210 Ga0207675_100359041
211 Ga0268266_10302022
212 Ga0265319_1047373
213 Ga0265334_10007429
214 Ga0265338_10000152
215 Ga0265338_10000241
216 Ga0265325_10004019
217 Ga0265325_10009866
218 Ga0265339_10001713
219 Ga0265339_10002518
220 Ga0265316_10063240
221 Ga0265316_10140498
222 Ga0265313_10000266
223 Ga0265313_10001145
224 Ga0265314_10077636
225 Ga0307413_10017336
226 Ga0307409_100001185
227 Ga0307416_100031981
228 Ga0307415_100023194
229 Ga0373943_0005483
230 Ga0373955_0104328
231 Ga0373961_0048436
232 Ga0373935_0118691
233 Ga0373933_0089159
234 Ga0373933_0092607
235 Ga0373933_0141512
236 Ga0373937_0057473
237 Ga0373937_0099807
238 Ga0436365_0529345
239 Ga0436360_1265353
240 Ga0436362_0256593
241 Ga0436362_0837403
242 Ga0466967_0027439
243 Ga0466967_0070474
244 Ga0466967_0546382
245 Ga0495592_0162588
246 Ga0495629_0045990
247 Ga0495651_0013374
248 Ga0495608_0027422
249 Ga0495618_0120896
250 Ga0495628_0140443
251 Ga0495630_0015562
252 Ga0495630_0108484
253 Ga0495652_0155817
254 Ga0495586_0009383
255 Ga0495587_0032683
256 Ga0495645_0136288
257 Ga0495645_0253132
258 Ga0495667_0010724
259 Ga0495634_0002689
260 Ga0495657_0004485
261 Ga0495623_0023087
262 Ga0495647_0020665
263 Ga0495613_0000400
264 Ga0495624_0060389
265 Ga0495604_0053055
266 Ga0495604_0241834
267 Ga0495674_0055449
268 Ga0495674_0470085
269 Ga0495672_0015492
270 Ga0495680_0016493
271 Ga0495680_0069053
272 Ga0495614_0020911
273 Ga0496105_0060168
274 Ga0496108_0062343
275 Ga0496109_0045343
276 Ga0496110_0122622
277 Ga0496112_0004367
278 Ga0496112_0122154
279 Ga0496113_0191224
280 Ga0496114_0176749
281 Ga0501032_0046524
282 Ga0501034_0003188
283 Ga0501034_0019612
284 Ga0501036_0264356
285 Ga0501037_0031364
286 Ga0501037_0060394
287 Ga0501040_0010209
288 Ga0501046_0005969
289 Ga0501048_0009510
290 Ga0501067_0109855
291 Ga0501068_0114400
292 Ga0501068_0214294
293 Ga0501069_0000025
294 Ga0501069_0001755
295 Ga0501070_0000026
296 Ga0501070_0000325
297 Ga0501070_0015329
298 Ga0501070_0037759
299 Ga0501070_0081674
300 Ga0501070_0126495
301 Ga0501070_0201281
302 Ga0501071_0016129
303 Ga0501071_0178494
304 Ga0501072_0005431
305 Ga0501072_0130478
306 Ga0501072_0132248
307 Ga0501073_0001818
308 Ga0501073_0022200
309 Ga0501073_0022945
310 Ga0501074_0030869
311 Ga0501075_0003862
312 Ga0501077_0004368
313 Ga0501079_0010444
314 Ga0501079_0122822
315 Ga0501079_0139469
316 Ga0501080_0000096
317 Ga0501080_0001092
318 Ga0501080_0003656
319 Ga0501080_0022445
320 Ga0501080_0156363
321 Ga0501081_0010236
322 Ga0501081_0103385
323 Ga0501083_0003618
324 Ga0501083_0077577
325 Ga0501044_0000201
326 nmdc:mga0yw44_23068_c1
327 nmdc:mga05p37_11559_c1
328 nmdc:mga05p37_3375_c1
329 nmdc:mga05p37_528311_c1
330 nmdc:mga05p37_67191_c1
331 nmdc:mga09592_170300_c1
332 nmdc:mga09592_9639_c1
333 nmdc:mga0qj67_131869_c1
334 nmdc:mga0qj67_8546_c1
335 nmdc:mga06r32_26263_c1
336 nmdc:mga06r32_43811_c1
337 nmdc:mga08y16_170250_c1
338 nmdc:mga08y16_98057_c1
339 nmdc:mga0n895_466472_c1
340 nmdc:mga0n895_477254_c1
341 Ga0495595_0024924
342 Ga0495595_0066068
343 Ga0495619_0007457
344 Ga0495619_0032023
345 Ga0495619_0099571
346 Ga0500616_0001415
347 Ga0501084_0000675
348 Ga0501084_0001982
349 Ga0501084_0005517
350 Ga0501082_0531647

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

179

309

0.89

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

30

141

0.89

PF16912

Glu_dehyd_C

Glucose dehydrogenase C-terminus

139

339

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
5oc3-assembly2.cif.gz_B crystal structure of ser67cys/pro121cys amadoriase i mutant from aspergillus fumigatus 0.9701 164 195
5oc2-assembly2.cif.gz_B crystal structure of asp295cys/lys303cys amadoriase i mutant from aspergillus fumigatus 0.9596 164 195
3djd-assembly1.cif.gz_A crystal structure of the deglycating enzyme fructosamine oxidase from aspergillus fumigatus (amadoriase ii) 0.9573 164 195
1gt8-assembly1.cif.gz_B dihydropyrimidine dehydrogenase (dpd) from pig, ternary complex with nadph and uracil-4-acetic acid 0.9091 164 197
1yy5-assembly1.cif.gz_B crystal structure of fms1, a polyamine oxidase from yeast 0.9051 164 195
ID Description Score Start End Superfamily
af_P9WNG1_4_225_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9605 164 197 3.50.50.60
af_O76383_32_486_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9429 165 197 3.50.50.60
af_A0A0R4IGI3_166_529_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9417 165 193 3.50.50.60
af_A8WHP1_6_481_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9384 165 197 3.50.50.60
af_Q5ZDX5_343_645_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9376 162 196 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A6I2V614-F1-model_v4 Alcohol dehydrogenase catalytic domain-containing protein 0.9496 1 252 GO:0008270
GO:0016491
AF-A0A261D0U9-F1-model_v4 Alcohol dehydrogenase 0.9298 1 342 GO:0008270
GO:0016491
AF-A0A2A7NFV2-F1-model_v4 Alcohol dehydrogenase 0.9244 1 342 GO:0008270
GO:0016491
AF-A0A3D2Z9V2-F1-model_v4 Alcohol dehydrogenase 0.924 1 309 GO:0016491
AF-A0A6I2V614-F1-model_v4 Alcohol dehydrogenase catalytic domain-containing protein 0.9209 1 252 GO:0008270
GO:0016491

Map