F266302

General Info

Members Datasets Scaffolds Average Seq Length
175 116 350 171

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10675451|Ga0105237_106754511
Length 182
Sequence MSETNSVVAIYETHSAAEEAIKELQKSGFDMKKMSIVGKDYHTDEHVVGYYNTGDRMKYWGKMGAFCGAIWGWLFGAAFFAIPGIGPILVAGPLVAWIVAALEGAVVVGGLSALGAGLYSIGIPKDSVVKYELALKSDKFLLMAHGTADEVAKARDIMQTTRPVEVTVHAAKREQLAGLSGR

Samples

Sample ID Description Type Environment
1 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
4 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
5 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
6 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
24 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
25 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
26 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
29 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
30 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
31 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
32 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
33 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
34 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
35 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
36 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
37 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
38 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
39 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
40 3300019182 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
41 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
42 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
65 3300030877 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
66 3300030880 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
67 3300031043 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
68 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
69 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
70 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
71 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
72 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
73 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
74 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
75 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
76 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
77 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
78 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
79 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
80 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
81 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
82 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
83 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
84 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
85 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
86 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
87 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
88 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
89 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
90 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
91 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
92 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
93 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
94 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
95 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
96 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
97 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
98 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
99 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
100 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
101 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
102 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
103 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
104 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
105 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
106 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
107 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
108 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
109 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
110 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
111 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
112 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
113 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
114 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
115 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
116 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.43
Metatranscriptomes 12.57
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.57
Nodule 0
Rhizoplane 0.57
Rhizosphere 98.86
Stem 0
Stem Tuber 0
Unclassified 33.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105237_10675451 3300009545 Bacteria 1040
2 Ga0070683_100571618 3300005329 Unclassified 1081
3 Ga0070661_100210987 3300005344 Bacteria 1486
4 Ga0070675_100705454 3300005354 Unclassified 919
5 Ga0070671_100583671 3300005355 Unclassified 965
6 Ga0070673_100436521 3300005364 Unclassified 1176
7 Ga0070673_101451002 3300005364 Unclassified 646
8 Ga0070709_10196921 3300005434 Unclassified 1425
9 Ga0070709_10484430 3300005434 Unclassified 937
10 Ga0070714_100276919 3300005435 Bacteria 1558
11 Ga0070713_100220586 3300005436 Bacteria 1720
12 Ga0070713_101177586 3300005436 Unclassified 742
13 Ga0070710_10141308 3300005437 Bacteria 1477
14 Ga0070711_100637556 3300005439 Bacteria 892
15 Ga0070681_10530900 3300005458 Unclassified 1090
16 Ga0070698_101376229 3300005471 Bacteria 656
17 Ga0070684_100295836 3300005535 Unclassified 1485
18 Ga0070684_100835417 3300005535 Unclassified 862
19 Ga0070697_101639168 3300005536 Unclassified 575
20 Ga0068853_100019757 3300005539 Bacteria 5593
21 Ga0070695_100081651 3300005545 Bacteria 2139
22 Ga0068855_100962982 3300005563 Bacteria 898
23 Ga0068857_100399003 3300005577 Bacteria 1280
24 Ga0068856_100273153 3300005614 Bacteria 1706
25 Ga0068852_100033450 3300005616 Unclassified 4268
26 Ga0068864_100147896 3300005618 Unclassified 2125
27 Ga0068858_100250927 3300005842 Unclassified 1681
28 Ga0070717_10472870 3300006028 Bacteria 1131
29 Ga0070716_100896024 3300006173 Bacteria 694
30 Ga0068871_100574808 3300006358 Bacteria 1023
31 Ga0105240_10007044 3300009093 Bacteria 16399
32 Ga0105240_10152557 3300009093 Unclassified 2750
33 Ga0105240_11089008 3300009093 Unclassified 851
34 Ga0105241_10057568 3300009174 Bacteria 2982
35 Ga0105241_10889819 3300009174 Unclassified 826
36 Ga0105248_10045199 3300009177 Bacteria 4939
37 Ga0105237_10017351 3300009545 Bacteria 7464
38 Ga0105237_10252842 3300009545 Unclassified 1764
39 Ga0105237_10272472 3300009545 Unclassified 1695
40 Ga0105238_10104847 3300009551 Bacteria 2808
41 Ga0157373_10009566 3300013100 Bacteria 7156
42 Ga0157370_10885303 3300013104 Unclassified 811
43 Ga0157369_10089522 3300013105 Unclassified 3286
44 Ga0157369_10372998 3300013105 Bacteria 1481
45 Ga0157369_10571849 3300013105 Bacteria 1167
46 Ga0157374_10271355 3300013296 Unclassified 1673
47 Ga0157374_11047948 3300013296 Unclassified 835
48 Ga0163162_10211956 3300013306 Unclassified 2067
49 Ga0157372_10174664 3300013307 Unclassified 2487
50 Ga0163163_10026350 3300014325 Bacteria 5556
51 Ga0157377_10509280 3300014745 Unclassified 843
52 Ga0157376_10439607 3300014969 Bacteria 1270
53 Ga0184598_136658 3300019182 Bacteria 1490
54 Ga0213872_10101102 3300021361 Bacteria 1285
55 Ga0207692_10112533 3300025898 Bacteria 1512
56 Ga0207699_10311861 3300025906 Unclassified 1101
57 Ga0207654_10005366 3300025911 Bacteria 6479
58 Ga0207707_10251567 3300025912 Bacteria 1535
59 Ga0207695_10004758 3300025913 Bacteria 18358
60 Ga0207695_10144047 3300025913 Bacteria 2329
61 Ga0207671_10000442 3300025914 Bacteria 57078
62 Ga0207649_10488051 3300025920 Unclassified 935
63 Ga0207694_10001265 3300025924 Bacteria 21805
64 Ga0207694_10049052 3300025924 Bacteria 3268
65 Ga0207694_10065746 3300025924 Bacteria 2828
66 Ga0207700_11398667 3300025928 Unclassified 622
67 Ga0207664_10210277 3300025929 Bacteria 1683
68 Ga0207644_10631928 3300025931 Unclassified 890
69 Ga0207670_10826472 3300025936 Unclassified 773
70 Ga0207665_11003193 3300025939 Bacteria 664
71 Ga0207711_10033910 3300025941 Bacteria 4322
72 Ga0207661_10864751 3300025944 Bacteria 833
73 Ga0207667_10285704 3300025949 Bacteria 1686
74 Ga0207667_10852340 3300025949 Bacteria 905
75 Ga0207640_10003111 3300025981 Bacteria 8923
76 Ga0207639_10002868 3300026041 Bacteria 11576
77 Ga0207641_10050826 3300026088 Bacteria 3509
78 Ga0207676_10073687 3300026095 Bacteria 2749
79 Ga0207674_10211656 3300026116 Bacteria 1887
80 Ga0207698_10006200 3300026142 Bacteria 7439
81 Ga0265323_10005935 3300028653 Bacteria 5162
82 Ga0265323_10008053 3300028653 Bacteria 4358
83 Ga0265323_10010883 3300028653 Bacteria 3683
84 Ga0265777_100133 3300030877 Unclassified 2824
85 Ga0265777_101138 3300030877 Bacteria 1378
86 Ga0265777_101262 3300030877 Unclassified 1332
87 Ga0265777_103192 3300030877 Unclassified 996
88 Ga0265777_110470 3300030877 Bacteria 679
89 Ga0265776_102678 3300030880 Unclassified 830
90 Ga0265779_106044 3300031043 Unclassified 672
91 Ga0265760_10024138 3300031090 Bacteria 1770
92 Ga0265330_10000557 3300031235 Bacteria 24298
93 Ga0265330_10197542 3300031235 Bacteria 851
94 Ga0265330_10220248 3300031235 Unclassified 801
95 Ga0265332_10350487 3300031238 Bacteria 609
96 Ga0265325_10005412 3300031241 Bacteria 7884
97 Ga0265325_10146040 3300031241 Bacteria 1122
98 Ga0265316_10000173 3300031344 Bacteria 73098
99 Ga0265316_10000822 3300031344 Bacteria 34339
100 Ga0265316_10003859 3300031344 Bacteria 15028
101 Ga0265316_10008042 3300031344 Bacteria 9841
102 Ga0265316_10040743 3300031344 Bacteria 3722
103 Ga0265316_10078703 3300031344 Unclassified 2530
104 Ga0265316_10100080 3300031344 Bacteria 2204
105 Ga0265316_10102426 3300031344 Bacteria 2175
106 Ga0265316_10210516 3300031344 Bacteria 1438
107 Ga0265316_10390918 3300031344 Bacteria 1003
108 Ga0265316_10451849 3300031344 Unclassified 921
109 Ga0265316_10553313 3300031344 Bacteria 819
110 Ga0265342_10031494 3300031712 Bacteria 3278
111 Ga0265342_10302755 3300031712 Unclassified 842
112 Ga0373934_0389995 3300035086 Bacteria 581
113 Ga0373927_0831346 3300035695 Bacteria 610
114 Ga0373947_0096637 3300035725 Bacteria 1850
115 Ga0373937_0439353 3300036401 Unclassified 1239
116 Ga0265778_000470 3300036457 Unclassified 3160
117 Ga0265778_000549 3300036457 Bacteria 2989
118 Ga0265778_001504 3300036457 Bacteria 2137
119 Ga0265778_001541 3300036457 Bacteria 2114
120 Ga0265778_002293 3300036457 Bacteria 1833
121 Ga0265778_002873 3300036457 Bacteria 1703
122 Ga0265778_003966 3300036457 Bacteria 1514
123 Ga0265778_004915 3300036457 Bacteria 1401
124 Ga0265778_006399 3300036457 Unclassified 1268
125 Ga0265778_007024 3300036457 Unclassified 1225
126 Ga0265778_011540 3300036457 Unclassified 1020
127 Ga0265778_013351 3300036457 Bacteria 962
128 Ga0265778_036341 3300036457 Unclassified 649
129 Ga0316582_0403408 3300036647 Bacteria 942
130 Ga0373925_0168179 3300037068 Bacteria 1730
131 Ga0373925_0949525 3300037068 Bacteria 708
132 Ga0373925_1096677 3300037068 Bacteria 655
133 Ga0436360_0860288 3300039438 Bacteria 3916
134 Ga0436361_0492869 3300039447 Bacteria 949
135 Ga0436361_0719567 3300039447 Unclassified 2672
136 Ga0436362_0682779 3300039453 Unclassified 1350
137 Ga0451577_0017309 3300042876 Bacteria 6661
138 Ga0451577_0050250 3300042876 Unclassified 3723
139 Ga0451577_0149108 3300042876 Bacteria 2104
140 Ga0453684_0001435 3300044712 Bacteria 68004
141 Ga0453684_0122430 3300044712 Bacteria 3138
142 Ga0451576_0001258 3300045051 Bacteria 44537
143 Ga0495592_0144625 3300046454 Bacteria 1650
144 Ga0495629_0574457 3300046459 Bacteria 755
145 Ga0495653_0039543 3300046463 Unclassified 3694
146 Ga0495582_0307332 3300046473 Bacteria 912
147 Ga0495662_0029224 3300046476 Bacteria 2661
148 Ga0495664_0030188 3300046477 Unclassified 3174
149 Ga0495664_0080116 3300046477 Bacteria 1957
150 Ga0495608_0637488 3300046511 Bacteria 637
151 Ga0495618_0011784 3300046514 Bacteria 5307
152 Ga0495628_0016780 3300046516 Bacteria 6102
153 Ga0495666_0446133 3300046526 Bacteria 580
154 Ga0495652_0032566 3300046529 Bacteria 4557
155 Ga0495665_0075231 3300046531 Bacteria 1778
156 Ga0495665_0295159 3300046531 Bacteria 830
157 Ga0495586_0353130 3300046535 Bacteria 844
158 Ga0495645_0002299 3300046543 Bacteria 12976
159 Ga0495667_0024382 3300046559 Bacteria 4073
160 Ga0495634_0448392 3300046642 Bacteria 761
161 Ga0495635_0025543 3300046663 Bacteria 4115
162 Ga0495599_0037100 3300046678 Unclassified 3062
163 Ga0495623_0447191 3300046679 Bacteria 688
164 Ga0495646_0089146 3300046680 Bacteria 1785
165 Ga0495613_0189852 3300046689 Bacteria 1452
166 Ga0495613_0232895 3300046689 Bacteria 1290
167 Ga0495600_0028084 3300046809 Bacteria 3639
168 Ga0495604_0052218 3300047317 Unclassified 3167
169 Ga0495674_0149006 3300047319 Bacteria 1963
170 Ga0495680_0053325 3300047322 Unclassified 3148
171 Ga0495675_0040970 3300047444 Unclassified 2952
172 Ga0495602_0146363 3300048088 Unclassified 1863
173 Ga0496113_0580941 3300048916 Unclassified 898
174 Ga0495619_0229287 3300053085 Bacteria 1287
175 Ga0500559_0000703 3300053136 Bacteria 21985
176 Ga0105237_10675451
177 Ga0070683_100571618
178 Ga0070661_100210987
179 Ga0070675_100705454
180 Ga0070671_100583671
181 Ga0070673_100436521
182 Ga0070673_101451002
183 Ga0070709_10196921
184 Ga0070709_10484430
185 Ga0070714_100276919
186 Ga0070713_100220586
187 Ga0070713_101177586
188 Ga0070710_10141308
189 Ga0070711_100637556
190 Ga0070681_10530900
191 Ga0070698_101376229
192 Ga0070684_100295836
193 Ga0070684_100835417
194 Ga0070697_101639168
195 Ga0068853_100019757
196 Ga0070695_100081651
197 Ga0068855_100962982
198 Ga0068857_100399003
199 Ga0068856_100273153
200 Ga0068852_100033450
201 Ga0068864_100147896
202 Ga0068858_100250927
203 Ga0070717_10472870
204 Ga0070716_100896024
205 Ga0068871_100574808
206 Ga0105240_10007044
207 Ga0105240_10152557
208 Ga0105240_11089008
209 Ga0105241_10057568
210 Ga0105241_10889819
211 Ga0105248_10045199
212 Ga0105237_10017351
213 Ga0105237_10252842
214 Ga0105237_10272472
215 Ga0105238_10104847
216 Ga0157373_10009566
217 Ga0157370_10885303
218 Ga0157369_10089522
219 Ga0157369_10372998
220 Ga0157369_10571849
221 Ga0157374_10271355
222 Ga0157374_11047948
223 Ga0163162_10211956
224 Ga0157372_10174664
225 Ga0163163_10026350
226 Ga0157377_10509280
227 Ga0157376_10439607
228 Ga0184598_136658
229 Ga0213872_10101102
230 Ga0207692_10112533
231 Ga0207699_10311861
232 Ga0207654_10005366
233 Ga0207707_10251567
234 Ga0207695_10004758
235 Ga0207695_10144047
236 Ga0207671_10000442
237 Ga0207649_10488051
238 Ga0207694_10001265
239 Ga0207694_10049052
240 Ga0207694_10065746
241 Ga0207700_11398667
242 Ga0207664_10210277
243 Ga0207644_10631928
244 Ga0207670_10826472
245 Ga0207665_11003193
246 Ga0207711_10033910
247 Ga0207661_10864751
248 Ga0207667_10285704
249 Ga0207667_10852340
250 Ga0207640_10003111
251 Ga0207639_10002868
252 Ga0207641_10050826
253 Ga0207676_10073687
254 Ga0207674_10211656
255 Ga0207698_10006200
256 Ga0265323_10005935
257 Ga0265323_10008053
258 Ga0265323_10010883
259 Ga0265777_100133
260 Ga0265777_101138
261 Ga0265777_101262
262 Ga0265777_103192
263 Ga0265777_110470
264 Ga0265776_102678
265 Ga0265779_106044
266 Ga0265760_10024138
267 Ga0265330_10000557
268 Ga0265330_10197542
269 Ga0265330_10220248
270 Ga0265332_10350487
271 Ga0265325_10005412
272 Ga0265325_10146040
273 Ga0265316_10000173
274 Ga0265316_10000822
275 Ga0265316_10003859
276 Ga0265316_10008042
277 Ga0265316_10040743
278 Ga0265316_10078703
279 Ga0265316_10100080
280 Ga0265316_10102426
281 Ga0265316_10210516
282 Ga0265316_10390918
283 Ga0265316_10451849
284 Ga0265316_10553313
285 Ga0265342_10031494
286 Ga0265342_10302755
287 Ga0373934_0389995
288 Ga0373927_0831346
289 Ga0373947_0096637
290 Ga0373937_0439353
291 Ga0265778_000470
292 Ga0265778_000549
293 Ga0265778_001504
294 Ga0265778_001541
295 Ga0265778_002293
296 Ga0265778_002873
297 Ga0265778_003966
298 Ga0265778_004915
299 Ga0265778_006399
300 Ga0265778_007024
301 Ga0265778_011540
302 Ga0265778_013351
303 Ga0265778_036341
304 Ga0316582_0403408
305 Ga0373925_0168179
306 Ga0373925_0949525
307 Ga0373925_1096677
308 Ga0436360_0860288
309 Ga0436361_0492869
310 Ga0436361_0719567
311 Ga0436362_0682779
312 Ga0451577_0017309
313 Ga0451577_0050250
314 Ga0451577_0149108
315 Ga0453684_0001435
316 Ga0453684_0122430
317 Ga0451576_0001258
318 Ga0495592_0144625
319 Ga0495629_0574457
320 Ga0495653_0039543
321 Ga0495582_0307332
322 Ga0495662_0029224
323 Ga0495664_0030188
324 Ga0495664_0080116
325 Ga0495608_0637488
326 Ga0495618_0011784
327 Ga0495628_0016780
328 Ga0495666_0446133
329 Ga0495652_0032566
330 Ga0495665_0075231
331 Ga0495665_0295159
332 Ga0495586_0353130
333 Ga0495645_0002299
334 Ga0495667_0024382
335 Ga0495634_0448392
336 Ga0495635_0025543
337 Ga0495599_0037100
338 Ga0495623_0447191
339 Ga0495646_0089146
340 Ga0495613_0189852
341 Ga0495613_0232895
342 Ga0495600_0028084
343 Ga0495604_0052218
344 Ga0495674_0149006
345 Ga0495680_0053325
346 Ga0495675_0040970
347 Ga0495602_0146363
348 Ga0496113_0580941
349 Ga0495619_0229287
350 Ga0500559_0000703

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11181

YflT

Heat induced stress protein YflT domain

6

79

0.85

PF11821

ActD

Alternative complex III, ActD subunit

5

168

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4rww-assembly1.cif.gz_C crystal structure of l. monocytogenes psta in complex with cyclic-di-amp 0.7695 5 36
4rwx-assembly1.cif.gz_C crystal structure of l. monocytogenes psta 0.723 5 155
3l7p-assembly1.cif.gz_E error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.6897 4 155
3l7p-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.6894 5 155
4d3g-assembly1.cif.gz_A structure of psta 0.6794 4 157
ID Description Score Start End Superfamily
3nwgA01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;BMC (bacterial microcompartment) domain 0.7001 4 154 3.30.70.1710
3l7pE00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.6897 4 155 3.30.70.120
4d3gA01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.6794 4 157 3.30.70.120
af_Q54UH8_328_406_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.6665 3 154 3.30.70.260
af_P56544_2_97_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.6649 125 154 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A838J167-F1-model_v4 YsnF/AvaK domain-containing protein 0.8665 4 145
AF-A0A2H6F7A7-F1-model_v4 General stress protein 17M-like domain-containing protein 0.8638 3 156
AF-A0A2T2WK79-F1-model_v4 Permease 0.8606 3 156 GO:0016020
AF-A0A7V9Q474-F1-model_v4 DUF2382 domain-containing protein 0.8603 4 145
AF-A0A0V7ZI78-F1-model_v4 DUF5615 domain-containing protein 0.8584 3 159

Map