F266164

General Info

Members Datasets Scaffolds Average Seq Length
175 111 348 198

Family's Representative Sequence

Representative Sequence 3300006847|Ga0075431_100129007|Ga0075431_1001290072
Length 240
Sequence MKNRNIRVGVMWRILQPDRNDRAESGAIRDAAHRHVARICAGTMELVPGNDDVRATNPGVKLTYDDFGLFPDDGRRHELIDGEHYVTPSPNRKHQKVSLNISLMIGNWLERNPIGQLFYAPFDVIFSIFDVVEPDLLYMSNERAANVLTDANVKGAPELVIEIGSEGTRRRDETIKRRLYERAGVAEYWVVDPEIDVVRMFRRGADGFQRPIELTAENNDTLTTPLLPGLSLPLSRIFRL

Samples

Sample ID Description Type Environment
1 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
31 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
32 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
42 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
43 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
47 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
48 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
49 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
65 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
66 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
67 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
68 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
69 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
70 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
71 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
72 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
73 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
74 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
75 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
76 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
77 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
78 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
79 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
80 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
81 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
82 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
83 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
84 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
85 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
86 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
87 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
88 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
89 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
92 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
93 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
94 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
95 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
96 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
97 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
98 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
99 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
100 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
101 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
102 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
103 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
104 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
105 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
106 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
107 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
108 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
109 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
110 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
111 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.14
Rhizosphere 98.86
Stem 0
Stem Tuber 0
Unclassified 22.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075431_100129007 3300006847 Bacteria 2609
2 Ga0065704_10146340 3300005289 Unclassified 1468
3 Ga0065707_10113917 3300005295 Bacteria 2312
4 Ga0070670_100042657 3300005331 Bacteria 3900
5 Ga0068869_100289627 3300005334 Bacteria 1319
6 Ga0070687_100143357 3300005343 Bacteria 1394
7 Ga0070675_100040846 3300005354 Bacteria 3789
8 Ga0070675_100060147 3300005354 Bacteria 3136
9 Ga0070674_100231268 3300005356 Bacteria 1443
10 Ga0070673_100054043 3300005364 Bacteria 3158
11 Ga0070673_100337343 3300005364 Bacteria 1335
12 Ga0070673_100445447 3300005364 Bacteria 1164
13 Ga0070688_100157281 3300005365 Bacteria 1559
14 Ga0070701_10367034 3300005438 Bacteria 904
15 Ga0070711_100121289 3300005439 Bacteria 1934
16 Ga0070705_100000156 3300005440 Bacteria 40273
17 Ga0070700_100234395 3300005441 Bacteria 1308
18 Ga0070694_100001976 3300005444 Bacteria 12165
19 Ga0070694_100877131 3300005444 Unclassified 740
20 Ga0070708_100568610 3300005445 Bacteria 1069
21 Ga0070678_100033077 3300005456 Bacteria 3586
22 Ga0070685_10138580 3300005466 Bacteria 1529
23 Ga0070699_100670632 3300005518 Unclassified 947
24 Ga0070686_100443656 3300005544 Bacteria 996
25 Ga0070695_100000148 3300005545 Bacteria 32862
26 Ga0070696_100000066 3300005546 Bacteria 50688
27 Ga0070704_100362855 3300005549 Bacteria 1226
28 Ga0070664_100473631 3300005564 Unclassified 1152
29 Ga0070702_100005452 3300005615 Bacteria 5927
30 Ga0068864_100241851 3300005618 Bacteria 1673
31 Ga0068870_10078896 3300005840 Bacteria 1815
32 Ga0068863_101036268 3300005841 Bacteria 824
33 Ga0097621_100024137 3300006237 Unclassified 4744
34 Ga0068871_100172150 3300006358 Unclassified 1857
35 Ga0068871_100628537 3300006358 Bacteria 978
36 Ga0075430_100062715 3300006846 Bacteria 3121
37 Ga0075430_100331535 3300006846 Unclassified 1257
38 Ga0075430_100534378 3300006846 Bacteria 967
39 Ga0075431_100546059 3300006847 Bacteria 1146
40 Ga0075431_100607934 3300006847 Bacteria 1077
41 Ga0075433_10000274 3300006852 Bacteria 30376
42 Ga0075433_10041322 3300006852 Bacteria 3994
43 Ga0075434_100000225 3300006871 Bacteria 38685
44 Ga0075434_100023858 3300006871 Bacteria 5970
45 Ga0075434_100027862 3300006871 Bacteria 5547
46 Ga0068865_100643699 3300006881 Unclassified 900
47 Ga0097620_100036602 3300006931 Bacteria 4927
48 Ga0097620_100443140 3300006931 Unclassified 1395
49 Ga0111539_10039737 3300009094 Bacteria 5669
50 Ga0111539_10118234 3300009094 Unclassified 3107
51 Ga0114129_10041275 3300009147 Bacteria 6502
52 Ga0114129_10066585 3300009147 Bacteria 5025
53 Ga0114129_10142367 3300009147 Bacteria 3286
54 Ga0114129_10926138 3300009147 Unclassified 1102
55 Ga0114129_11048657 3300009147 Unclassified 1024
56 Ga0105243_10121267 3300009148 Bacteria 2204
57 Ga0105248_10180529 3300009177 Bacteria 2378
58 Ga0105248_10189826 3300009177 Bacteria 2315
59 Ga0105248_10720273 3300009177 Bacteria 1126
60 Ga0105249_10012425 3300009553 Bacteria 7507
61 Ga0105249_11342654 3300009553 Unclassified 787
62 Ga0105249_11515542 3300009553 Unclassified 743
63 Ga0105246_10202120 3300011119 Bacteria 1545
64 Ga0157371_10405888 3300013102 Unclassified 997
65 Ga0157378_10505819 3300013297 Unclassified 1207
66 Ga0163162_10417148 3300013306 Bacteria 1475
67 Ga0163162_10734933 3300013306 Bacteria 1107
68 Ga0157375_10225727 3300013308 Unclassified 2032
69 Ga0157375_10790383 3300013308 Unclassified 1098
70 Ga0157380_10057341 3300014326 Bacteria 3101
71 Ga0157380_10161388 3300014326 Unclassified 1949
72 Ga0157380_10391265 3300014326 Bacteria 1315
73 Ga0157380_10582797 3300014326 Unclassified 1103
74 Ga0157377_10009285 3300014745 Bacteria 4818
75 Ga0157377_10020616 3300014745 Bacteria 3456
76 Ga0157377_10145951 3300014745 Unclassified 1458
77 Ga0157376_10677587 3300014969 Unclassified 1034
78 Ga0207682_10001088 3300025893 Bacteria 12555
79 Ga0207682_10052027 3300025893 Bacteria 1697
80 Ga0207682_10062987 3300025893 Unclassified 1556
81 Ga0207643_10015979 3300025908 Bacteria 4088
82 Ga0207681_10047325 3300025923 Bacteria 2897
83 Ga0207650_10018485 3300025925 Bacteria 4891
84 Ga0207650_10492253 3300025925 Bacteria 1024
85 Ga0207659_10028110 3300025926 Bacteria 3818
86 Ga0207709_10084638 3300025935 Bacteria 2054
87 Ga0207670_10135108 3300025936 Bacteria 1812
88 Ga0207691_10238228 3300025940 Bacteria 1574
89 Ga0207689_10002755 3300025942 Bacteria 16250
90 Ga0207651_10396134 3300025960 Bacteria 1173
91 Ga0207703_10947291 3300026035 Unclassified 825
92 Ga0207678_10260566 3300026067 Bacteria 1486
93 Ga0207675_100778314 3300026118 Bacteria 969
94 Ga0207683_10011361 3300026121 Bacteria 7597
95 Ga0207698_10494604 3300026142 Bacteria 1189
96 Ga0209999_1050855 3300027543 Unclassified 783
97 Ga0373939_0062520 3300035114 Bacteria 1190
98 Ga0373943_0014060 3300035170 Unclassified 3619
99 Ga0373924_0000600 3300035410 Bacteria 11123
100 Ga0373935_0043591 3300035692 Unclassified 2824
101 Ga0373927_0169691 3300035695 Bacteria 1430
102 Ga0373947_0010294 3300035725 Bacteria 5367
103 Ga0373937_0643461 3300036401 Bacteria 1006
104 Ga0373925_0012165 3300037068 Bacteria 6230
105 Ga0439453_0013026 3300041408 Bacteria 1409
106 Ga0451789_0629941 3300041443 Unclassified 803
107 Ga0451800_1180910 3300041459 Bacteria 1009
108 Ga0439449_0098360 3300042007 Bacteria 1081
109 Ga0439435_0028526 3300042436 Bacteria 1501
110 Ga0439435_0095865 3300042436 Bacteria 906
111 Ga0439440_0023948 3300042993 Bacteria 1396
112 Ga0451576_0277070 3300045051 Unclassified 1754
113 Ga0451576_0434051 3300045051 Bacteria 1378
114 Ga0451576_0498313 3300045051 Bacteria 1279
115 Ga0451576_0704495 3300045051 Unclassified 1061
116 Ga0495629_0334284 3300046459 Bacteria 1035
117 Ga0495594_0282254 3300046499 Unclassified 946
118 Ga0495643_0001948 3300046522 Bacteria 17369
119 Ga0495621_0147461 3300046539 Unclassified 924
120 Ga0495647_0288784 3300046681 Unclassified 737
121 Ga0495658_0012184 3300046683 Unclassified 4346
122 Ga0495636_0030471 3300047318 Bacteria 2206
123 Ga0495676_0584451 3300047321 Bacteria 728
124 Ga0495684_0245329 3300047471 Bacteria 1305
125 Ga0501038_0181247 3300049574 Bacteria 1699
126 Ga0501040_0850476 3300049576 Bacteria 660
127 Ga0501041_0013677 3300049577 Bacteria 4815
128 Ga0501048_0083480 3300049582 Bacteria 2253
129 Ga0501068_0122995 3300049584 Bacteria 1619
130 Ga0501071_0071832 3300049587 Bacteria 2523
131 Ga0501072_0145682 3300049588 Bacteria 1888
132 Ga0501075_0069596 3300049591 Bacteria 2659
133 Ga0501075_0309590 3300049591 Bacteria 1203
134 Ga0501076_0041395 3300049592 Bacteria 3625
135 Ga0501079_0341369 3300049741 Bacteria 1173
136 Ga0501080_0955382 3300049742 Bacteria 745
137 Ga0501045_0075532 3300049824 Bacteria 2482
138 nmdc:mga05p37_127072_c1 3300050507 Bacteria 3130
139 nmdc:mga05p37_136794_c1 3300050507 Bacteria 3003
140 nmdc:mga05p37_407540_c1 3300050507 Bacteria 1586
141 nmdc:mga05p37_755504_c1 3300050507 Bacteria 1071
142 nmdc:mga05p37_794909_c1 3300050507 Unclassified 1036
143 nmdc:mga05p37_82058_c1 3300050507 Unclassified 3972
144 nmdc:mga05p37_86974_c1 3300050507 Bacteria 3464
145 nmdc:mga09592_568909_c1 3300050508 Unclassified 973
146 nmdc:mga09592_9345_c1 3300050508 Bacteria 7972
147 nmdc:mga0qj67_10972_c1 3300050509 Bacteria 6781
148 nmdc:mga0qj67_20263_c1 3300050509 Bacteria 5089
149 nmdc:mga0qj67_272440_c1 3300050509 Unclassified 1372
150 nmdc:mga0qj67_53424_c1 3300050509 Bacteria 3199
151 nmdc:mga0qj67_99453_c1 3300050509 Bacteria 2344
152 nmdc:mga06r32_11242_c1 3300050510 Bacteria 8063
153 nmdc:mga06r32_1200929_c1 3300050510 Bacteria 705
154 nmdc:mga06r32_2955_c1 3300050510 Bacteria 15240
155 nmdc:mga06r32_327919_c1 3300050510 Bacteria 1516
156 nmdc:mga06r32_6109_c1 3300050510 Bacteria 10816
157 nmdc:mga08y16_164528_c1 3300050511 Bacteria 1512
158 nmdc:mga08y16_396577_c1 3300050511 Bacteria 1413
159 nmdc:mga08y16_6865_c1 3300050511 Bacteria 11938
160 nmdc:mga0n895_209047_c1 3300050512 Bacteria 1982
161 nmdc:mga0n895_49712_c1 3300050512 Bacteria 4110
162 nmdc:mga0n895_79591_c1 3300050512 Bacteria 3264
163 nmdc:mga0rr50_105439_c1 3300050513 Bacteria 2223
164 nmdc:mga0rr50_14758_c1 3300050513 Bacteria 5136
165 nmdc:mga08x19_545654_c1 3300050514 Unclassified 820
166 nmdc:mga0a205_33583_c1 3300050515 Bacteria 4919
167 nmdc:mga0a205_418_c1 3300050515 Bacteria 32685
168 nmdc:mga0a205_438337_c1 3300050515 Bacteria 1167
169 nmdc:mga0a205_52358_c1 3300050515 Bacteria 3940
170 nmdc:mga0a205_53315_c1 3300050515 Bacteria 3904
171 nmdc:mga0a205_74_c1 3300050515 Bacteria 54821
172 nmdc:mga0a205_75970_c1 3300050515 Bacteria 3246
173 Ga0501084_0159042 3300054114 Bacteria 1906
174 Ga0501082_0124967 3300060353 Bacteria 2231
175 Ga0075431_100129007
176 Ga0065704_10146340
177 Ga0065707_10113917
178 Ga0070670_100042657
179 Ga0068869_100289627
180 Ga0070687_100143357
181 Ga0070675_100040846
182 Ga0070675_100060147
183 Ga0070674_100231268
184 Ga0070673_100054043
185 Ga0070673_100337343
186 Ga0070673_100445447
187 Ga0070688_100157281
188 Ga0070701_10367034
189 Ga0070711_100121289
190 Ga0070705_100000156
191 Ga0070700_100234395
192 Ga0070694_100001976
193 Ga0070694_100877131
194 Ga0070708_100568610
195 Ga0070678_100033077
196 Ga0070685_10138580
197 Ga0070699_100670632
198 Ga0070686_100443656
199 Ga0070695_100000148
200 Ga0070696_100000066
201 Ga0070704_100362855
202 Ga0070664_100473631
203 Ga0070702_100005452
204 Ga0068864_100241851
205 Ga0068870_10078896
206 Ga0068863_101036268
207 Ga0097621_100024137
208 Ga0068871_100172150
209 Ga0068871_100628537
210 Ga0075430_100062715
211 Ga0075430_100331535
212 Ga0075430_100534378
213 Ga0075431_100546059
214 Ga0075431_100607934
215 Ga0075433_10000274
216 Ga0075433_10041322
217 Ga0075434_100000225
218 Ga0075434_100023858
219 Ga0075434_100027862
220 Ga0068865_100643699
221 Ga0097620_100036602
222 Ga0097620_100443140
223 Ga0111539_10039737
224 Ga0111539_10118234
225 Ga0114129_10041275
226 Ga0114129_10066585
227 Ga0114129_10142367
228 Ga0114129_10926138
229 Ga0114129_11048657
230 Ga0105243_10121267
231 Ga0105248_10180529
232 Ga0105248_10189826
233 Ga0105248_10720273
234 Ga0105249_10012425
235 Ga0105249_11342654
236 Ga0105249_11515542
237 Ga0105246_10202120
238 Ga0157371_10405888
239 Ga0157378_10505819
240 Ga0163162_10417148
241 Ga0163162_10734933
242 Ga0157375_10225727
243 Ga0157375_10790383
244 Ga0157380_10057341
245 Ga0157380_10161388
246 Ga0157380_10391265
247 Ga0157380_10582797
248 Ga0157377_10009285
249 Ga0157377_10020616
250 Ga0157377_10145951
251 Ga0157376_10677587
252 Ga0207682_10001088
253 Ga0207682_10052027
254 Ga0207682_10062987
255 Ga0207643_10015979
256 Ga0207681_10047325
257 Ga0207650_10018485
258 Ga0207650_10492253
259 Ga0207659_10028110
260 Ga0207709_10084638
261 Ga0207670_10135108
262 Ga0207691_10238228
263 Ga0207689_10002755
264 Ga0207651_10396134
265 Ga0207703_10947291
266 Ga0207678_10260566
267 Ga0207675_100778314
268 Ga0207683_10011361
269 Ga0207698_10494604
270 Ga0209999_1050855
271 Ga0373939_0062520
272 Ga0373943_0014060
273 Ga0373924_0000600
274 Ga0373935_0043591
275 Ga0373927_0169691
276 Ga0373947_0010294
277 Ga0373937_0643461
278 Ga0373925_0012165
279 Ga0439453_0013026
280 Ga0451789_0629941
281 Ga0451800_1180910
282 Ga0439449_0098360
283 Ga0439435_0028526
284 Ga0439435_0095865
285 Ga0439440_0023948
286 Ga0451576_0277070
287 Ga0451576_0434051
288 Ga0451576_0498313
289 Ga0451576_0704495
290 Ga0495629_0334284
291 Ga0495594_0282254
292 Ga0495643_0001948
293 Ga0495621_0147461
294 Ga0495647_0288784
295 Ga0495658_0012184
296 Ga0495636_0030471
297 Ga0495676_0584451
298 Ga0495684_0245329
299 Ga0501038_0181247
300 Ga0501040_0850476
301 Ga0501041_0013677
302 Ga0501048_0083480
303 Ga0501068_0122995
304 Ga0501071_0071832
305 Ga0501072_0145682
306 Ga0501075_0069596
307 Ga0501075_0309590
308 Ga0501076_0041395
309 Ga0501079_0341369
310 Ga0501080_0955382
311 Ga0501045_0075532
312 nmdc:mga05p37_127072_c1
313 nmdc:mga05p37_136794_c1
314 nmdc:mga05p37_407540_c1
315 nmdc:mga05p37_755504_c1
316 nmdc:mga05p37_794909_c1
317 nmdc:mga05p37_82058_c1
318 nmdc:mga05p37_86974_c1
319 nmdc:mga09592_568909_c1
320 nmdc:mga09592_9345_c1
321 nmdc:mga0qj67_10972_c1
322 nmdc:mga0qj67_20263_c1
323 nmdc:mga0qj67_272440_c1
324 nmdc:mga0qj67_53424_c1
325 nmdc:mga0qj67_99453_c1
326 nmdc:mga06r32_11242_c1
327 nmdc:mga06r32_1200929_c1
328 nmdc:mga06r32_2955_c1
329 nmdc:mga06r32_327919_c1
330 nmdc:mga06r32_6109_c1
331 nmdc:mga08y16_164528_c1
332 nmdc:mga08y16_396577_c1
333 nmdc:mga08y16_6865_c1
334 nmdc:mga0n895_209047_c1
335 nmdc:mga0n895_49712_c1
336 nmdc:mga0n895_79591_c1
337 nmdc:mga0rr50_105439_c1
338 nmdc:mga0rr50_14758_c1
339 nmdc:mga08x19_545654_c1
340 nmdc:mga0a205_33583_c1
341 nmdc:mga0a205_418_c1
342 nmdc:mga0a205_438337_c1
343 nmdc:mga0a205_52358_c1
344 nmdc:mga0a205_53315_c1
345 nmdc:mga0a205_74_c1
346 nmdc:mga0a205_75970_c1
347 Ga0501084_0159042
348 Ga0501082_0124967

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05685

Uma2

Putative restriction endonuclease

64

235

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
6okh-assembly1.cif.gz_B structure of an uncharacterized protein from leptospira borgpetersenii serovar hardjo-bovis (strain jb197) 0.9516 18 194
6okh-assembly1.cif.gz_B structure of an uncharacterized protein from leptospira borgpetersenii serovar hardjo-bovis (strain jb197) 0.9256 18 194
1wdj-assembly1.cif.gz_C crystal structure of tt1808 from thermus thermophilus hb8 0.8621 31 194
3ot2-assembly1.cif.gz_B crystal structure of a putative nuclease belonging to duf820 (ava_3926) from anabaena variabilis atcc 29413 at 1.96 a resolution 0.846 19 195
1wdj-assembly1.cif.gz_B crystal structure of tt1808 from thermus thermophilus hb8 0.8381 42 194
ID Description Score Start End Superfamily
1wdjC00 Alpha Beta;Alpha-Beta Complex;tt1808, chain A;tt1808, chain A 0.8621 31 194 3.90.1570.10
3ot2B00 Alpha Beta;Alpha-Beta Complex;tt1808, chain A;tt1808, chain A 0.8435 19 195 3.90.1570.10
1wdjB00 Alpha Beta;Alpha-Beta Complex;tt1808, chain A;tt1808, chain A 0.8381 42 194 3.90.1570.10
1wdjB00 Alpha Beta;Alpha-Beta Complex;tt1808, chain A;tt1808, chain A 0.8229 42 194 3.90.1570.10
3ot2B00 Alpha Beta;Alpha-Beta Complex;tt1808, chain A;tt1808, chain A 0.8173 19 195 3.90.1570.10
ID Description Score Start End GO Terms
AF-A0A7W1I460-F1-model_v4 Uma2 family endonuclease 0.979 19 197 GO:0004519
AF-A0A1F2VFW6-F1-model_v4 Putative restriction endonuclease domain-containing protein 0.9769 18 196
AF-A0A2V8GU37-F1-model_v4 Restriction endonuclease 0.9768 60 196 GO:0004519
AF-A0A7W1I460-F1-model_v4 Uma2 family endonuclease 0.9683 19 197 GO:0004519
AF-A0A7V1Y4C5-F1-model_v4 Uma2 family endonuclease 0.9674 14 162 GO:0004519

Map