F266118

General Info

Members Datasets Scaffolds Average Seq Length
175 98 175 174

Family's Representative Sequence

Representative Sequence 3300006178|Ga0075367_10006114|Ga0075367_100061142
Length 185
Sequence VAAPDYVPKPTDEKPRVYTSPPRRPDSWLADRPAEIQGLQPEGPGLGVPGPDQGYALKLARRFEGQLVLTAGEHEDDAIAGAVAIATRRASLYGRSPVIHDLTVALTIWGFLGEAPADLAAARKVLFAGVANPHHYSEGRAIVDSVPEEWLRMTPDAVARTVRDEPAQVLAMAAAASTGEAHAAD

Samples

Sample ID Description Type Environment
1 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
2 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
3 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
4 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
5 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
6 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
7 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
8 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
9 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
10 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
11 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
12 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
13 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
14 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
15 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
16 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
17 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
18 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
19 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
20 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
21 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
26 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
27 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
28 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
29 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
30 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
31 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
32 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
33 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
34 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
35 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
36 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
37 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
38 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
39 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
40 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
41 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
42 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
43 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
44 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
45 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
46 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
47 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
48 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
49 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
50 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
51 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
52 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
53 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
54 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
55 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
56 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
57 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
58 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
59 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
60 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
61 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
62 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
63 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
64 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
65 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
66 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
67 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
68 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
69 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
70 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
71 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
72 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
73 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
74 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
75 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
76 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
77 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
78 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
79 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
80 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
81 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
82 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
83 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
84 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
85 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
86 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
87 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
88 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
89 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
90 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
91 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
92 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
93 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
94 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
95 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
96 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
97 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
98 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 34.86
Nodule 0
Rhizoplane 2.29
Rhizosphere 57.71
Stem 0
Stem Tuber 0
Unclassified 5.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068868_101325410 3300005338 Unclassified 669
2 Ga0070689_100924276 3300005340 Bacteria 773
3 Ga0070671_100000584 3300005355 Bacteria 25993
4 Ga0070706_100031045 3300005467 Bacteria 4926
5 Ga0070707_100761244 3300005468 Archaea 932
6 Ga0070699_100294384 3300005518 Archaea 1456
7 Ga0068858_100007994 3300005842 Bacteria 10194
8 Ga0068860_100056353 3300005843 Bacteria 3737
9 Ga0081538_10000101 3300005981 Bacteria 83888
10 Ga0075365_10002996 3300006038 Bacteria 8554
11 Ga0075365_10019496 3300006038 Bacteria 4188
12 Ga0075365_10045490 3300006038 Bacteria 2880
13 Ga0075365_10063056 3300006038 Bacteria 2481
14 Ga0075365_10079901 3300006038 Bacteria 2213
15 Ga0075365_10093650 3300006038 Bacteria 2049
16 Ga0075365_10126692 3300006038 Bacteria 1765
17 Ga0075365_10237797 3300006038 Bacteria 1279
18 Ga0075365_10469032 3300006038 Bacteria 889
19 Ga0075368_10167805 3300006042 Bacteria 922
20 Ga0075363_100015113 3300006048 Bacteria 3787
21 Ga0075363_100090127 3300006048 Unclassified 1687
22 Ga0075363_100129538 3300006048 Bacteria 1414
23 Ga0075364_10000890 3300006051 Bacteria 15783
24 Ga0075364_10014308 3300006051 Bacteria 4901
25 Ga0075364_10028873 3300006051 Bacteria 3554
26 Ga0075364_10031706 3300006051 Bacteria 3396
27 Ga0075364_10060982 3300006051 Bacteria 2473
28 Ga0075364_10163755 3300006051 Bacteria 1502
29 Ga0075364_10299568 3300006051 Bacteria 1094
30 Ga0075364_10640383 3300006051 Bacteria 726
31 Ga0070712_100648229 3300006175 Bacteria 897
32 Ga0070712_100829924 3300006175 Unclassified 794
33 Ga0075367_10003638 3300006178 Bacteria 7390
34 Ga0075367_10006114 3300006178 Bacteria 6052
35 Ga0075367_10089317 3300006178 Bacteria 1873
36 Ga0075367_10097258 3300006178 Bacteria 1796
37 Ga0075367_10393901 3300006178 Unclassified 876
38 Ga0075369_10119572 3300006186 Bacteria 1192
39 Ga0075369_10275104 3300006186 Unclassified 784
40 Ga0075370_10069883 3300006353 Bacteria 2008
41 Ga0075370_10309216 3300006353 Bacteria 941
42 Ga0075435_100123530 3300007076 Bacteria 2162
43 Ga0105245_10042273 3300009098 Bacteria 4066
44 Ga0114129_10096009 3300009147 Bacteria 4105
45 Ga0207684_10393045 3300025910 Unclassified 1192
46 Ga0207687_10016837 3300025927 Bacteria 4805
47 Ga0207644_10222545 3300025931 Bacteria 1496
48 Ga0207661_10729684 3300025944 Bacteria 912
49 Ga0207677_11105683 3300026023 Bacteria 723
50 Ga0207703_10006305 3300026035 Bacteria 9482
51 Ga0268264_10106209 3300028381 Bacteria 2451
52 Ga0316578_10046230 3300031728 Bacteria 2536
53 Ga0307410_10091034 3300031852 Bacteria 2165
54 Ga0307407_10028980 3300031903 Bacteria 2967
55 Ga0307407_10261852 3300031903 Bacteria 1190
56 Ga0307409_100010555 3300031995 Bacteria 5754
57 Ga0307409_102142585 3300031995 Bacteria 589
58 Ga0307416_100044054 3300032002 Bacteria 3500
59 Ga0307415_100018880 3300032126 Bacteria 4175
60 Ga0316585_10080649 3300032137 Bacteria 1060
61 Ga0316580_10034252 3300032139 Bacteria 1572
62 Ga0373953_0045585 3300035117 Bacteria 1758
63 Ga0373955_0389315 3300035172 Bacteria 846
64 Ga0316574_0073627 3300035398 Bacteria 2160
65 Ga0373931_0000469 3300035691 Bacteria 16516
66 Ga0373933_0101453 3300035724 Bacteria 1786
67 Ga0373937_0016416 3300036401 Bacteria 6577
68 Ga0316582_0023304 3300036647 Bacteria 3688
69 Ga0316584_0218932 3300036712 Bacteria 1399
70 Ga0400483_035083 3300039062 Unclassified 1430
71 Ga0400483_039901 3300039062 Bacteria 4287
72 Ga0400483_055656 3300039062 Bacteria 1530
73 Ga0400483_128609 3300039062 Bacteria 1507
74 Ga0400483_165176 3300039062 Bacteria 6100
75 Ga0400483_175339 3300039062 Bacteria 1451
76 Ga0400483_191237 3300039062 Bacteria 5571
77 Ga0400483_217504 3300039062 Bacteria 23123
78 Ga0400483_251055 3300039062 Bacteria 3383
79 Ga0436360_1222521 3300039438 Bacteria 4826
80 Ga0436361_0807531 3300039447 Bacteria 1125
81 Ga0436362_1192036 3300039453 Bacteria 8755
82 Ga0451793_1593654 3300041452 Bacteria 930
83 Ga0439452_027114 3300042010 Bacteria 1441
84 Ga0439434_0015540 3300042435 Bacteria 2271
85 Ga0495651_0002877 3300046462 Bacteria 13334
86 Ga0495653_0047213 3300046463 Bacteria 3332
87 Ga0495664_0260201 3300046477 Bacteria 1049
88 Ga0495608_0141363 3300046511 Bacteria 1536
89 Ga0495630_0899895 3300046517 Bacteria 674
90 Ga0495630_1290337 3300046517 Archaea 551
91 Ga0495640_0514853 3300046533 Bacteria 727
92 Ga0495587_0016637 3300046536 Bacteria 4575
93 Ga0495645_0606839 3300046543 Bacteria 673
94 Ga0495667_0003496 3300046559 Bacteria 10530
95 Ga0495623_0120910 3300046679 Bacteria 1576
96 Ga0495600_0009914 3300046809 Bacteria 5901
97 Ga0495604_0041330 3300047317 Bacteria 3617
98 Ga0495684_0664952 3300047471 Bacteria 695
99 Ga0495593_0356760 3300047673 Unclassified 731
100 Ga0495602_0141986 3300048088 Bacteria 1900
101 Ga0496101_0247709 3300048904 Bacteria 1388
102 Ga0496108_0110838 3300048911 Bacteria 2347
103 Ga0496110_0437468 3300048913 Bacteria 1192
104 Ga0501034_0000425 3300049571 Bacteria 70362
105 Ga0501034_0008034 3300049571 Bacteria 11194
106 Ga0501034_0030221 3300049571 Bacteria 5506
107 Ga0501036_0520445 3300049572 Bacteria 989
108 Ga0501037_0329203 3300049573 Bacteria 1057
109 Ga0501037_0512054 3300049573 Bacteria 813
110 Ga0501067_0148877 3300049583 Bacteria 1304
111 Ga0501067_0386547 3300049583 Bacteria 780
112 Ga0501068_0000422 3300049584 Bacteria 21446
113 Ga0501068_0000824 3300049584 Bacteria 16106
114 Ga0501068_0069514 3300049584 Bacteria 2147
115 Ga0501068_0174234 3300049584 Bacteria 1359
116 Ga0501069_0000009 3300049585 Bacteria 175166
117 Ga0501069_0012453 3300049585 Bacteria 4523
118 Ga0501069_0015939 3300049585 Bacteria 4030
119 Ga0501069_0111084 3300049585 Bacteria 1561
120 Ga0501070_0000006 3300049586 Bacteria 226569
121 Ga0501070_0007570 3300049586 Bacteria 9227
122 Ga0501070_0041618 3300049586 Bacteria 3827
123 Ga0501070_0144629 3300049586 Bacteria 1963
124 Ga0501070_1062659 3300049586 Unclassified 626
125 Ga0501071_0014550 3300049587 Bacteria 5382
126 Ga0501073_0002248 3300049589 Bacteria 14454
127 Ga0501073_0008961 3300049589 Bacteria 7390
128 Ga0501074_0000337 3300049590 Bacteria 27375
129 Ga0501074_0024049 3300049590 Bacteria 4427
130 Ga0501074_0629036 3300049590 Bacteria 759
131 Ga0501076_0048133 3300049592 Bacteria 3371
132 Ga0501079_0030403 3300049741 Bacteria 4149
133 Ga0501080_0007336 3300049742 Bacteria 9950
134 Ga0501080_0014896 3300049742 Bacteria 7160
135 Ga0501080_0107312 3300049742 Bacteria 2588
136 Ga0501083_0000308 3300049744 Bacteria 30932
137 Ga0501083_0067825 3300049744 Bacteria 2374
138 Ga0501044_0086957 3300049823 Bacteria 3157
139 nmdc:mga03683_222881_c1 3300050489 Unclassified 870
140 nmdc:mga03683_88920_c1 3300050489 Bacteria 1344
141 nmdc:mga03n38_103373_c1 3300050490 Bacteria 1377
142 nmdc:mga03n38_136799_c1 3300050490 Bacteria 1220
143 nmdc:mga03n38_54382_c1 3300050490 Bacteria 1799
144 nmdc:mga00v17_132770_c1 3300050491 Bacteria 1592
145 nmdc:mga00v17_318965_c1 3300050491 Bacteria 1010
146 nmdc:mga00v17_358260_c1 3300050491 Bacteria 948
147 nmdc:mga00v17_552739_c1 3300050491 Bacteria 744
148 nmdc:mga00v17_556840_c1 3300050491 Bacteria 741
149 nmdc:mga00v17_565971_c1 3300050491 Bacteria 734
150 nmdc:mga00v17_891227_c1 3300050491 Bacteria 564
151 nmdc:mga0yw44_129511_c1 3300050492 Bacteria 1632
152 nmdc:mga0yw44_1569_c1 3300050492 Bacteria 9161
153 nmdc:mga0yw44_20530_c1 3300050492 Bacteria 3668
154 nmdc:mga0yw44_360170_c1 3300050492 Bacteria 980
155 nmdc:mga0yw44_40272_c1 3300050492 Bacteria 2775
156 nmdc:mga0yw44_444267_c1 3300050492 Bacteria 879
157 nmdc:mga0yw44_59101_c1 3300050492 Bacteria 2344
158 nmdc:mga0yw44_8037_c1 3300050492 Bacteria 5231
159 nmdc:mga06z11_132429_c1 3300050494 Bacteria 1401
160 nmdc:mga06z11_22654_c1 3300050494 Bacteria 2937
161 nmdc:mga06z11_33429_c1 3300050494 Bacteria 2516
162 nmdc:mga06z11_343986_c1 3300050494 Unclassified 892
163 nmdc:mga06z11_455546_c1 3300050494 Bacteria 773
164 nmdc:mga06z11_79345_c1 3300050494 Bacteria 1757
165 nmdc:mga07m45_359370_c1 3300050496 Bacteria 846
166 nmdc:mga07m45_435897_c1 3300050496 Archaea 760
167 nmdc:mga0rr50_110739_c1 3300050513 Bacteria 2172
168 nmdc:mga0sz30_234777_c1 3300050516 Bacteria 816
169 Ga0495601_0295988 3300053077 Bacteria 1055
170 Ga0500635_0005093 3300053080 Bacteria 3428
171 Ga0495595_0181281 3300053084 Bacteria 1044
172 Ga0500616_0066510 3300053153 Bacteria 1850
173 Ga0501084_0019315 3300054114 Bacteria 5677
174 Ga0501082_0011657 3300060353 Bacteria 7558
175 Ga0530510_0191104 3300061734 Bacteria 1520

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039062 Ga0400483_039901 Ga0400483_039901_3733_4167 140
2 3300039062 Ga0400483_191237 Ga0400483_191237_2287_2721 140
3 3300039062 Ga0400483_128609 Ga0400483_128609_64_582 144
4 3300039062 Ga0400483_251055 Ga0400483_251055_398_916 144
5 3300046517 Ga0495630_1290337 Ga0495630_1290337_56_514 150
6 3300031903 Ga0307407_10261852 Ga0307407_102618522 156
7 3300005355 Ga0070671_100000584 Ga0070671_1000005848 158
8 3300050496 nmdc:mga07m45_359370_c1 nmdc:mga07m45_359370_c1_23_526 160
9 3300049584 Ga0501068_0000824 Ga0501068_0000824_1523_2032 162
10 3300049584 Ga0501068_0174234 Ga0501068_0174234_758_1267 162
11 3300049585 Ga0501069_0111084 Ga0501069_0111084_349_858 162
12 3300039062 Ga0400483_035083 Ga0400483_035083_822_1340 167
13 3300039062 Ga0400483_055656 Ga0400483_055656_818_1354 167
14 3300039062 Ga0400483_165176 Ga0400483_165176_3512_4030 167
15 3300039062 Ga0400483_175339 Ga0400483_175339_796_1314 167
16 3300039062 Ga0400483_217504 Ga0400483_217504_10804_11340 167
17 3300049573 Ga0501037_0512054 Ga0501037_0512054_195_713 167
18 3300049584 Ga0501068_0069514 Ga0501068_0069514_722_1240 167
19 3300049585 Ga0501069_0015939 Ga0501069_0015939_2665_3183 167
20 3300049586 Ga0501070_0007570 Ga0501070_0007570_5127_5645 167
21 3300049587 Ga0501071_0014550 Ga0501071_0014550_334_852 167
22 3300049589 Ga0501073_0002248 Ga0501073_0002248_11280_11798 167
23 3300049590 Ga0501074_0024049 Ga0501074_0024049_218_736 167
24 3300049741 Ga0501079_0030403 Ga0501079_0030403_2907_3425 167
25 3300049742 Ga0501080_0014896 Ga0501080_0014896_2014_2532 167
26 3300049744 Ga0501083_0000308 Ga0501083_0000308_27099_27617 167
27 3300054114 Ga0501084_0019315 Ga0501084_0019315_4324_4842 167
28 3300060353 Ga0501082_0011657 Ga0501082_0011657_4103_4621 167
29 3300005338 Ga0068868_101325410 Ga0068868_1013254102 168
30 3300005340 Ga0070689_100924276 Ga0070689_1009242761 168
31 3300005467 Ga0070706_100031045 Ga0070706_1000310451 168
32 3300005468 Ga0070707_100761244 Ga0070707_1007612442 168
33 3300005518 Ga0070699_100294384 Ga0070699_1002943842 168
34 3300005842 Ga0068858_100007994 Ga0068858_1000079949 168
35 3300005843 Ga0068860_100056353 Ga0068860_1000563532 168
36 3300005981 Ga0081538_10000101 Ga0081538_1000010169 168
37 3300006038 Ga0075365_10002996 Ga0075365_100029967 168
38 3300006038 Ga0075365_10019496 Ga0075365_100194962 168
39 3300006038 Ga0075365_10045490 Ga0075365_100454902 168
40 3300006038 Ga0075365_10063056 Ga0075365_100630562 168
41 3300006038 Ga0075365_10079901 Ga0075365_100799011 168
42 3300006038 Ga0075365_10093650 Ga0075365_100936502 168
43 3300006038 Ga0075365_10126692 Ga0075365_101266922 168
44 3300006038 Ga0075365_10237797 Ga0075365_102377972 168
45 3300006038 Ga0075365_10469032 Ga0075365_104690322 168
46 3300006042 Ga0075368_10167805 Ga0075368_101678052 168
47 3300006048 Ga0075363_100015113 Ga0075363_1000151135 168
48 3300006048 Ga0075363_100090127 Ga0075363_1000901272 168
49 3300006048 Ga0075363_100129538 Ga0075363_1001295382 168
50 3300006051 Ga0075364_10000890 Ga0075364_100008902 168
51 3300006051 Ga0075364_10014308 Ga0075364_100143084 168
52 3300006051 Ga0075364_10028873 Ga0075364_100288735 168
53 3300006051 Ga0075364_10031706 Ga0075364_100317062 168
54 3300006051 Ga0075364_10060982 Ga0075364_100609822 168
55 3300006051 Ga0075364_10163755 Ga0075364_101637552 168
56 3300006051 Ga0075364_10299568 Ga0075364_102995682 168
57 3300006051 Ga0075364_10640383 Ga0075364_106403831 168
58 3300006175 Ga0070712_100648229 Ga0070712_1006482292 168
59 3300006175 Ga0070712_100829924 Ga0070712_1008299241 168
60 3300006178 Ga0075367_10003638 Ga0075367_100036384 168
61 3300006178 Ga0075367_10006114 Ga0075367_100061142 168
62 3300006178 Ga0075367_10089317 Ga0075367_100893172 168
63 3300006178 Ga0075367_10097258 Ga0075367_100972582 168
64 3300006178 Ga0075367_10393901 Ga0075367_103939011 168
65 3300006186 Ga0075369_10119572 Ga0075369_101195722 168
66 3300006186 Ga0075369_10275104 Ga0075369_102751042 168
67 3300006353 Ga0075370_10069883 Ga0075370_100698832 168
68 3300006353 Ga0075370_10309216 Ga0075370_103092162 168
69 3300007076 Ga0075435_100123530 Ga0075435_1001235302 168
70 3300009098 Ga0105245_10042273 Ga0105245_100422732 168
71 3300009147 Ga0114129_10096009 Ga0114129_100960093 168
72 3300025910 Ga0207684_10393045 Ga0207684_103930452 168
73 3300025927 Ga0207687_10016837 Ga0207687_100168372 168
74 3300025931 Ga0207644_10222545 Ga0207644_102225452 168
75 3300025944 Ga0207661_10729684 Ga0207661_107296842 168
76 3300026023 Ga0207677_11105683 Ga0207677_111056832 168
77 3300026035 Ga0207703_10006305 Ga0207703_100063058 168
78 3300028381 Ga0268264_10106209 Ga0268264_101062092 168
79 3300031728 Ga0316578_10046230 Ga0316578_100462302 168
80 3300031852 Ga0307410_10091034 Ga0307410_100910342 168
81 3300031903 Ga0307407_10028980 Ga0307407_100289801 168
82 3300031995 Ga0307409_100010555 Ga0307409_1000105552 168
83 3300031995 Ga0307409_102142585 Ga0307409_1021425851 168
84 3300032002 Ga0307416_100044054 Ga0307416_1000440541 168
85 3300032126 Ga0307415_100018880 Ga0307415_1000188802 168
86 3300032137 Ga0316585_10080649 Ga0316585_100806492 168
87 3300032139 Ga0316580_10034252 Ga0316580_100342522 168
88 3300035117 Ga0373953_0045585 Ga0373953_0045585_270_794 168
89 3300035172 Ga0373955_0389315 Ga0373955_0389315_52_576 168
90 3300035398 Ga0316574_0073627 Ga0316574_0073627_1332_1892 168
91 3300035691 Ga0373931_0000469 Ga0373931_0000469_8608_9120 168
92 3300035724 Ga0373933_0101453 Ga0373933_0101453_1248_1772 168
93 3300036401 Ga0373937_0016416 Ga0373937_0016416_3391_3915 168
94 3300036647 Ga0316582_0023304 Ga0316582_0023304_3013_3573 168
95 3300036712 Ga0316584_0218932 Ga0316584_0218932_269_829 168
96 3300039438 Ga0436360_1222521 Ga0436360_1222521_482_991 168
97 3300039447 Ga0436361_0807531 Ga0436361_0807531_106_615 168
98 3300039453 Ga0436362_1192036 Ga0436362_1192036_1121_1630 168
99 3300041452 Ga0451793_1593654 Ga0451793_1593654_300_827 168
100 3300042010 Ga0439452_027114 Ga0439452_027114_57_575 168
101 3300042435 Ga0439434_0015540 Ga0439434_0015540_1239_1757 168
102 3300046462 Ga0495651_0002877 Ga0495651_0002877_8786_9310 168
103 3300046463 Ga0495653_0047213 Ga0495653_0047213_1577_2101 168
104 3300046477 Ga0495664_0260201 Ga0495664_0260201_115_639 168
105 3300046511 Ga0495608_0141363 Ga0495608_0141363_359_883 168
106 3300046517 Ga0495630_0899895 Ga0495630_0899895_123_647 168
107 3300046533 Ga0495640_0514853 Ga0495640_0514853_111_635 168
108 3300046536 Ga0495587_0016637 Ga0495587_0016637_3165_3689 168
109 3300046543 Ga0495645_0606839 Ga0495645_0606839_94_618 168
110 3300046559 Ga0495667_0003496 Ga0495667_0003496_6385_6909 168
111 3300046679 Ga0495623_0120910 Ga0495623_0120910_860_1384 168
112 3300046809 Ga0495600_0009914 Ga0495600_0009914_2020_2544 168
113 3300047317 Ga0495604_0041330 Ga0495604_0041330_80_604 168
114 3300047471 Ga0495684_0664952 Ga0495684_0664952_125_649 168
115 3300047673 Ga0495593_0356760 Ga0495593_0356760_147_671 168
116 3300048088 Ga0495602_0141986 Ga0495602_0141986_623_1147 168
117 3300048904 Ga0496101_0247709 Ga0496101_0247709_299_838 168
118 3300048911 Ga0496108_0110838 Ga0496108_0110838_620_1159 168
119 3300048913 Ga0496110_0437468 Ga0496110_0437468_523_1062 168
120 3300049571 Ga0501034_0000425 Ga0501034_0000425_32581_33117 168
121 3300049571 Ga0501034_0008034 Ga0501034_0008034_8213_8743 168
122 3300049571 Ga0501034_0030221 Ga0501034_0030221_3908_4444 168
123 3300049572 Ga0501036_0520445 Ga0501036_0520445_447_968 168
124 3300049573 Ga0501037_0329203 Ga0501037_0329203_122_652 168
125 3300049583 Ga0501067_0148877 Ga0501067_0148877_382_912 168
126 3300049583 Ga0501067_0386547 Ga0501067_0386547_23_550 168
127 3300049584 Ga0501068_0000422 Ga0501068_0000422_101_631 168
128 3300049585 Ga0501069_0000009 Ga0501069_0000009_86666_87217 168
129 3300049585 Ga0501069_0012453 Ga0501069_0012453_3369_3881 168
130 3300049586 Ga0501070_0000006 Ga0501070_0000006_121107_121658 168
131 3300049586 Ga0501070_0041618 Ga0501070_0041618_866_1396 168
132 3300049586 Ga0501070_0144629 Ga0501070_0144629_764_1285 168
133 3300049586 Ga0501070_1062659 Ga0501070_1062659_35_562 168
134 3300049589 Ga0501073_0008961 Ga0501073_0008961_4404_4934 168
135 3300049590 Ga0501074_0000337 Ga0501074_0000337_20878_21408 168
136 3300049590 Ga0501074_0629036 Ga0501074_0629036_110_661 168
137 3300049592 Ga0501076_0048133 Ga0501076_0048133_1924_2454 168
138 3300049742 Ga0501080_0007336 Ga0501080_0007336_8061_8612 168
139 3300049742 Ga0501080_0107312 Ga0501080_0107312_902_1435 168
140 3300049744 Ga0501083_0067825 Ga0501083_0067825_897_1430 168
141 3300049823 Ga0501044_0086957 Ga0501044_0086957_2559_3080 168
142 3300050489 nmdc:mga03683_222881_c1 nmdc:mga03683_222881_c1_295_822 168
143 3300050489 nmdc:mga03683_88920_c1 nmdc:mga03683_88920_c1_252_779 168
144 3300050490 nmdc:mga03n38_103373_c1 nmdc:mga03n38_103373_c1_48_575 168
145 3300050490 nmdc:mga03n38_136799_c1 nmdc:mga03n38_136799_c1_592_1116 168
146 3300050490 nmdc:mga03n38_54382_c1 nmdc:mga03n38_54382_c1_461_988 168
147 3300050491 nmdc:mga00v17_132770_c1 nmdc:mga00v17_132770_c1_832_1368 168
148 3300050491 nmdc:mga00v17_318965_c1 nmdc:mga00v17_318965_c1_41_568 168
149 3300050491 nmdc:mga00v17_358260_c1 nmdc:mga00v17_358260_c1_87_626 168
150 3300050491 nmdc:mga00v17_552739_c1 nmdc:mga00v17_552739_c1_19_555 168
151 3300050491 nmdc:mga00v17_556840_c1 nmdc:mga00v17_556840_c1_32_559 168
152 3300050491 nmdc:mga00v17_565971_c1 nmdc:mga00v17_565971_c1_141_668 168
153 3300050491 nmdc:mga00v17_891227_c1 nmdc:mga00v17_891227_c1_25_552 168
154 3300050492 nmdc:mga0yw44_129511_c1 nmdc:mga0yw44_129511_c1_178_705 168
155 3300050492 nmdc:mga0yw44_1569_c1 nmdc:mga0yw44_1569_c1_116_652 168
156 3300050492 nmdc:mga0yw44_20530_c1 nmdc:mga0yw44_20530_c1_2901_3425 168
157 3300050492 nmdc:mga0yw44_360170_c1 nmdc:mga0yw44_360170_c1_40_567 168
158 3300050492 nmdc:mga0yw44_40272_c1 nmdc:mga0yw44_40272_c1_1020_1547 168
159 3300050492 nmdc:mga0yw44_444267_c1 nmdc:mga0yw44_444267_c1_263_802 168
160 3300050492 nmdc:mga0yw44_59101_c1 nmdc:mga0yw44_59101_c1_1695_2225 168
161 3300050492 nmdc:mga0yw44_8037_c1 nmdc:mga0yw44_8037_c1_2176_2703 168
162 3300050494 nmdc:mga06z11_132429_c1 nmdc:mga06z11_132429_c1_119_643 168
163 3300050494 nmdc:mga06z11_22654_c1 nmdc:mga06z11_22654_c1_1980_2537 168
164 3300050494 nmdc:mga06z11_33429_c1 nmdc:mga06z11_33429_c1_684_1211 168
165 3300050494 nmdc:mga06z11_343986_c1 nmdc:mga06z11_343986_c1_257_781 168
166 3300050494 nmdc:mga06z11_455546_c1 nmdc:mga06z11_455546_c1_19_546 168
167 3300050494 nmdc:mga06z11_79345_c1 nmdc:mga06z11_79345_c1_44_571 168
168 3300050496 nmdc:mga07m45_435897_c1 nmdc:mga07m45_435897_c1_30_557 168
169 3300050513 nmdc:mga0rr50_110739_c1 nmdc:mga0rr50_110739_c1_931_1443 168
170 3300050516 nmdc:mga0sz30_234777_c1 nmdc:mga0sz30_234777_c1_270_794 168
171 3300053077 Ga0495601_0295988 Ga0495601_0295988_27_551 168
172 3300053080 Ga0500635_0005093 Ga0500635_0005093_2650_3177 168
173 3300053084 Ga0495595_0181281 Ga0495595_0181281_189_713 168
174 3300053153 Ga0500616_0066510 Ga0500616_0066510_233_769 168
175 3300061734 Ga0530510_0191104 Ga0530510_0191104_107_637 168

Structural Annotation

Top 5 Hits

ID Description Score Start End
5vhn-assembly1.cif.gz_C conformational landscape of the p28-bound human proteasome regulatory particle 0.4546 48 106
5vhh-assembly1.cif.gz_C conformational landscape of the p28-bound human proteasome regulatory particle 0.4491 48 106
3whl-assembly1.cif.gz_A crystal structure of nas2 n-terminal domain complexed with pan-rpt5c chimera 0.4216 50 106
4ozd-assembly2.cif.gz_B crystal structure of pdsp15a 0.4137 47 126
4jd9-assembly4.cif.gz_D contact pathway inhibitor from a sand fly 0.4113 47 126
ID Description Score Start End Superfamily
af_K7MXY1_63_164_1.10.472.10 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Cyclin-like 0.4927 49 102 1.10.472.10
af_Q90459_155_262_1.10.472.10 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Cyclin-like 0.4624 55 162 1.10.472.10
af_Q86LH3_1_311_2.60.470.10 Mainly Beta;Sandwich;Acid-sensing ion channels like fold;Acid-sensing ion channels like domains 0.4593 56 140 2.60.470.10
1c9bQ01 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Cyclin-like 0.4288 47 129 1.10.472.10
af_F1R9S3_76_179_1.10.472.10 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Cyclin-like 0.4252 48 107 1.10.472.10
ID Description Score Start End GO Terms
AF-A0A381V3F4-F1-model_v4 Uncharacterized protein 0.9708 59 149
AF-A0A6J6Z2C9-F1-model_v4 Unannotated protein 0.9401 66 168
AF-A0A2E5I132-F1-model_v4 deleted 0.9194 45 166
AF-A0A359A495-F1-model_v4 deleted 0.8847 45 165
AF-A0A6J6Z2C9-F1-model_v4 Unannotated protein 0.8829 66 168

Feature Viewer

pLDDT pTM Quality
82.92 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map