F264937
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 174 | 142 | 137 | 354 |
Family's Representative Sequence
| Representative Sequence | 3300037471|Ga0395905_0034741|Ga0395905_0034741_814_2067 |
| Length | 398 |
| Sequence | MPEADHLWAAHGAILASRRRVGAVGLPALSDRRCILTGPAPLAASARVAPPEWESMMTVVLAVGTSKGLFLATSTDDRKTFDVSGPHFPMNAIYAVGMDKRRARPRLLASVTSSHFGPSVATSDDLGASWREPDQAPLAFPSDTEVSLERVWQFAPGPAGEPDLVYAGTQPSALFRSVDGGQTYEIVRALWDHPHREHWGAGFGGQAIHTVLPHPADPAQVLVAMSTGGVYRTVDSGAGWSPGNTGIHARYSPDPWPEYGQCVHKVARDPVEADRLYAQVHHGVYRSDDGGSAWQSIAGGLPSDFGFPIVAHPHRAGVIYNFPLTADGERFPVDQRCRVYRSSDAGATWEALDSGLPEEPCYATVLRDAMAADDCDTAGVYFGTRTGEVVLCVRAMEV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501039 | Frankia saprophytica CN3 | Isolate | Nodule |
| 2 | 2643221631 | Kitasatospora sp. Root107 | Isolate | Unclassified |
| 3 | 2675902999 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 4 | 2675903059 | Asanoa hainanensis CGMCC 4.5593 | Isolate | Rhizosphere |
| 5 | 2687453737 | Frankia sp. BMG5.36 | Isolate | Nodule |
| 6 | 2731639228 | Motilibacter peucedani DSM 45328 | Isolate | Rhizosphere |
| 7 | 2751185734 | Saccharothrix sp. NRRL B-16314 | Isolate | Rhizosphere |
| 8 | 2772190715 | Micromonospora chokoriensis NRRL B-24750 | Isolate | Unclassified |
| 9 | 2773857921 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 10 | 2795385472 | Herbihabitans rhizosphaerae DSM 101727 | Isolate | Rhizosphere |
| 11 | 2816332119 | Kribbella amoyensis DSM 24683 | Isolate | Rhizosphere |
| 12 | 2855670206 | Micromonospora noduli Lupac 07 | Isolate | Nodule |
| 13 | 2855676851 | Micromonospora saelicesensis GAR05 | Isolate | Unclassified |
| 14 | 2857288857 | Micromonospora noduli ONO23 | Isolate | Unclassified |
| 15 | 2858848962 | Micromonospora saelicesensis GAR06 | Isolate | Unclassified |
| 16 | 2858868258 | Micromonospora sp. MH33 | Isolate | Unclassified |
| 17 | 2858882152 | Micromonospora noduli MED15 | Isolate | Nodule |
| 18 | 2858888857 | Micromonospora saelicesensis Lupac 06 | Isolate | Unclassified |
| 19 | 2858895516 | Micromonospora saelicesensis PSN13 | Isolate | Unclassified |
| 20 | 2869048445 | Micromonospora saelicesensis PSN01 | Isolate | Unclassified |
| 21 | 2869061728 | Micromonospora noduli ONO86 | Isolate | Unclassified |
| 22 | 2869068681 | Micromonospora noduli GUI43 | Isolate | Unclassified |
| 23 | 2870721527 | Saccharothrix ecbatanensis DSM 45486 | Isolate | Rhizosphere |
| 24 | 2880489317 | Micromonospora ureilytica DSM 101692 | Isolate | Unclassified |
| 25 | 2880495981 | Micromonospora vinacea DSM 101695 | Isolate | Unclassified |
| 26 | 2887478801 | Catellatospora paridis NEAU-CL2 | Isolate | Rhizosphere |
| 27 | 2902582711 | Micromonospora sp. AP08 | Isolate | Unclassified |
| 28 | 2929219909 | Micromonospora sp. R-75348 Hybrid assembly | Isolate | Unclassified |
| 29 | 2929226422 | Micromonospora sp. R-74116 Hybrid assembly | Isolate | Unclassified |
| 30 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 36 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 38 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 39 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 40 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 41 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 42 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 43 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 44 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 45 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 46 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 47 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 48 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 49 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 50 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 51 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 59 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 60 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 72 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 74 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 75 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 76 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 77 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 78 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 79 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 80 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 81 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 82 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 83 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 84 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 85 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 86 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 87 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 88 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 89 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 90 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 91 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 92 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 93 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 94 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 95 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 96 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 97 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 98 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 99 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 100 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 101 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 102 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 103 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 104 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 105 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 106 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 121 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 122 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 123 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 124 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 125 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 126 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 127 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 128 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 129 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 130 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 131 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 132 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 133 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 134 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 135 | 8002775197 | Frankia nepalensis CN7 | Isolate | Nodule |
| 136 | 8003830390 | Micromonospora parastrephiae STR1_7 | Isolate | Rhizosphere |
| 137 | 8003870546 | Micromonospora tarensis STR1s_6 | Isolate | Rhizosphere |
| 138 | 8054704163 | Micromonospora trifolii NIE79 | Isolate | Nodule |
| 139 | 8054727385 | Micromonospora alfalfae MED01 | Isolate | Nodule |
| 140 | 8054734606 | Micromonospora hortensis NIE111 | Isolate | Nodule |
| 141 | 8055172936 | Sphaerisporangium perillae NEAU-ZS1 | Isolate | Unclassified |
| 142 | 8055412473 | Micromonospora phytophila DSM 105363 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 78.16 |
| Metatranscriptomes | 0.57 |
| Isolates | 21.26 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.15 |
| Nodule | 6.32 |
| Rhizoplane | 4.6 |
| Rhizosphere | 73.56 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 14.37 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070668_100000160 | 3300005347 | Bacteria | 42522 |
| 2 | Ga0070668_100004651 | 3300005347 | Bacteria | 10167 |
| 3 | Ga0070674_100038922 | 3300005356 | Bacteria | 3208 |
| 4 | Ga0070714_100078412 | 3300005435 | Bacteria | 2871 |
| 5 | Ga0070663_100004449 | 3300005455 | Bacteria | 8243 |
| 6 | Ga0070706_100042958 | 3300005467 | Bacteria | 4176 |
| 7 | Ga0068853_100144245 | 3300005539 | Bacteria | 2139 |
| 8 | Ga0070665_100080158 | 3300005548 | Bacteria | 3270 |
| 9 | Ga0068864_100137275 | 3300005618 | Bacteria | 2203 |
| 10 | Ga0068864_100152107 | 3300005618 | Bacteria | 2097 |
| 11 | Ga0068863_100004657 | 3300005841 | Bacteria | 13521 |
| 12 | Ga0081455_10001073 | 3300005937 | Bacteria | 34404 |
| 13 | Ga0081455_10006873 | 3300005937 | Bacteria | 12118 |
| 14 | Ga0081455_10008504 | 3300005937 | Bacteria | 10664 |
| 15 | Ga0081455_10046646 | 3300005937 | Bacteria | 3758 |
| 16 | Ga0081539_10001020 | 3300005985 | Bacteria | 51615 |
| 17 | Ga0075364_10026884 | 3300006051 | Bacteria | 3674 |
| 18 | Ga0075432_10000200 | 3300006058 | Bacteria | 15700 |
| 19 | Ga0075428_100000090 | 3300006844 | Bacteria | 74510 |
| 20 | Ga0075428_100002187 | 3300006844 | Bacteria | 21146 |
| 21 | Ga0075428_100032838 | 3300006844 | Bacteria | 5731 |
| 22 | Ga0075430_100116262 | 3300006846 | Bacteria | 2229 |
| 23 | Ga0075431_100025212 | 3300006847 | Bacteria | 6095 |
| 24 | Ga0075431_100300544 | 3300006847 | Bacteria | 1622 |
| 25 | Ga0075433_10004368 | 3300006852 | Bacteria | 10988 |
| 26 | Ga0075433_10015323 | 3300006852 | Bacteria | 6283 |
| 27 | Ga0075434_100007407 | 3300006871 | Bacteria | 10162 |
| 28 | Ga0075429_100073362 | 3300006880 | Bacteria | 2981 |
| 29 | Ga0075436_100004280 | 3300006914 | Bacteria | 9806 |
| 30 | Ga0075436_100051575 | 3300006914 | Bacteria | 2839 |
| 31 | Ga0075435_100003511 | 3300007076 | Bacteria | 10644 |
| 32 | Ga0075435_100030168 | 3300007076 | Bacteria | 4261 |
| 33 | Ga0111539_10015633 | 3300009094 | Bacteria | 9436 |
| 34 | Ga0111539_10032146 | 3300009094 | Bacteria | 6375 |
| 35 | Ga0114129_10005166 | 3300009147 | Bacteria | 18371 |
| 36 | Ga0114129_10044360 | 3300009147 | Bacteria | 6255 |
| 37 | Ga0114129_10537367 | 3300009147 | Bacteria | 1522 |
| 38 | Ga0105243_10017592 | 3300009148 | Bacteria | 5406 |
| 39 | Ga0105242_10135791 | 3300009176 | Unclassified | 2128 |
| 40 | Ga0163162_10162768 | 3300013306 | Bacteria | 2353 |
| 41 | Ga0163163_10025562 | 3300014325 | Bacteria | 5630 |
| 42 | Ga0163161_10138829 | 3300017792 | Bacteria | 1839 |
| 43 | Ga0197907_11070600 | 3300020069 | Bacteria | 1429 |
| 44 | Ga0213876_10009974 | 3300021384 | Bacteria | 5104 |
| 45 | Ga0207664_10076904 | 3300025929 | Bacteria | 2703 |
| 46 | Ga0207690_10063286 | 3300025932 | Bacteria | 2522 |
| 47 | Ga0207706_10022085 | 3300025933 | Bacteria | 5711 |
| 48 | Ga0207709_10019009 | 3300025935 | Bacteria | 3855 |
| 49 | Ga0207667_10270330 | 3300025949 | Bacteria | 1738 |
| 50 | Ga0207668_10000597 | 3300025972 | Bacteria | 22455 |
| 51 | Ga0207668_10029353 | 3300025972 | Bacteria | 3604 |
| 52 | Ga0207678_10001733 | 3300026067 | Bacteria | 19957 |
| 53 | Ga0207702_10244301 | 3300026078 | Bacteria | 1683 |
| 54 | Ga0207641_10016268 | 3300026088 | Bacteria | 6092 |
| 55 | Ga0207676_10173078 | 3300026095 | Bacteria | 1883 |
| 56 | Ga0207676_10203454 | 3300026095 | Bacteria | 1751 |
| 57 | Ga0207675_100025396 | 3300026118 | Bacteria | 5514 |
| 58 | Ga0207428_10000522 | 3300027907 | Bacteria | 45986 |
| 59 | Ga0207428_10000747 | 3300027907 | Bacteria | 37176 |
| 60 | Ga0268266_10016784 | 3300028379 | Bacteria | 6259 |
| 61 | Ga0307515_10082548 | 3300028794 | Bacteria | 4154 |
| 62 | Ga0307513_10015333 | 3300031456 | Bacteria | 9293 |
| 63 | Ga0307509_10078840 | 3300031507 | Bacteria | 3411 |
| 64 | Ga0307408_100001746 | 3300031548 | Bacteria | 15861 |
| 65 | Ga0307405_10007434 | 3300031731 | Bacteria | 5480 |
| 66 | Ga0307518_10014471 | 3300031838 | Bacteria | 5640 |
| 67 | Ga0307410_10000105 | 3300031852 | Bacteria | 29319 |
| 68 | Ga0307406_10000266 | 3300031901 | Bacteria | 31369 |
| 69 | Ga0307406_10117322 | 3300031901 | Bacteria | 1844 |
| 70 | Ga0307407_10042839 | 3300031903 | Bacteria | 2541 |
| 71 | Ga0307407_10095250 | 3300031903 | Bacteria | 1835 |
| 72 | Ga0307409_100000004 | 3300031995 | Bacteria | 84332 |
| 73 | Ga0307416_100000085 | 3300032002 | Bacteria | 64569 |
| 74 | Ga0307415_100000482 | 3300032126 | Bacteria | 17247 |
| 75 | Ga0307415_100336293 | 3300032126 | Bacteria | 1265 |
| 76 | Ga0373934_0009189 | 3300035086 | Bacteria | 3701 |
| 77 | Ga0373956_0029380 | 3300035119 | Bacteria | 2397 |
| 78 | Ga0373924_0032579 | 3300035410 | Bacteria | 2100 |
| 79 | Ga0395900_0037368 | 3300037418 | Bacteria | 5007 |
| 80 | Ga0395898_0009880 | 3300037466 | Bacteria | 10004 |
| 81 | Ga0395905_0034741 | 3300037471 | Bacteria | 4734 |
| 82 | Ga0436365_0723412 | 3300039437 | Bacteria | 3900 |
| 83 | Ga0436365_1426582 | 3300039437 | Bacteria | 2552 |
| 84 | Ga0451837_0562212 | 3300041494 | Bacteria | 3334 |
| 85 | Ga0439448_0015460 | 3300042005 | Bacteria | 2312 |
| 86 | Ga0439463_003015 | 3300042016 | Bacteria | 4274 |
| 87 | Ga0439464_0014756 | 3300042439 | Bacteria | 2104 |
| 88 | Ga0466969_0103126 | 3300044656 | Bacteria | 1341 |
| 89 | Ga0466972_0057201 | 3300044658 | Bacteria | 1873 |
| 90 | Ga0466965_0138725 | 3300044683 | Bacteria | 1265 |
| 91 | Ga0466961_0005095 | 3300044693 | Bacteria | 8270 |
| 92 | Ga0466963_0000317 | 3300044694 | Bacteria | 21773 |
| 93 | Ga0466963_0050947 | 3300044694 | Bacteria | 2742 |
| 94 | Ga0466963_0165316 | 3300044694 | Bacteria | 1541 |
| 95 | Ga0466963_0180887 | 3300044694 | Bacteria | 1472 |
| 96 | Ga0466964_0057675 | 3300044706 | Bacteria | 1608 |
| 97 | Ga0466970_0015428 | 3300044765 | Bacteria | 3928 |
| 98 | Ga0466957_0105489 | 3300044842 | Bacteria | 1781 |
| 99 | Ga0466958_0003111 | 3300045836 | Bacteria | 8525 |
| 100 | Ga0466967_0002714 | 3300045976 | Bacteria | 11186 |
| 101 | Ga0466967_0004617 | 3300045976 | Bacteria | 9334 |
| 102 | Ga0466967_0062876 | 3300045976 | Bacteria | 3296 |
| 103 | Ga0495651_0014532 | 3300046462 | Bacteria | 6086 |
| 104 | Ga0495639_0037153 | 3300046475 | Bacteria | 2183 |
| 105 | Ga0495594_0003959 | 3300046499 | Bacteria | 7625 |
| 106 | Ga0495608_0063118 | 3300046511 | Bacteria | 2432 |
| 107 | Ga0495628_0218025 | 3300046516 | Bacteria | 1434 |
| 108 | Ga0495652_0043648 | 3300046529 | Bacteria | 3861 |
| 109 | Ga0495587_0074741 | 3300046536 | Bacteria | 1968 |
| 110 | Ga0495668_0000563 | 3300046616 | Bacteria | 45601 |
| 111 | Ga0495625_0000763 | 3300046660 | Bacteria | 44832 |
| 112 | Ga0495657_0078391 | 3300046675 | Bacteria | 2141 |
| 113 | Ga0495623_0042049 | 3300046679 | Bacteria | 2912 |
| 114 | Ga0495672_0074059 | 3300047320 | Bacteria | 1919 |
| 115 | Ga0495675_0150287 | 3300047444 | Bacteria | 1439 |
| 116 | Ga0495626_0000029 | 3300048091 | Bacteria | 202868 |
| 117 | Ga0496104_0158357 | 3300048907 | Bacteria | 2173 |
| 118 | Ga0496104_0190467 | 3300048907 | Bacteria | 1962 |
| 119 | Ga0496105_0203246 | 3300048908 | Bacteria | 1617 |
| 120 | Ga0496108_0041248 | 3300048911 | Bacteria | 3852 |
| 121 | Ga0496109_0012913 | 3300048912 | Bacteria | 7222 |
| 122 | Ga0496110_0091838 | 3300048913 | Bacteria | 2716 |
| 123 | Ga0496112_0081234 | 3300048915 | Bacteria | 3205 |
| 124 | Ga0496112_0081922 | 3300048915 | Bacteria | 3191 |
| 125 | nmdc:mga00v17_41831_c1 | 3300050491 | Bacteria | 2753 |
| 126 | nmdc:mga09592_191763_c1 | 3300050508 | Bacteria | 1769 |
| 127 | nmdc:mga0qj67_84170_c1 | 3300050509 | Bacteria | 2550 |
| 128 | nmdc:mga06r32_13437_c1 | 3300050510 | Bacteria | 7415 |
| 129 | nmdc:mga06r32_20888_c1 | 3300050510 | Bacteria | 6035 |
| 130 | nmdc:mga08y16_22679_c1 | 3300050511 | Bacteria | 6629 |
| 131 | nmdc:mga08y16_3625_c1 | 3300050511 | Bacteria | 16038 |
| 132 | nmdc:mga0n895_2894_c1 | 3300050512 | Bacteria | 13623 |
| 133 | nmdc:mga0n895_3493_c1 | 3300050512 | Bacteria | 12692 |
| 134 | nmdc:mga0rr50_1041_c1 | 3300050513 | Bacteria | 15041 |
| 135 | nmdc:mga08x19_54065_c1 | 3300050514 | Bacteria | 2584 |
| 136 | nmdc:mga0a205_3561_c1 | 3300050515 | Bacteria | 13940 |
| 137 | nmdc:mga0a205_3817_c1 | 3300050515 | Bacteria | 13505 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050512 | nmdc:mga0n895_3493_c1 | nmdc:mga0n895_3493_c1_5104_6189 | 315 |
| 2 | 3300006058 | Ga0075432_10000200 | Ga0075432_100002008 | 326 |
| 3 | 3300006852 | Ga0075433_10004368 | Ga0075433_100043685 | 326 |
| 4 | 3300006871 | Ga0075434_100007407 | Ga0075434_1000074073 | 326 |
| 5 | 3300006914 | Ga0075436_100004280 | Ga0075436_1000042804 | 326 |
| 6 | 3300007076 | Ga0075435_100030168 | Ga0075435_1000301684 | 326 |
| 7 | 3300009094 | Ga0111539_10015633 | Ga0111539_100156336 | 326 |
| 8 | 3300027907 | Ga0207428_10000522 | Ga0207428_1000052233 | 326 |
| 9 | 3300050511 | nmdc:mga08y16_3625_c1 | nmdc:mga08y16_3625_c1_8383_9468 | 326 |
| 10 | 3300050515 | nmdc:mga0a205_3561_c1 | nmdc:mga0a205_3561_c1_6425_7510 | 326 |
| 11 | 3300044658 | Ga0466972_0057201 | Ga0466972_0057201_112_1194 | 330 |
| 12 | 3300005435 | Ga0070714_100078412 | Ga0070714_1000784124 | 331 |
| 13 | 3300025929 | Ga0207664_10076904 | Ga0207664_100769044 | 331 |
| 14 | iso_pu_bacteria | 2751185734 | 2753071549 | 331 |
| 15 | iso_pu_bacteria | 2870721527 | 2870729489 | 331 |
| 16 | 3300046475 | Ga0495639_0037153 | Ga0495639_0037153_1066_2124 | 332 |
| 17 | 3300005467 | Ga0070706_100042958 | Ga0070706_1000429585 | 335 |
| 18 | 3300009147 | Ga0114129_10044360 | Ga0114129_100443602 | 335 |
| 19 | 3300021384 | Ga0213876_10009974 | Ga0213876_100099745 | 335 |
| 20 | 3300039437 | Ga0436365_0723412 | Ga0436365_0723412_368_1447 | 335 |
| 21 | 3300039437 | Ga0436365_1426582 | Ga0436365_1426582_752_1834 | 335 |
| 22 | 3300006051 | Ga0075364_10026884 | Ga0075364_100268844 | 336 |
| 23 | 3300047320 | Ga0495672_0074059 | Ga0495672_0074059_126_1220 | 336 |
| 24 | 3300050491 | nmdc:mga00v17_41831_c1 | nmdc:mga00v17_41831_c1_772_1860 | 336 |
| 25 | 3300005548 | Ga0070665_100080158 | Ga0070665_1000801583 | 337 |
| 26 | 3300005618 | Ga0068864_100152107 | Ga0068864_1001521073 | 337 |
| 27 | 3300005841 | Ga0068863_100004657 | Ga0068863_1000046573 | 337 |
| 28 | 3300006846 | Ga0075430_100116262 | Ga0075430_1001162622 | 337 |
| 29 | 3300006880 | Ga0075429_100073362 | Ga0075429_1000733623 | 337 |
| 30 | 3300009147 | Ga0114129_10537367 | Ga0114129_105373673 | 337 |
| 31 | 3300026088 | Ga0207641_10016268 | Ga0207641_100162681 | 337 |
| 32 | 3300026095 | Ga0207676_10203454 | Ga0207676_102034542 | 337 |
| 33 | 3300031901 | Ga0307406_10117322 | Ga0307406_101173223 | 337 |
| 34 | 3300032126 | Ga0307415_100336293 | Ga0307415_1003362931 | 337 |
| 35 | 3300041494 | Ga0451837_0562212 | Ga0451837_0562212_1923_3023 | 337 |
| 36 | 3300050509 | nmdc:mga0qj67_84170_c1 | nmdc:mga0qj67_84170_c1_796_1869 | 337 |
| 37 | 3300050510 | nmdc:mga06r32_13437_c1 | nmdc:mga06r32_13437_c1_424_1497 | 337 |
| 38 | iso_pu_bacteria | 2675903059 | 2676486488 | 337 |
| 39 | iso_pu_bacteria | 2858868258 | 2858874899 | 337 |
| 40 | iso_pu_bacteria | 2902582711 | 2902586647 | 337 |
| 41 | 3300005356 | Ga0070674_100038922 | Ga0070674_1000389222 | 338 |
| 42 | 3300020069 | Ga0197907_11070600 | Ga0197907_110706002 | 338 |
| 43 | 3300037418 | Ga0395900_0037368 | Ga0395900_0037368_3264_4517 | 338 |
| 44 | 3300037466 | Ga0395898_0009880 | Ga0395898_0009880_6129_7382 | 338 |
| 45 | 3300044656 | Ga0466969_0103126 | Ga0466969_0103126_86_1168 | 338 |
| 46 | 3300044693 | Ga0466961_0005095 | Ga0466961_0005095_2991_4073 | 338 |
| 47 | iso_pu_bacteria | 2643221631 | 2644174549 | 338 |
| 48 | iso_pu_bacteria | 2731639228 | 2731906355 | 338 |
| 49 | iso_pu_bacteria | 2772190715 | 2772643665 | 338 |
| 50 | iso_pu_bacteria | 2795385472 | 2795792002 | 338 |
| 51 | iso_pu_bacteria | 2855670206 | 2855675165 | 338 |
| 52 | iso_pu_bacteria | 2855676851 | 2855681946 | 338 |
| 53 | iso_pu_bacteria | 2857288857 | 2857289176 | 338 |
| 54 | iso_pu_bacteria | 2858848962 | 2858849999 | 338 |
| 55 | iso_pu_bacteria | 2858882152 | 2858883490 | 338 |
| 56 | iso_pu_bacteria | 2858888857 | 2858891984 | 338 |
| 57 | iso_pu_bacteria | 2858895516 | 2858899334 | 338 |
| 58 | iso_pu_bacteria | 2869048445 | 2869051893 | 338 |
| 59 | iso_pu_bacteria | 2869061728 | 2869067940 | 338 |
| 60 | iso_pu_bacteria | 2869068681 | 2869073449 | 338 |
| 61 | iso_pu_bacteria | 2880489317 | 2880492025 | 338 |
| 62 | iso_pu_bacteria | 2880495981 | 2880500268 | 338 |
| 63 | iso_pu_bacteria | 2887478801 | 2887482930 | 338 |
| 64 | iso_pu_bacteria | 2929219909 | 2929222163 | 338 |
| 65 | iso_pu_bacteria | 2929226422 | 2929228830 | 338 |
| 66 | iso_pu_bacteria | 8003830390 | 8003835709 | 338 |
| 67 | iso_pu_bacteria | 8003870546 | 8003874143 | 338 |
| 68 | iso_pu_bacteria | 8054704163 | 8054706818 | 338 |
| 69 | iso_pu_bacteria | 8054727385 | 8054730844 | 338 |
| 70 | iso_pu_bacteria | 8054734606 | 8054738889 | 338 |
| 71 | iso_pu_bacteria | 8055172936 | 8055179140 | 338 |
| 72 | iso_pu_bacteria | 8055412473 | 8055412807 | 338 |
| 73 | 3300031507 | Ga0307509_10078840 | Ga0307509_100788402 | 339 |
| 74 | 3300031838 | Ga0307518_10014471 | Ga0307518_100144716 | 339 |
| 75 | 3300044683 | Ga0466965_0138725 | Ga0466965_0138725_155_1234 | 339 |
| 76 | 3300044694 | Ga0466963_0000317 | Ga0466963_0000317_10942_12024 | 339 |
| 77 | 3300044706 | Ga0466964_0057675 | Ga0466964_0057675_302_1384 | 339 |
| 78 | 3300044765 | Ga0466970_0015428 | Ga0466970_0015428_1789_2868 | 339 |
| 79 | 3300044842 | Ga0466957_0105489 | Ga0466957_0105489_108_1190 | 339 |
| 80 | 3300045836 | Ga0466958_0003111 | Ga0466958_0003111_4309_5391 | 339 |
| 81 | 3300045976 | Ga0466967_0004617 | Ga0466967_0004617_6312_7394 | 339 |
| 82 | 3300048907 | Ga0496104_0190467 | Ga0496104_0190467_61_1146 | 339 |
| 83 | 3300048908 | Ga0496105_0203246 | Ga0496105_0203246_387_1472 | 339 |
| 84 | 3300048915 | Ga0496112_0081922 | Ga0496112_0081922_309_1394 | 339 |
| 85 | iso_pu_bacteria | 2816332119 | 2816427418 | 339 |
| 86 | 3300005347 | Ga0070668_100004651 | Ga0070668_1000046515 | 340 |
| 87 | 3300005455 | Ga0070663_100004449 | Ga0070663_1000044498 | 340 |
| 88 | 3300005618 | Ga0068864_100137275 | Ga0068864_1001372753 | 340 |
| 89 | 3300006847 | Ga0075431_100300544 | Ga0075431_1003005442 | 340 |
| 90 | 3300009148 | Ga0105243_10017592 | Ga0105243_100175923 | 340 |
| 91 | 3300025972 | Ga0207668_10029353 | Ga0207668_100293531 | 340 |
| 92 | 3300026067 | Ga0207678_10001733 | Ga0207678_100017337 | 340 |
| 93 | 3300026078 | Ga0207702_10244301 | Ga0207702_102443012 | 340 |
| 94 | 3300026095 | Ga0207676_10173078 | Ga0207676_101730781 | 340 |
| 95 | 3300028794 | Ga0307515_10082548 | Ga0307515_100825483 | 340 |
| 96 | 3300031456 | Ga0307513_10015333 | Ga0307513_1001533311 | 340 |
| 97 | 3300044694 | Ga0466963_0050947 | Ga0466963_0050947_179_1261 | 340 |
| 98 | 3300044694 | Ga0466963_0165316 | Ga0466963_0165316_403_1491 | 340 |
| 99 | 3300044694 | Ga0466963_0180887 | Ga0466963_0180887_304_1395 | 340 |
| 100 | 3300045976 | Ga0466967_0002714 | Ga0466967_0002714_3583_4668 | 340 |
| 101 | 3300045976 | Ga0466967_0062876 | Ga0466967_0062876_31_1116 | 340 |
| 102 | 3300048907 | Ga0496104_0158357 | Ga0496104_0158357_418_1503 | 340 |
| 103 | 3300048911 | Ga0496108_0041248 | Ga0496108_0041248_1601_2686 | 340 |
| 104 | 3300048912 | Ga0496109_0012913 | Ga0496109_0012913_223_1308 | 340 |
| 105 | 3300048913 | Ga0496110_0091838 | Ga0496110_0091838_631_1716 | 340 |
| 106 | iso_pu_bacteria | 2508501039 | 2508678257 | 340 |
| 107 | iso_pu_bacteria | 2675902999 | 2676201651 | 340 |
| 108 | iso_pu_bacteria | 2687453737 | 2689959368 | 340 |
| 109 | iso_pu_bacteria | 2773857921 | 2774846227 | 340 |
| 110 | iso_pu_bacteria | 8002775197 | 8002782463 | 340 |
| 111 | 3300005539 | Ga0068853_100144245 | Ga0068853_1001442452 | 341 |
| 112 | 3300005937 | Ga0081455_10001073 | Ga0081455_100010739 | 341 |
| 113 | 3300005937 | Ga0081455_10006873 | Ga0081455_100068733 | 341 |
| 114 | 3300005937 | Ga0081455_10008504 | Ga0081455_100085047 | 341 |
| 115 | 3300005937 | Ga0081455_10046646 | Ga0081455_100466466 | 341 |
| 116 | 3300006844 | Ga0075428_100002187 | Ga0075428_10000218712 | 341 |
| 117 | 3300006844 | Ga0075428_100032838 | Ga0075428_1000328384 | 341 |
| 118 | 3300006847 | Ga0075431_100025212 | Ga0075431_1000252125 | 341 |
| 119 | 3300006852 | Ga0075433_10015323 | Ga0075433_100153234 | 341 |
| 120 | 3300006914 | Ga0075436_100051575 | Ga0075436_1000515753 | 341 |
| 121 | 3300007076 | Ga0075435_100003511 | Ga0075435_1000035113 | 341 |
| 122 | 3300009094 | Ga0111539_10032146 | Ga0111539_100321464 | 341 |
| 123 | 3300009147 | Ga0114129_10005166 | Ga0114129_100051669 | 341 |
| 124 | 3300009176 | Ga0105242_10135791 | Ga0105242_101357912 | 341 |
| 125 | 3300013306 | Ga0163162_10162768 | Ga0163162_101627682 | 341 |
| 126 | 3300017792 | Ga0163161_10138829 | Ga0163161_101388292 | 341 |
| 127 | 3300025932 | Ga0207690_10063286 | Ga0207690_100632862 | 341 |
| 128 | 3300025933 | Ga0207706_10022085 | Ga0207706_100220855 | 341 |
| 129 | 3300025949 | Ga0207667_10270330 | Ga0207667_102703301 | 341 |
| 130 | 3300026118 | Ga0207675_100025396 | Ga0207675_1000253962 | 341 |
| 131 | 3300027907 | Ga0207428_10000747 | Ga0207428_100007478 | 341 |
| 132 | 3300031548 | Ga0307408_100001746 | Ga0307408_1000017466 | 341 |
| 133 | 3300031852 | Ga0307410_10000105 | Ga0307410_1000010526 | 341 |
| 134 | 3300031901 | Ga0307406_10000266 | Ga0307406_1000026632 | 341 |
| 135 | 3300031903 | Ga0307407_10042839 | Ga0307407_100428392 | 341 |
| 136 | 3300031903 | Ga0307407_10095250 | Ga0307407_100952503 | 341 |
| 137 | 3300031995 | Ga0307409_100000004 | Ga0307409_10000000414 | 341 |
| 138 | 3300032002 | Ga0307416_100000085 | Ga0307416_10000008531 | 341 |
| 139 | 3300032126 | Ga0307415_100000482 | Ga0307415_1000004829 | 341 |
| 140 | 3300035086 | Ga0373934_0009189 | Ga0373934_0009189_1425_2522 | 341 |
| 141 | 3300035119 | Ga0373956_0029380 | Ga0373956_0029380_788_1942 | 341 |
| 142 | 3300035410 | Ga0373924_0032579 | Ga0373924_0032579_990_2087 | 341 |
| 143 | 3300037471 | Ga0395905_0034741 | Ga0395905_0034741_814_2067 | 341 |
| 144 | 3300042005 | Ga0439448_0015460 | Ga0439448_0015460_1050_2135 | 341 |
| 145 | 3300042016 | Ga0439463_003015 | Ga0439463_003015_1106_2191 | 341 |
| 146 | 3300042439 | Ga0439464_0014756 | Ga0439464_0014756_908_1993 | 341 |
| 147 | 3300046462 | Ga0495651_0014532 | Ga0495651_0014532_4137_5234 | 341 |
| 148 | 3300046499 | Ga0495594_0003959 | Ga0495594_0003959_3472_4557 | 341 |
| 149 | 3300046511 | Ga0495608_0063118 | Ga0495608_0063118_163_1260 | 341 |
| 150 | 3300046516 | Ga0495628_0218025 | Ga0495628_0218025_265_1362 | 341 |
| 151 | 3300046529 | Ga0495652_0043648 | Ga0495652_0043648_1445_2599 | 341 |
| 152 | 3300046536 | Ga0495587_0074741 | Ga0495587_0074741_756_1910 | 341 |
| 153 | 3300046675 | Ga0495657_0078391 | Ga0495657_0078391_882_1979 | 341 |
| 154 | 3300046679 | Ga0495623_0042049 | Ga0495623_0042049_476_1573 | 341 |
| 155 | 3300047444 | Ga0495675_0150287 | Ga0495675_0150287_180_1277 | 341 |
| 156 | 3300050508 | nmdc:mga09592_191763_c1 | nmdc:mga09592_191763_c1_569_1654 | 341 |
| 157 | 3300050510 | nmdc:mga06r32_20888_c1 | nmdc:mga06r32_20888_c1_3618_4706 | 341 |
| 158 | 3300050511 | nmdc:mga08y16_22679_c1 | nmdc:mga08y16_22679_c1_2708_3793 | 341 |
| 159 | 3300050512 | nmdc:mga0n895_2894_c1 | nmdc:mga0n895_2894_c1_1972_3057 | 341 |
| 160 | 3300050513 | nmdc:mga0rr50_1041_c1 | nmdc:mga0rr50_1041_c1_9690_10775 | 341 |
| 161 | 3300050514 | nmdc:mga08x19_54065_c1 | nmdc:mga08x19_54065_c1_911_1996 | 341 |
| 162 | 3300050515 | nmdc:mga0a205_3817_c1 | nmdc:mga0a205_3817_c1_116_1201 | 341 |
| 163 | 3300005347 | Ga0070668_100000160 | Ga0070668_10000016014 | 342 |
| 164 | 3300005985 | Ga0081539_10001020 | Ga0081539_1000102013 | 342 |
| 165 | 3300006844 | Ga0075428_100000090 | Ga0075428_10000009040 | 342 |
| 166 | 3300014325 | Ga0163163_10025562 | Ga0163163_100255625 | 342 |
| 167 | 3300025935 | Ga0207709_10019009 | Ga0207709_100190093 | 342 |
| 168 | 3300025972 | Ga0207668_10000597 | Ga0207668_100005972 | 342 |
| 169 | 3300028379 | Ga0268266_10016784 | Ga0268266_100167843 | 342 |
| 170 | 3300031731 | Ga0307405_10007434 | Ga0307405_100074344 | 342 |
| 171 | 3300046616 | Ga0495668_0000563 | Ga0495668_0000563_9055_10140 | 342 |
| 172 | 3300046660 | Ga0495625_0000763 | Ga0495625_0000763_26262_27347 | 342 |
| 173 | 3300048091 | Ga0495626_0000029 | Ga0495626_0000029_3721_4806 | 342 |
| 174 | 3300048915 | Ga0496112_0081234 | Ga0496112_0081234_165_1250 | 342 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3b7f-assembly1.cif.gz_A | crystal structure of a putative glycosyl hydrolase with bnr repeats (reut_b4987) from ralstonia eutropha jmp134 at 2.20 a resolution | 0.9093 | 2 | 339 |
| 3b7f-assembly1.cif.gz_A | crystal structure of a putative glycosyl hydrolase with bnr repeats (reut_b4987) from ralstonia eutropha jmp134 at 2.20 a resolution | 0.8964 | 2 | 339 |
| 6hxi-assembly1.cif.gz_C-2 | structure of atp citrate lyase from methanothrix soehngenii in complex with citrate and coenzyme a | 0.7312 | 2 | 28 |
| 5ojr-assembly3.cif.gz_C | ycf48 bound to d1 peptide | 0.7197 | 7 | 311 |
| 8i7r-assembly1.cif.gz_P3 | in situ structure of axonemal doublet microtubules in mouse sperm with 48-nm repeat | 0.7153 | 5 | 339 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3b7fA00 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.8889 | 3 | 339 | 2.130.10.10 |
| 3b7fA00 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.8714 | 3 | 339 | 2.130.10.10 |
| af_O94365_34_213_2.130.10.10 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.7542 | 28 | 238 | 2.130.10.10 |
| af_P33215_130_332_2.130.10.10 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.7476 | 4 | 180 | 2.130.10.10 |
| af_Q8TED0_27_157_2.130.10.10 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.7264 | 20 | 178 | 2.130.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4R4R210-F1-model_v4 | Exo-alpha-sialidase | 0.9847 | 1 | 276 |
GO:0000272
GO:0010411 GO:0016798 |
| AF-A0A810L8I7-F1-model_v4 | Glycosyl hydrolase | 0.9826 | 1 | 315 |
GO:0000272
GO:0010411 GO:0016798 |
| AF-N1UYK0-F1-model_v4 | Glycosyl hydrolase | 0.9821 | 61 | 342 |
GO:0000272
GO:0010411 GO:0016798 |
| AF-A0A3D1AQV5-F1-model_v4 | Glycosyl hydrolase | 0.9797 | 225 | 330 |
|
| AF-C4RHV0-F1-model_v4 | Glycosyl hydrolase | 0.9781 | 1 | 240 |
GO:0000272
GO:0010411 GO:0016798 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar