F264937

General Info

Members Datasets Scaffolds Average Seq Length
174 142 137 354

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0034741|Ga0395905_0034741_814_2067
Length 398
Sequence MPEADHLWAAHGAILASRRRVGAVGLPALSDRRCILTGPAPLAASARVAPPEWESMMTVVLAVGTSKGLFLATSTDDRKTFDVSGPHFPMNAIYAVGMDKRRARPRLLASVTSSHFGPSVATSDDLGASWREPDQAPLAFPSDTEVSLERVWQFAPGPAGEPDLVYAGTQPSALFRSVDGGQTYEIVRALWDHPHREHWGAGFGGQAIHTVLPHPADPAQVLVAMSTGGVYRTVDSGAGWSPGNTGIHARYSPDPWPEYGQCVHKVARDPVEADRLYAQVHHGVYRSDDGGSAWQSIAGGLPSDFGFPIVAHPHRAGVIYNFPLTADGERFPVDQRCRVYRSSDAGATWEALDSGLPEEPCYATVLRDAMAADDCDTAGVYFGTRTGEVVLCVRAMEV

Samples

Sample ID Description Type Environment
1 2508501039 Frankia saprophytica CN3 Isolate Nodule
2 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
3 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
4 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
5 2687453737 Frankia sp. BMG5.36 Isolate Nodule
6 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
7 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
8 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
9 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
10 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
11 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
12 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
13 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
14 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
15 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
16 2858868258 Micromonospora sp. MH33 Isolate Unclassified
17 2858882152 Micromonospora noduli MED15 Isolate Nodule
18 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
19 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
20 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
21 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
22 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
23 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
24 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
25 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
26 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
27 2902582711 Micromonospora sp. AP08 Isolate Unclassified
28 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
29 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
42 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
58 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
60 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
72 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
74 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
75 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
76 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
77 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
78 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
79 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
80 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
81 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
82 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
83 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
84 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
85 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
86 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
87 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
88 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
89 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
90 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
91 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
92 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
93 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
94 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
95 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
96 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
97 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
98 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
99 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
100 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
101 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
102 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
103 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
104 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
105 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
106 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
107 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
108 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
109 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
110 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
111 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
112 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
113 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
114 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
115 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
116 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
117 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
118 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
119 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
120 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
121 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
122 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
123 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
124 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
125 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
126 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
127 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
128 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
129 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
130 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
131 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
132 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
133 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
134 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
135 8002775197 Frankia nepalensis CN7 Isolate Nodule
136 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
137 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
138 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
139 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
140 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
141 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
142 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 78.16
Metatranscriptomes 0.57
Isolates 21.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.15
Nodule 6.32
Rhizoplane 4.6
Rhizosphere 73.56
Stem 0
Stem Tuber 0
Unclassified 14.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070668_100000160 3300005347 Bacteria 42522
2 Ga0070668_100004651 3300005347 Bacteria 10167
3 Ga0070674_100038922 3300005356 Bacteria 3208
4 Ga0070714_100078412 3300005435 Bacteria 2871
5 Ga0070663_100004449 3300005455 Bacteria 8243
6 Ga0070706_100042958 3300005467 Bacteria 4176
7 Ga0068853_100144245 3300005539 Bacteria 2139
8 Ga0070665_100080158 3300005548 Bacteria 3270
9 Ga0068864_100137275 3300005618 Bacteria 2203
10 Ga0068864_100152107 3300005618 Bacteria 2097
11 Ga0068863_100004657 3300005841 Bacteria 13521
12 Ga0081455_10001073 3300005937 Bacteria 34404
13 Ga0081455_10006873 3300005937 Bacteria 12118
14 Ga0081455_10008504 3300005937 Bacteria 10664
15 Ga0081455_10046646 3300005937 Bacteria 3758
16 Ga0081539_10001020 3300005985 Bacteria 51615
17 Ga0075364_10026884 3300006051 Bacteria 3674
18 Ga0075432_10000200 3300006058 Bacteria 15700
19 Ga0075428_100000090 3300006844 Bacteria 74510
20 Ga0075428_100002187 3300006844 Bacteria 21146
21 Ga0075428_100032838 3300006844 Bacteria 5731
22 Ga0075430_100116262 3300006846 Bacteria 2229
23 Ga0075431_100025212 3300006847 Bacteria 6095
24 Ga0075431_100300544 3300006847 Bacteria 1622
25 Ga0075433_10004368 3300006852 Bacteria 10988
26 Ga0075433_10015323 3300006852 Bacteria 6283
27 Ga0075434_100007407 3300006871 Bacteria 10162
28 Ga0075429_100073362 3300006880 Bacteria 2981
29 Ga0075436_100004280 3300006914 Bacteria 9806
30 Ga0075436_100051575 3300006914 Bacteria 2839
31 Ga0075435_100003511 3300007076 Bacteria 10644
32 Ga0075435_100030168 3300007076 Bacteria 4261
33 Ga0111539_10015633 3300009094 Bacteria 9436
34 Ga0111539_10032146 3300009094 Bacteria 6375
35 Ga0114129_10005166 3300009147 Bacteria 18371
36 Ga0114129_10044360 3300009147 Bacteria 6255
37 Ga0114129_10537367 3300009147 Bacteria 1522
38 Ga0105243_10017592 3300009148 Bacteria 5406
39 Ga0105242_10135791 3300009176 Unclassified 2128
40 Ga0163162_10162768 3300013306 Bacteria 2353
41 Ga0163163_10025562 3300014325 Bacteria 5630
42 Ga0163161_10138829 3300017792 Bacteria 1839
43 Ga0197907_11070600 3300020069 Bacteria 1429
44 Ga0213876_10009974 3300021384 Bacteria 5104
45 Ga0207664_10076904 3300025929 Bacteria 2703
46 Ga0207690_10063286 3300025932 Bacteria 2522
47 Ga0207706_10022085 3300025933 Bacteria 5711
48 Ga0207709_10019009 3300025935 Bacteria 3855
49 Ga0207667_10270330 3300025949 Bacteria 1738
50 Ga0207668_10000597 3300025972 Bacteria 22455
51 Ga0207668_10029353 3300025972 Bacteria 3604
52 Ga0207678_10001733 3300026067 Bacteria 19957
53 Ga0207702_10244301 3300026078 Bacteria 1683
54 Ga0207641_10016268 3300026088 Bacteria 6092
55 Ga0207676_10173078 3300026095 Bacteria 1883
56 Ga0207676_10203454 3300026095 Bacteria 1751
57 Ga0207675_100025396 3300026118 Bacteria 5514
58 Ga0207428_10000522 3300027907 Bacteria 45986
59 Ga0207428_10000747 3300027907 Bacteria 37176
60 Ga0268266_10016784 3300028379 Bacteria 6259
61 Ga0307515_10082548 3300028794 Bacteria 4154
62 Ga0307513_10015333 3300031456 Bacteria 9293
63 Ga0307509_10078840 3300031507 Bacteria 3411
64 Ga0307408_100001746 3300031548 Bacteria 15861
65 Ga0307405_10007434 3300031731 Bacteria 5480
66 Ga0307518_10014471 3300031838 Bacteria 5640
67 Ga0307410_10000105 3300031852 Bacteria 29319
68 Ga0307406_10000266 3300031901 Bacteria 31369
69 Ga0307406_10117322 3300031901 Bacteria 1844
70 Ga0307407_10042839 3300031903 Bacteria 2541
71 Ga0307407_10095250 3300031903 Bacteria 1835
72 Ga0307409_100000004 3300031995 Bacteria 84332
73 Ga0307416_100000085 3300032002 Bacteria 64569
74 Ga0307415_100000482 3300032126 Bacteria 17247
75 Ga0307415_100336293 3300032126 Bacteria 1265
76 Ga0373934_0009189 3300035086 Bacteria 3701
77 Ga0373956_0029380 3300035119 Bacteria 2397
78 Ga0373924_0032579 3300035410 Bacteria 2100
79 Ga0395900_0037368 3300037418 Bacteria 5007
80 Ga0395898_0009880 3300037466 Bacteria 10004
81 Ga0395905_0034741 3300037471 Bacteria 4734
82 Ga0436365_0723412 3300039437 Bacteria 3900
83 Ga0436365_1426582 3300039437 Bacteria 2552
84 Ga0451837_0562212 3300041494 Bacteria 3334
85 Ga0439448_0015460 3300042005 Bacteria 2312
86 Ga0439463_003015 3300042016 Bacteria 4274
87 Ga0439464_0014756 3300042439 Bacteria 2104
88 Ga0466969_0103126 3300044656 Bacteria 1341
89 Ga0466972_0057201 3300044658 Bacteria 1873
90 Ga0466965_0138725 3300044683 Bacteria 1265
91 Ga0466961_0005095 3300044693 Bacteria 8270
92 Ga0466963_0000317 3300044694 Bacteria 21773
93 Ga0466963_0050947 3300044694 Bacteria 2742
94 Ga0466963_0165316 3300044694 Bacteria 1541
95 Ga0466963_0180887 3300044694 Bacteria 1472
96 Ga0466964_0057675 3300044706 Bacteria 1608
97 Ga0466970_0015428 3300044765 Bacteria 3928
98 Ga0466957_0105489 3300044842 Bacteria 1781
99 Ga0466958_0003111 3300045836 Bacteria 8525
100 Ga0466967_0002714 3300045976 Bacteria 11186
101 Ga0466967_0004617 3300045976 Bacteria 9334
102 Ga0466967_0062876 3300045976 Bacteria 3296
103 Ga0495651_0014532 3300046462 Bacteria 6086
104 Ga0495639_0037153 3300046475 Bacteria 2183
105 Ga0495594_0003959 3300046499 Bacteria 7625
106 Ga0495608_0063118 3300046511 Bacteria 2432
107 Ga0495628_0218025 3300046516 Bacteria 1434
108 Ga0495652_0043648 3300046529 Bacteria 3861
109 Ga0495587_0074741 3300046536 Bacteria 1968
110 Ga0495668_0000563 3300046616 Bacteria 45601
111 Ga0495625_0000763 3300046660 Bacteria 44832
112 Ga0495657_0078391 3300046675 Bacteria 2141
113 Ga0495623_0042049 3300046679 Bacteria 2912
114 Ga0495672_0074059 3300047320 Bacteria 1919
115 Ga0495675_0150287 3300047444 Bacteria 1439
116 Ga0495626_0000029 3300048091 Bacteria 202868
117 Ga0496104_0158357 3300048907 Bacteria 2173
118 Ga0496104_0190467 3300048907 Bacteria 1962
119 Ga0496105_0203246 3300048908 Bacteria 1617
120 Ga0496108_0041248 3300048911 Bacteria 3852
121 Ga0496109_0012913 3300048912 Bacteria 7222
122 Ga0496110_0091838 3300048913 Bacteria 2716
123 Ga0496112_0081234 3300048915 Bacteria 3205
124 Ga0496112_0081922 3300048915 Bacteria 3191
125 nmdc:mga00v17_41831_c1 3300050491 Bacteria 2753
126 nmdc:mga09592_191763_c1 3300050508 Bacteria 1769
127 nmdc:mga0qj67_84170_c1 3300050509 Bacteria 2550
128 nmdc:mga06r32_13437_c1 3300050510 Bacteria 7415
129 nmdc:mga06r32_20888_c1 3300050510 Bacteria 6035
130 nmdc:mga08y16_22679_c1 3300050511 Bacteria 6629
131 nmdc:mga08y16_3625_c1 3300050511 Bacteria 16038
132 nmdc:mga0n895_2894_c1 3300050512 Bacteria 13623
133 nmdc:mga0n895_3493_c1 3300050512 Bacteria 12692
134 nmdc:mga0rr50_1041_c1 3300050513 Bacteria 15041
135 nmdc:mga08x19_54065_c1 3300050514 Bacteria 2584
136 nmdc:mga0a205_3561_c1 3300050515 Bacteria 13940
137 nmdc:mga0a205_3817_c1 3300050515 Bacteria 13505

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050512 nmdc:mga0n895_3493_c1 nmdc:mga0n895_3493_c1_5104_6189 315
2 3300006058 Ga0075432_10000200 Ga0075432_100002008 326
3 3300006852 Ga0075433_10004368 Ga0075433_100043685 326
4 3300006871 Ga0075434_100007407 Ga0075434_1000074073 326
5 3300006914 Ga0075436_100004280 Ga0075436_1000042804 326
6 3300007076 Ga0075435_100030168 Ga0075435_1000301684 326
7 3300009094 Ga0111539_10015633 Ga0111539_100156336 326
8 3300027907 Ga0207428_10000522 Ga0207428_1000052233 326
9 3300050511 nmdc:mga08y16_3625_c1 nmdc:mga08y16_3625_c1_8383_9468 326
10 3300050515 nmdc:mga0a205_3561_c1 nmdc:mga0a205_3561_c1_6425_7510 326
11 3300044658 Ga0466972_0057201 Ga0466972_0057201_112_1194 330
12 3300005435 Ga0070714_100078412 Ga0070714_1000784124 331
13 3300025929 Ga0207664_10076904 Ga0207664_100769044 331
14 iso_pu_bacteria 2751185734 2753071549 331
15 iso_pu_bacteria 2870721527 2870729489 331
16 3300046475 Ga0495639_0037153 Ga0495639_0037153_1066_2124 332
17 3300005467 Ga0070706_100042958 Ga0070706_1000429585 335
18 3300009147 Ga0114129_10044360 Ga0114129_100443602 335
19 3300021384 Ga0213876_10009974 Ga0213876_100099745 335
20 3300039437 Ga0436365_0723412 Ga0436365_0723412_368_1447 335
21 3300039437 Ga0436365_1426582 Ga0436365_1426582_752_1834 335
22 3300006051 Ga0075364_10026884 Ga0075364_100268844 336
23 3300047320 Ga0495672_0074059 Ga0495672_0074059_126_1220 336
24 3300050491 nmdc:mga00v17_41831_c1 nmdc:mga00v17_41831_c1_772_1860 336
25 3300005548 Ga0070665_100080158 Ga0070665_1000801583 337
26 3300005618 Ga0068864_100152107 Ga0068864_1001521073 337
27 3300005841 Ga0068863_100004657 Ga0068863_1000046573 337
28 3300006846 Ga0075430_100116262 Ga0075430_1001162622 337
29 3300006880 Ga0075429_100073362 Ga0075429_1000733623 337
30 3300009147 Ga0114129_10537367 Ga0114129_105373673 337
31 3300026088 Ga0207641_10016268 Ga0207641_100162681 337
32 3300026095 Ga0207676_10203454 Ga0207676_102034542 337
33 3300031901 Ga0307406_10117322 Ga0307406_101173223 337
34 3300032126 Ga0307415_100336293 Ga0307415_1003362931 337
35 3300041494 Ga0451837_0562212 Ga0451837_0562212_1923_3023 337
36 3300050509 nmdc:mga0qj67_84170_c1 nmdc:mga0qj67_84170_c1_796_1869 337
37 3300050510 nmdc:mga06r32_13437_c1 nmdc:mga06r32_13437_c1_424_1497 337
38 iso_pu_bacteria 2675903059 2676486488 337
39 iso_pu_bacteria 2858868258 2858874899 337
40 iso_pu_bacteria 2902582711 2902586647 337
41 3300005356 Ga0070674_100038922 Ga0070674_1000389222 338
42 3300020069 Ga0197907_11070600 Ga0197907_110706002 338
43 3300037418 Ga0395900_0037368 Ga0395900_0037368_3264_4517 338
44 3300037466 Ga0395898_0009880 Ga0395898_0009880_6129_7382 338
45 3300044656 Ga0466969_0103126 Ga0466969_0103126_86_1168 338
46 3300044693 Ga0466961_0005095 Ga0466961_0005095_2991_4073 338
47 iso_pu_bacteria 2643221631 2644174549 338
48 iso_pu_bacteria 2731639228 2731906355 338
49 iso_pu_bacteria 2772190715 2772643665 338
50 iso_pu_bacteria 2795385472 2795792002 338
51 iso_pu_bacteria 2855670206 2855675165 338
52 iso_pu_bacteria 2855676851 2855681946 338
53 iso_pu_bacteria 2857288857 2857289176 338
54 iso_pu_bacteria 2858848962 2858849999 338
55 iso_pu_bacteria 2858882152 2858883490 338
56 iso_pu_bacteria 2858888857 2858891984 338
57 iso_pu_bacteria 2858895516 2858899334 338
58 iso_pu_bacteria 2869048445 2869051893 338
59 iso_pu_bacteria 2869061728 2869067940 338
60 iso_pu_bacteria 2869068681 2869073449 338
61 iso_pu_bacteria 2880489317 2880492025 338
62 iso_pu_bacteria 2880495981 2880500268 338
63 iso_pu_bacteria 2887478801 2887482930 338
64 iso_pu_bacteria 2929219909 2929222163 338
65 iso_pu_bacteria 2929226422 2929228830 338
66 iso_pu_bacteria 8003830390 8003835709 338
67 iso_pu_bacteria 8003870546 8003874143 338
68 iso_pu_bacteria 8054704163 8054706818 338
69 iso_pu_bacteria 8054727385 8054730844 338
70 iso_pu_bacteria 8054734606 8054738889 338
71 iso_pu_bacteria 8055172936 8055179140 338
72 iso_pu_bacteria 8055412473 8055412807 338
73 3300031507 Ga0307509_10078840 Ga0307509_100788402 339
74 3300031838 Ga0307518_10014471 Ga0307518_100144716 339
75 3300044683 Ga0466965_0138725 Ga0466965_0138725_155_1234 339
76 3300044694 Ga0466963_0000317 Ga0466963_0000317_10942_12024 339
77 3300044706 Ga0466964_0057675 Ga0466964_0057675_302_1384 339
78 3300044765 Ga0466970_0015428 Ga0466970_0015428_1789_2868 339
79 3300044842 Ga0466957_0105489 Ga0466957_0105489_108_1190 339
80 3300045836 Ga0466958_0003111 Ga0466958_0003111_4309_5391 339
81 3300045976 Ga0466967_0004617 Ga0466967_0004617_6312_7394 339
82 3300048907 Ga0496104_0190467 Ga0496104_0190467_61_1146 339
83 3300048908 Ga0496105_0203246 Ga0496105_0203246_387_1472 339
84 3300048915 Ga0496112_0081922 Ga0496112_0081922_309_1394 339
85 iso_pu_bacteria 2816332119 2816427418 339
86 3300005347 Ga0070668_100004651 Ga0070668_1000046515 340
87 3300005455 Ga0070663_100004449 Ga0070663_1000044498 340
88 3300005618 Ga0068864_100137275 Ga0068864_1001372753 340
89 3300006847 Ga0075431_100300544 Ga0075431_1003005442 340
90 3300009148 Ga0105243_10017592 Ga0105243_100175923 340
91 3300025972 Ga0207668_10029353 Ga0207668_100293531 340
92 3300026067 Ga0207678_10001733 Ga0207678_100017337 340
93 3300026078 Ga0207702_10244301 Ga0207702_102443012 340
94 3300026095 Ga0207676_10173078 Ga0207676_101730781 340
95 3300028794 Ga0307515_10082548 Ga0307515_100825483 340
96 3300031456 Ga0307513_10015333 Ga0307513_1001533311 340
97 3300044694 Ga0466963_0050947 Ga0466963_0050947_179_1261 340
98 3300044694 Ga0466963_0165316 Ga0466963_0165316_403_1491 340
99 3300044694 Ga0466963_0180887 Ga0466963_0180887_304_1395 340
100 3300045976 Ga0466967_0002714 Ga0466967_0002714_3583_4668 340
101 3300045976 Ga0466967_0062876 Ga0466967_0062876_31_1116 340
102 3300048907 Ga0496104_0158357 Ga0496104_0158357_418_1503 340
103 3300048911 Ga0496108_0041248 Ga0496108_0041248_1601_2686 340
104 3300048912 Ga0496109_0012913 Ga0496109_0012913_223_1308 340
105 3300048913 Ga0496110_0091838 Ga0496110_0091838_631_1716 340
106 iso_pu_bacteria 2508501039 2508678257 340
107 iso_pu_bacteria 2675902999 2676201651 340
108 iso_pu_bacteria 2687453737 2689959368 340
109 iso_pu_bacteria 2773857921 2774846227 340
110 iso_pu_bacteria 8002775197 8002782463 340
111 3300005539 Ga0068853_100144245 Ga0068853_1001442452 341
112 3300005937 Ga0081455_10001073 Ga0081455_100010739 341
113 3300005937 Ga0081455_10006873 Ga0081455_100068733 341
114 3300005937 Ga0081455_10008504 Ga0081455_100085047 341
115 3300005937 Ga0081455_10046646 Ga0081455_100466466 341
116 3300006844 Ga0075428_100002187 Ga0075428_10000218712 341
117 3300006844 Ga0075428_100032838 Ga0075428_1000328384 341
118 3300006847 Ga0075431_100025212 Ga0075431_1000252125 341
119 3300006852 Ga0075433_10015323 Ga0075433_100153234 341
120 3300006914 Ga0075436_100051575 Ga0075436_1000515753 341
121 3300007076 Ga0075435_100003511 Ga0075435_1000035113 341
122 3300009094 Ga0111539_10032146 Ga0111539_100321464 341
123 3300009147 Ga0114129_10005166 Ga0114129_100051669 341
124 3300009176 Ga0105242_10135791 Ga0105242_101357912 341
125 3300013306 Ga0163162_10162768 Ga0163162_101627682 341
126 3300017792 Ga0163161_10138829 Ga0163161_101388292 341
127 3300025932 Ga0207690_10063286 Ga0207690_100632862 341
128 3300025933 Ga0207706_10022085 Ga0207706_100220855 341
129 3300025949 Ga0207667_10270330 Ga0207667_102703301 341
130 3300026118 Ga0207675_100025396 Ga0207675_1000253962 341
131 3300027907 Ga0207428_10000747 Ga0207428_100007478 341
132 3300031548 Ga0307408_100001746 Ga0307408_1000017466 341
133 3300031852 Ga0307410_10000105 Ga0307410_1000010526 341
134 3300031901 Ga0307406_10000266 Ga0307406_1000026632 341
135 3300031903 Ga0307407_10042839 Ga0307407_100428392 341
136 3300031903 Ga0307407_10095250 Ga0307407_100952503 341
137 3300031995 Ga0307409_100000004 Ga0307409_10000000414 341
138 3300032002 Ga0307416_100000085 Ga0307416_10000008531 341
139 3300032126 Ga0307415_100000482 Ga0307415_1000004829 341
140 3300035086 Ga0373934_0009189 Ga0373934_0009189_1425_2522 341
141 3300035119 Ga0373956_0029380 Ga0373956_0029380_788_1942 341
142 3300035410 Ga0373924_0032579 Ga0373924_0032579_990_2087 341
143 3300037471 Ga0395905_0034741 Ga0395905_0034741_814_2067 341
144 3300042005 Ga0439448_0015460 Ga0439448_0015460_1050_2135 341
145 3300042016 Ga0439463_003015 Ga0439463_003015_1106_2191 341
146 3300042439 Ga0439464_0014756 Ga0439464_0014756_908_1993 341
147 3300046462 Ga0495651_0014532 Ga0495651_0014532_4137_5234 341
148 3300046499 Ga0495594_0003959 Ga0495594_0003959_3472_4557 341
149 3300046511 Ga0495608_0063118 Ga0495608_0063118_163_1260 341
150 3300046516 Ga0495628_0218025 Ga0495628_0218025_265_1362 341
151 3300046529 Ga0495652_0043648 Ga0495652_0043648_1445_2599 341
152 3300046536 Ga0495587_0074741 Ga0495587_0074741_756_1910 341
153 3300046675 Ga0495657_0078391 Ga0495657_0078391_882_1979 341
154 3300046679 Ga0495623_0042049 Ga0495623_0042049_476_1573 341
155 3300047444 Ga0495675_0150287 Ga0495675_0150287_180_1277 341
156 3300050508 nmdc:mga09592_191763_c1 nmdc:mga09592_191763_c1_569_1654 341
157 3300050510 nmdc:mga06r32_20888_c1 nmdc:mga06r32_20888_c1_3618_4706 341
158 3300050511 nmdc:mga08y16_22679_c1 nmdc:mga08y16_22679_c1_2708_3793 341
159 3300050512 nmdc:mga0n895_2894_c1 nmdc:mga0n895_2894_c1_1972_3057 341
160 3300050513 nmdc:mga0rr50_1041_c1 nmdc:mga0rr50_1041_c1_9690_10775 341
161 3300050514 nmdc:mga08x19_54065_c1 nmdc:mga08x19_54065_c1_911_1996 341
162 3300050515 nmdc:mga0a205_3817_c1 nmdc:mga0a205_3817_c1_116_1201 341
163 3300005347 Ga0070668_100000160 Ga0070668_10000016014 342
164 3300005985 Ga0081539_10001020 Ga0081539_1000102013 342
165 3300006844 Ga0075428_100000090 Ga0075428_10000009040 342
166 3300014325 Ga0163163_10025562 Ga0163163_100255625 342
167 3300025935 Ga0207709_10019009 Ga0207709_100190093 342
168 3300025972 Ga0207668_10000597 Ga0207668_100005972 342
169 3300028379 Ga0268266_10016784 Ga0268266_100167843 342
170 3300031731 Ga0307405_10007434 Ga0307405_100074344 342
171 3300046616 Ga0495668_0000563 Ga0495668_0000563_9055_10140 342
172 3300046660 Ga0495625_0000763 Ga0495625_0000763_26262_27347 342
173 3300048091 Ga0495626_0000029 Ga0495626_0000029_3721_4806 342
174 3300048915 Ga0496112_0081234 Ga0496112_0081234_165_1250 342

Structural Annotation

Top 5 Hits

ID Description Score Start End
3b7f-assembly1.cif.gz_A crystal structure of a putative glycosyl hydrolase with bnr repeats (reut_b4987) from ralstonia eutropha jmp134 at 2.20 a resolution 0.9093 2 339
3b7f-assembly1.cif.gz_A crystal structure of a putative glycosyl hydrolase with bnr repeats (reut_b4987) from ralstonia eutropha jmp134 at 2.20 a resolution 0.8964 2 339
6hxi-assembly1.cif.gz_C-2 structure of atp citrate lyase from methanothrix soehngenii in complex with citrate and coenzyme a 0.7312 2 28
5ojr-assembly3.cif.gz_C ycf48 bound to d1 peptide 0.7197 7 311
8i7r-assembly1.cif.gz_P3 in situ structure of axonemal doublet microtubules in mouse sperm with 48-nm repeat 0.7153 5 339
ID Description Score Start End Superfamily
3b7fA00 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8889 3 339 2.130.10.10
3b7fA00 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8714 3 339 2.130.10.10
af_O94365_34_213_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7542 28 238 2.130.10.10
af_P33215_130_332_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7476 4 180 2.130.10.10
af_Q8TED0_27_157_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7264 20 178 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A4R4R210-F1-model_v4 Exo-alpha-sialidase 0.9847 1 276 GO:0000272
GO:0010411
GO:0016798
AF-A0A810L8I7-F1-model_v4 Glycosyl hydrolase 0.9826 1 315 GO:0000272
GO:0010411
GO:0016798
AF-N1UYK0-F1-model_v4 Glycosyl hydrolase 0.9821 61 342 GO:0000272
GO:0010411
GO:0016798
AF-A0A3D1AQV5-F1-model_v4 Glycosyl hydrolase 0.9797 225 330
AF-C4RHV0-F1-model_v4 Glycosyl hydrolase 0.9781 1 240 GO:0000272
GO:0010411
GO:0016798

Feature Viewer

pLDDT pTM Quality
93.96 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map