F264293

General Info

Members Datasets Scaffolds Average Seq Length
174 107 174 186

Family's Representative Sequence

Representative Sequence 3300006028|Ga0070717_10371326|Ga0070717_103713262
Length 209
Sequence MKITSRKRVVHLVAPKQLQNPLTPMKRFTFFAAISLAFSAISLLPSSGRAASAAELDQSAKAALRSLYASNPAAQAVGKKAKAILVFPSIVKGGFLVGAQHGDGALLVNGKTVGYYNTVAASYGFQAGVQKFSYAMFFMNDASLNYLRKSGGWEVGSAPSLVVVDTGMARSLSTTTLKKGIYVFFFDQKGLMGGLGLQGTKITQYTPSA

Samples

Sample ID Description Type Environment
1 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
2 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
3 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
4 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
5 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
6 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
7 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
8 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
9 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
10 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
11 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
12 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
13 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
14 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
15 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
16 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
17 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
18 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
19 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
20 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
21 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
22 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
23 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
24 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
25 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
26 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
29 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
30 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
31 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
32 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
33 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
36 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
40 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
41 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
45 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
46 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
58 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
61 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
62 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
63 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
64 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
65 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
66 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
67 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
68 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
69 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
70 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
71 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
72 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
73 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
74 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
75 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
76 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
77 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
78 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
79 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
80 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
81 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
82 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
83 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
84 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
85 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
86 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
87 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
88 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
89 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
90 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
91 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
92 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
93 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
95 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
96 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
97 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
98 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
99 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
100 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
101 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
102 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
103 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
104 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
105 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
106 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
107 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.43
Metatranscriptomes 0.57
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.57
Rhizosphere 98.28
Stem 0
Stem Tuber 0
Unclassified 1.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070670_100630862 3300005331 Bacteria 960
2 Ga0070667_100037082 3300005367 Bacteria 4087
3 Ga0070708_100020366 3300005445 Bacteria 5593
4 Ga0070708_100027787 3300005445 Bacteria 4859
5 Ga0070663_100100676 3300005455 Unclassified 2156
6 Ga0070706_100002824 3300005467 Bacteria 17365
7 Ga0070706_100450361 3300005467 Unclassified 1198
8 Ga0070706_100659920 3300005467 Unclassified 971
9 Ga0070706_101179979 3300005467 Bacteria 704
10 Ga0070707_100039871 3300005468 Bacteria 4491
11 Ga0070707_100069206 3300005468 Bacteria 3398
12 Ga0070707_100184779 3300005468 Unclassified 2032
13 Ga0070698_100007035 3300005471 Bacteria 12187
14 Ga0070698_100148002 3300005471 Unclassified 2297
15 Ga0070698_100578441 3300005471 Unclassified 1063
16 Ga0070699_100008277 3300005518 Bacteria 9016
17 Ga0070699_100547763 3300005518 Unclassified 1053
18 Ga0070697_100136947 3300005536 Bacteria 2057
19 Ga0070697_100700118 3300005536 Unclassified 894
20 Ga0070696_100319759 3300005546 Unclassified 1194
21 Ga0070696_100835938 3300005546 Bacteria 760
22 Ga0070665_100205467 3300005548 Bacteria 1970
23 Ga0070704_100400793 3300005549 Unclassified 1171
24 Ga0068856_101894126 3300005614 Unclassified 607
25 Ga0068859_100265016 3300005617 Bacteria 1810
26 Ga0068859_100806477 3300005617 Bacteria 1026
27 Ga0068864_100377741 3300005618 Bacteria 1342
28 Ga0068861_100836939 3300005719 Unclassified 866
29 Ga0068861_100865896 3300005719 Unclassified 853
30 Ga0068870_10231981 3300005840 Bacteria 1135
31 Ga0068863_100097319 3300005841 Bacteria 2795
32 Ga0068863_100111921 3300005841 Bacteria 2600
33 Ga0068863_101297032 3300005841 Bacteria 735
34 Ga0068858_100096410 3300005842 Bacteria 2756
35 Ga0068858_100102089 3300005842 Bacteria 2675
36 Ga0068860_100488370 3300005843 Bacteria 1228
37 Ga0068860_100912025 3300005843 Bacteria 895
38 Ga0068862_101393413 3300005844 Bacteria 704
39 Ga0081540_1028880 3300005983 Bacteria 3102
40 Ga0070717_10371326 3300006028 Unclassified 1282
41 Ga0070715_10185513 3300006163 Unclassified 1046
42 Ga0070716_100749142 3300006173 Bacteria 751
43 Ga0068871_100955512 3300006358 Unclassified 796
44 Ga0075428_100850748 3300006844 Bacteria 968
45 Ga0075428_101060918 3300006844 Unclassified 857
46 Ga0075430_100176690 3300006846 Bacteria 1776
47 Ga0075430_100462181 3300006846 Bacteria 1047
48 Ga0075431_100935516 3300006847 Bacteria 835
49 Ga0075433_10147603 3300006852 Bacteria 2091
50 Ga0075433_10214275 3300006852 Unclassified 1711
51 Ga0075433_10334691 3300006852 Bacteria 1338
52 Ga0075433_10939187 3300006852 Bacteria 754
53 Ga0075433_11239556 3300006852 Bacteria 647
54 Ga0075434_100010670 3300006871 Bacteria 8625
55 Ga0075434_100029800 3300006871 Bacteria 5371
56 Ga0075434_100106605 3300006871 Unclassified 2812
57 Ga0075434_100324557 3300006871 Unclassified 1560
58 Ga0075434_100389381 3300006871 Unclassified 1415
59 Ga0075429_100330708 3300006880 Bacteria 1333
60 Ga0075436_100121763 3300006914 Bacteria 1826
61 Ga0075436_100122062 3300006914 Bacteria 1823
62 Ga0097620_100265049 3300006931 Bacteria 1810
63 Ga0097620_100806323 3300006931 Bacteria 1026
64 Ga0075435_100020567 3300007076 Bacteria 5060
65 Ga0075435_100061664 3300007076 Bacteria 3042
66 Ga0099794_10002827 3300007265 Bacteria 6501
67 Ga0111539_10000813 3300009094 Bacteria 40534
68 Ga0111539_10016721 3300009094 Bacteria 9091
69 Ga0111539_10515473 3300009094 Unclassified 1393
70 Ga0111539_10601444 3300009094 Bacteria 1281
71 Ga0114129_10468239 3300009147 Bacteria 1651
72 Ga0114129_11857144 3300009147 Unclassified 731
73 Ga0105249_10111357 3300009553 Unclassified 2588
74 Ga0105249_10271957 3300009553 Unclassified 1688
75 Ga0157374_10659856 3300013296 Bacteria 1058
76 Ga0163162_10906881 3300013306 Bacteria 994
77 Ga0157375_10713530 3300013308 Unclassified 1156
78 Ga0157375_11192885 3300013308 Bacteria 893
79 Ga0163163_10407067 3300014325 Bacteria 1419
80 Ga0157379_10007254 3300014968 Bacteria 9591
81 Ga0157379_10500981 3300014968 Unclassified 1126
82 Ga0213876_10150374 3300021384 Bacteria 1238
83 Ga0207647_10001581 3300025904 Bacteria 17475
84 Ga0207684_10002219 3300025910 Bacteria 19814
85 Ga0207684_10423205 3300025910 Bacteria 1144
86 Ga0207684_10440615 3300025910 Bacteria 1119
87 Ga0207684_10669465 3300025910 Unclassified 883
88 Ga0207684_10960604 3300025910 Unclassified 716
89 Ga0207646_10032730 3300025922 Unclassified 4704
90 Ga0207646_10033472 3300025922 Bacteria 4649
91 Ga0207646_10479830 3300025922 Bacteria 1121
92 Ga0207706_10513310 3300025933 Unclassified 1034
93 Ga0207665_10129546 3300025939 Bacteria 1789
94 Ga0207711_10434040 3300025941 Bacteria 1222
95 Ga0207712_10103637 3300025961 Bacteria 2120
96 Ga0207712_10292088 3300025961 Unclassified 1334
97 Ga0207658_10132473 3300025986 Bacteria 2005
98 Ga0207703_10112233 3300026035 Bacteria 2328
99 Ga0207678_10124223 3300026067 Bacteria 2202
100 Ga0207641_10095532 3300026088 Bacteria 2609
101 Ga0207641_11271418 3300026088 Bacteria 736
102 Ga0207428_10000018 3300027907 Bacteria 293117
103 Ga0207428_10030276 3300027907 Bacteria 4476
104 Ga0268266_10234326 3300028379 Bacteria 1692
105 Ga0268265_11413408 3300028380 Bacteria 698
106 Ga0265330_10049892 3300031235 Bacteria 1836
107 Ga0265332_10000858 3300031238 Bacteria 18411
108 Ga0265328_10003605 3300031239 Bacteria 6830
109 Ga0265331_10000254 3300031250 Bacteria 63081
110 Ga0265327_10000255 3300031251 Bacteria 105762
111 Ga0265316_10000275 3300031344 Bacteria 57985
112 Ga0265316_10490706 3300031344 Bacteria 878
113 Ga0265314_10003257 3300031711 Bacteria 15878
114 Ga0265342_10018642 3300031712 Bacteria 4487
115 Ga0307412_11330873 3300031911 Bacteria 648
116 Ga0307416_100465337 3300032002 Unclassified 1321
117 Ga0316587_1005703 3300033529 Unclassified 1878
118 Ga0373948_0039195 3300034817 Unclassified 985
119 Ga0373950_0011600 3300034818 Bacteria 1442
120 Ga0373940_0002011 3300035088 Bacteria 3853
121 Ga0373949_0008118 3300035090 Bacteria 2301
122 Ga0373932_0034056 3300035112 Bacteria 1433
123 Ga0373939_0085592 3300035114 Bacteria 1056
124 Ga0373961_0109638 3300035241 Bacteria 903
125 Ga0373931_0044977 3300035691 Bacteria 2330
126 Ga0373931_0105267 3300035691 Bacteria 1593
127 Ga0373935_0032341 3300035692 Bacteria 3251
128 Ga0373947_0016357 3300035725 Bacteria 4263
129 Ga0373937_0078697 3300036401 Unclassified 3047
130 Ga0373937_1446097 3300036401 Bacteria 635
131 Ga0373925_0009057 3300037068 Bacteria 7244
132 Ga0395901_1274945 3300038443 Bacteria 698
133 Ga0436365_0851945 3300039437 Bacteria 2131
134 Ga0436360_0339714 3300039438 Bacteria 5428
135 Ga0439435_0008890 3300042436 Bacteria 2342
136 Ga0451576_0288886 3300045051 Bacteria 1714
137 Ga0451576_0913859 3300045051 Unclassified 921
138 Ga0495580_0002217 3300046472 Bacteria 17012
139 Ga0495642_0382274 3300046528 Unclassified 620
140 Ga0495640_0618902 3300046533 Unclassified 653
141 Ga0495636_0061087 3300047318 Unclassified 1593
142 Ga0496107_0154118 3300048910 Bacteria 1701
143 Ga0501036_0116683 3300049572 Unclassified 2255
144 Ga0501038_0204300 3300049574 Unclassified 1584
145 Ga0501072_0091643 3300049588 Unclassified 2413
146 Ga0501074_0316927 3300049590 Unclassified 1108
147 Ga0501076_0012299 3300049592 Bacteria 6400
148 nmdc:mga05p37_1149754_c1 3300050507 Bacteria 807
149 nmdc:mga05p37_798942_c1 3300050507 Bacteria 1033
150 nmdc:mga09592_262919_c1 3300050508 Bacteria 1497
151 nmdc:mga06r32_1222055_c1 3300050510 Bacteria 697
152 nmdc:mga06r32_472270_c1 3300050510 Bacteria 1233
153 nmdc:mga06r32_50286_c1 3300050510 Bacteria 3988
154 nmdc:mga08y16_1079345_c1 3300050511 Unclassified 779
155 nmdc:mga08y16_1251_c1 3300050511 Bacteria 25187
156 nmdc:mga08y16_52299_c1 3300050511 Bacteria 4274
157 nmdc:mga08y16_92257_c1 3300050511 Bacteria 3156
158 nmdc:mga0n895_379917_c1 3300050512 Unclassified 1430
159 nmdc:mga0n895_42148_c1 3300050512 Bacteria 4440
160 nmdc:mga0n895_551996_c1 3300050512 Bacteria 1158
161 nmdc:mga0rr50_12193_c1 3300050513 Bacteria 5542
162 nmdc:mga0rr50_152269_c1 3300050513 Unclassified 1870
163 nmdc:mga0rr50_29098_c1 3300050513 Bacteria 3892
164 nmdc:mga0rr50_380665_c1 3300050513 Bacteria 1190
165 nmdc:mga0rr50_692133_c1 3300050513 Bacteria 870
166 nmdc:mga08x19_124520_c1 3300050514 Bacteria 1730
167 nmdc:mga08x19_24088_c1 3300050514 Bacteria 3779
168 nmdc:mga08x19_276825_c1 3300050514 Unclassified 1162
169 nmdc:mga0a205_290324_c1 3300050515 Unclassified 1510
170 nmdc:mga0a205_296956_c1 3300050515 Bacteria 1489
171 nmdc:mga0a205_368810_c1 3300050515 Bacteria 1302
172 nmdc:mga0a205_396453_c1 3300050515 Bacteria 1244
173 Ga0501082_1545169 3300060353 Unclassified 579
174 Ga0530510_0276920 3300061734 Bacteria 1253

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039437 Ga0436365_0851945 Ga0436365_0851945_217_726 168
2 3300036401 Ga0373937_1446097 Ga0373937_1446097_43_606 171
3 3300034818 Ga0373950_0011600 Ga0373950_0011600_893_1420 174
4 3300050513 nmdc:mga0rr50_380665_c1 nmdc:mga0rr50_380665_c1_178_702 174
5 3300050514 nmdc:mga08x19_276825_c1 nmdc:mga08x19_276825_c1_228_758 175
6 3300046533 Ga0495640_0618902 Ga0495640_0618902_102_635 177
7 3300005549 Ga0070704_100400793 Ga0070704_1004007932 178
8 3300013308 Ga0157375_11192885 Ga0157375_111928851 178
9 3300006173 Ga0070716_100749142 Ga0070716_1007491421 179
10 3300009553 Ga0105249_10111357 Ga0105249_101113572 179
11 3300042436 Ga0439435_0008890 Ga0439435_0008890_1189_1731 179
12 3300005445 Ga0070708_100020366 Ga0070708_1000203662 180
13 3300005467 Ga0070706_101179979 Ga0070706_1011799792 180
14 3300049572 Ga0501036_0116683 Ga0501036_0116683_1017_1565 181
15 3300049574 Ga0501038_0204300 Ga0501038_0204300_96_644 181
16 3300049588 Ga0501072_0091643 Ga0501072_0091643_1058_1606 181
17 3300049590 Ga0501074_0316927 Ga0501074_0316927_86_634 181
18 3300049592 Ga0501076_0012299 Ga0501076_0012299_2842_3390 181
19 3300050510 nmdc:mga06r32_1222055_c1 nmdc:mga06r32_1222055_c1_101_646 181
20 3300060353 Ga0501082_1545169 Ga0501082_1545169_10_558 181
21 3300005467 Ga0070706_100002824 Ga0070706_10000282417 182
22 3300005467 Ga0070706_100659920 Ga0070706_1006599201 182
23 3300005468 Ga0070707_100039871 Ga0070707_1000398714 182
24 3300005468 Ga0070707_100069206 Ga0070707_1000692064 182
25 3300005471 Ga0070698_100007035 Ga0070698_1000070352 182
26 3300005518 Ga0070699_100008277 Ga0070699_1000082776 182
27 3300005536 Ga0070697_100700118 Ga0070697_1007001181 182
28 3300005614 Ga0068856_101894126 Ga0068856_1018941261 182
29 3300005841 Ga0068863_100097319 Ga0068863_1000973192 182
30 3300005842 Ga0068858_100096410 Ga0068858_1000964102 182
31 3300005843 Ga0068860_100912025 Ga0068860_1009120252 182
32 3300006852 Ga0075433_11239556 Ga0075433_112395561 182
33 3300009147 Ga0114129_11857144 Ga0114129_118571442 182
34 3300013308 Ga0157375_10713530 Ga0157375_107135302 182
35 3300021384 Ga0213876_10150374 Ga0213876_101503742 182
36 3300025910 Ga0207684_10002219 Ga0207684_100022192 182
37 3300025910 Ga0207684_10960604 Ga0207684_109606041 182
38 3300025922 Ga0207646_10033472 Ga0207646_100334722 182
39 3300025961 Ga0207712_10103637 Ga0207712_101036372 182
40 3300026035 Ga0207703_10112233 Ga0207703_101122333 182
41 3300031251 Ga0265327_10000255 Ga0265327_1000025560 182
42 3300050510 nmdc:mga06r32_472270_c1 nmdc:mga06r32_472270_c1_122_673 182
43 3300061734 Ga0530510_0276920 Ga0530510_0276920_61_615 182
44 3300006852 Ga0075433_10147603 Ga0075433_101476032 183
45 3300006871 Ga0075434_100389381 Ga0075434_1003893812 183
46 3300006914 Ga0075436_100122062 Ga0075436_1001220622 183
47 3300007076 Ga0075435_100020567 Ga0075435_1000205672 183
48 3300050512 nmdc:mga0n895_379917_c1 nmdc:mga0n895_379917_c1_319_873 183
49 3300050513 nmdc:mga0rr50_12193_c1 nmdc:mga0rr50_12193_c1_180_734 183
50 3300050514 nmdc:mga08x19_24088_c1 nmdc:mga08x19_24088_c1_2365_2919 183
51 3300050515 nmdc:mga0a205_296956_c1 nmdc:mga0a205_296956_c1_448_1002 183
52 3300005467 Ga0070706_100450361 Ga0070706_1004503612 184
53 3300005468 Ga0070707_100184779 Ga0070707_1001847792 184
54 3300005471 Ga0070698_100148002 Ga0070698_1001480022 184
55 3300005471 Ga0070698_100578441 Ga0070698_1005784412 184
56 3300005546 Ga0070696_100319759 Ga0070696_1003197591 184
57 3300005617 Ga0068859_100265016 Ga0068859_1002650163 184
58 3300005840 Ga0068870_10231981 Ga0068870_102319812 184
59 3300005844 Ga0068862_101393413 Ga0068862_1013934131 184
60 3300005983 Ga0081540_1028880 Ga0081540_10288803 184
61 3300006844 Ga0075428_100850748 Ga0075428_1008507482 184
62 3300006844 Ga0075428_101060918 Ga0075428_1010609182 184
63 3300006846 Ga0075430_100176690 Ga0075430_1001766903 184
64 3300006847 Ga0075431_100935516 Ga0075431_1009355162 184
65 3300006852 Ga0075433_10214275 Ga0075433_102142753 184
66 3300006852 Ga0075433_10939187 Ga0075433_109391871 184
67 3300006871 Ga0075434_100010670 Ga0075434_1000106706 184
68 3300006871 Ga0075434_100106605 Ga0075434_1001066052 184
69 3300006880 Ga0075429_100330708 Ga0075429_1003307082 184
70 3300006931 Ga0097620_100265049 Ga0097620_1002650493 184
71 3300007265 Ga0099794_10002827 Ga0099794_100028274 184
72 3300009094 Ga0111539_10000813 Ga0111539_100008132 184
73 3300009147 Ga0114129_10468239 Ga0114129_104682392 184
74 3300013296 Ga0157374_10659856 Ga0157374_106598561 184
75 3300013306 Ga0163162_10906881 Ga0163162_109068812 184
76 3300014968 Ga0157379_10007254 Ga0157379_100072548 184
77 3300025904 Ga0207647_10001581 Ga0207647_1000158114 184
78 3300025910 Ga0207684_10423205 Ga0207684_104232051 184
79 3300025910 Ga0207684_10440615 Ga0207684_104406152 184
80 3300025910 Ga0207684_10669465 Ga0207684_106694651 184
81 3300025922 Ga0207646_10479830 Ga0207646_104798302 184
82 3300025941 Ga0207711_10434040 Ga0207711_104340402 184
83 3300027907 Ga0207428_10000018 Ga0207428_10000018199 184
84 3300028380 Ga0268265_11413408 Ga0268265_114134081 184
85 3300031911 Ga0307412_11330873 Ga0307412_113308732 184
86 3300033529 Ga0316587_1005703 Ga0316587_10057032 184
87 3300035088 Ga0373940_0002011 Ga0373940_0002011_3042_3599 184
88 3300035090 Ga0373949_0008118 Ga0373949_0008118_1471_2028 184
89 3300035112 Ga0373932_0034056 Ga0373932_0034056_288_845 184
90 3300035114 Ga0373939_0085592 Ga0373939_0085592_48_605 184
91 3300035241 Ga0373961_0109638 Ga0373961_0109638_176_733 184
92 3300035691 Ga0373931_0105267 Ga0373931_0105267_353_910 184
93 3300035692 Ga0373935_0032341 Ga0373935_0032341_531_1088 184
94 3300035725 Ga0373947_0016357 Ga0373947_0016357_2936_3493 184
95 3300036401 Ga0373937_0078697 Ga0373937_0078697_1422_1982 184
96 3300037068 Ga0373925_0009057 Ga0373925_0009057_4570_5127 184
97 3300045051 Ga0451576_0288886 Ga0451576_0288886_746_1303 184
98 3300046472 Ga0495580_0002217 Ga0495580_0002217_2902_3459 184
99 3300047318 Ga0495636_0061087 Ga0495636_0061087_912_1469 184
100 3300050507 nmdc:mga05p37_798942_c1 nmdc:mga05p37_798942_c1_140_697 184
101 3300050508 nmdc:mga09592_262919_c1 nmdc:mga09592_262919_c1_866_1423 184
102 3300050510 nmdc:mga06r32_50286_c1 nmdc:mga06r32_50286_c1_337_894 184
103 3300050511 nmdc:mga08y16_1251_c1 nmdc:mga08y16_1251_c1_9458_10015 184
104 3300050512 nmdc:mga0n895_42148_c1 nmdc:mga0n895_42148_c1_1935_2489 184
105 3300050513 nmdc:mga0rr50_152269_c1 nmdc:mga0rr50_152269_c1_747_1301 184
106 3300050513 nmdc:mga0rr50_692133_c1 nmdc:mga0rr50_692133_c1_188_745 184
107 3300050515 nmdc:mga0a205_396453_c1 nmdc:mga0a205_396453_c1_618_1175 184
108 3300005367 Ga0070667_100037082 Ga0070667_1000370821 185
109 3300005455 Ga0070663_100100676 Ga0070663_1001006763 185
110 3300005518 Ga0070699_100547763 Ga0070699_1005477631 185
111 3300005536 Ga0070697_100136947 Ga0070697_1001369472 185
112 3300005546 Ga0070696_100835938 Ga0070696_1008359381 185
113 3300005548 Ga0070665_100205467 Ga0070665_1002054672 185
114 3300005617 Ga0068859_100806477 Ga0068859_1008064771 185
115 3300005618 Ga0068864_100377741 Ga0068864_1003777412 185
116 3300005719 Ga0068861_100836939 Ga0068861_1008369392 185
117 3300005841 Ga0068863_100111921 Ga0068863_1001119212 185
118 3300005841 Ga0068863_101297032 Ga0068863_1012970322 185
119 3300005842 Ga0068858_100102089 Ga0068858_1001020894 185
120 3300005843 Ga0068860_100488370 Ga0068860_1004883701 185
121 3300006163 Ga0070715_10185513 Ga0070715_101855132 185
122 3300006358 Ga0068871_100955512 Ga0068871_1009555121 185
123 3300006846 Ga0075430_100462181 Ga0075430_1004621811 185
124 3300006852 Ga0075433_10334691 Ga0075433_103346912 185
125 3300006871 Ga0075434_100029800 Ga0075434_1000298004 185
126 3300006871 Ga0075434_100324557 Ga0075434_1003245573 185
127 3300006914 Ga0075436_100121763 Ga0075436_1001217632 185
128 3300006931 Ga0097620_100806323 Ga0097620_1008063231 185
129 3300007076 Ga0075435_100061664 Ga0075435_1000616644 185
130 3300009094 Ga0111539_10016721 Ga0111539_100167217 185
131 3300009094 Ga0111539_10515473 Ga0111539_105154731 185
132 3300009553 Ga0105249_10271957 Ga0105249_102719573 185
133 3300014325 Ga0163163_10407067 Ga0163163_104070672 185
134 3300014968 Ga0157379_10500981 Ga0157379_105009812 185
135 3300025961 Ga0207712_10292088 Ga0207712_102920882 185
136 3300025986 Ga0207658_10132473 Ga0207658_101324734 185
137 3300026067 Ga0207678_10124223 Ga0207678_101242234 185
138 3300026088 Ga0207641_10095532 Ga0207641_100955322 185
139 3300026088 Ga0207641_11271418 Ga0207641_112714181 185
140 3300027907 Ga0207428_10030276 Ga0207428_100302766 185
141 3300028379 Ga0268266_10234326 Ga0268266_102343262 185
142 3300031235 Ga0265330_10049892 Ga0265330_100498922 185
143 3300031238 Ga0265332_10000858 Ga0265332_100008587 185
144 3300031239 Ga0265328_10003605 Ga0265328_100036055 185
145 3300031250 Ga0265331_10000254 Ga0265331_1000025445 185
146 3300031344 Ga0265316_10000275 Ga0265316_1000027512 185
147 3300031344 Ga0265316_10490706 Ga0265316_104907062 185
148 3300031711 Ga0265314_10003257 Ga0265314_100032575 185
149 3300031712 Ga0265342_10018642 Ga0265342_100186422 185
150 3300034817 Ga0373948_0039195 Ga0373948_0039195_183_743 185
151 3300035691 Ga0373931_0044977 Ga0373931_0044977_910_1470 185
152 3300045051 Ga0451576_0913859 Ga0451576_0913859_127_687 185
153 3300046528 Ga0495642_0382274 Ga0495642_0382274_36_596 185
154 3300048910 Ga0496107_0154118 Ga0496107_0154118_418_978 185
155 3300050511 nmdc:mga08y16_1079345_c1 nmdc:mga08y16_1079345_c1_204_764 185
156 3300050511 nmdc:mga08y16_92257_c1 nmdc:mga08y16_92257_c1_1296_1856 185
157 3300050513 nmdc:mga0rr50_29098_c1 nmdc:mga0rr50_29098_c1_1395_1955 185
158 3300050514 nmdc:mga08x19_124520_c1 nmdc:mga08x19_124520_c1_788_1348 185
159 3300050515 nmdc:mga0a205_368810_c1 nmdc:mga0a205_368810_c1_469_1029 185
160 3300005719 Ga0068861_100865896 Ga0068861_1008658962 186
161 3300009094 Ga0111539_10601444 Ga0111539_106014442 186
162 3300025933 Ga0207706_10513310 Ga0207706_105133102 186
163 3300032002 Ga0307416_100465337 Ga0307416_1004653372 186
164 3300050507 nmdc:mga05p37_1149754_c1 nmdc:mga05p37_1149754_c1_86_736 186
165 3300050511 nmdc:mga08y16_52299_c1 nmdc:mga08y16_52299_c1_2800_3450 186
166 3300050512 nmdc:mga0n895_551996_c1 nmdc:mga0n895_551996_c1_272_841 186
167 3300050515 nmdc:mga0a205_290324_c1 nmdc:mga0a205_290324_c1_710_1279 186
168 3300005331 Ga0070670_100630862 Ga0070670_1006308622 187
169 3300005445 Ga0070708_100027787 Ga0070708_1000277871 187
170 3300006028 Ga0070717_10371326 Ga0070717_103713262 187
171 3300025922 Ga0207646_10032730 Ga0207646_100327303 187
172 3300025939 Ga0207665_10129546 Ga0207665_101295462 187
173 3300038443 Ga0395901_1274945 Ga0395901_1274945_33_629 187
174 3300039438 Ga0436360_0339714 Ga0436360_0339714_3861_4439 187

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04366

Ysc84

Las17-binding protein actin regulator

119

208

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ofn-assembly1.cif.gz_A nmr solution structure of the sylf domain of burkholderia pseudomallei bpsl1445 0.7888 33 185
7ofn-assembly1.cif.gz_A nmr solution structure of the sylf domain of burkholderia pseudomallei bpsl1445 0.7398 33 185
4aye-assembly3.cif.gz_F structure of a complex between ccps 6 and 7 of human complement factor h and neisseria meningitidis fhbp variant 1 e283ae304a mutant 0.5451 79 121
6zkw-assembly1.cif.gz_A crystal structure of inha:01 tcr in complex with hla-e bound to inha (53-61) 0.5118 62 117
8gqw-assembly1.cif.gz_A the crystal structures of a swine sla-2*hb01 molecules complexed with a ctl epitope from asia1 serotype of foot-and-mouth disease virus 0.5085 62 122
ID Description Score Start End Superfamily
2qirA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.7952 80 100 3.40.630.30
af_Q5YDB6_731_798_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.5409 68 96 3.30.160.20
af_E7F9I1_15_193_3.30.500.10 Alpha Beta;2-Layer Sandwich;Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1;MHC class I-like antigen recognition-like 0.507 62 115 3.30.500.10
af_Q9STR6_51_204_2.120.10.80 Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller 0.4662 84 114 2.120.10.80
af_B5DER2_2_107_2.60.40.4240 Mainly Beta;Sandwich;Immunoglobulin-like;Transcription activator, Churchill 0.4457 63 112 2.60.40.4240
ID Description Score Start End GO Terms
AF-A0A0F2RJN5-F1-model_v4 Twin-arginine translocation pathway signal protein 0.9193 33 185
AF-A0A482J2M3-F1-model_v4 Twin-arginine translocation pathway signal protein 0.9117 35 186
AF-A0A2G6CCL9-F1-model_v4 Twin-arginine translocation pathway signal 0.9051 33 132
AF-A0A257PKR9-F1-model_v4 Twin-arginine translocation pathway signal protein 0.901 32 186
AF-A0A5E7DS89-F1-model_v4 Ysc84 actin-binding domain-containing protein 0.8963 86 185

Feature Viewer

pLDDT pTM Quality
71.19 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map