F264275

General Info

Members Datasets Scaffolds Average Seq Length
174 132 142 229

Family's Representative Sequence

Representative Sequence 3300005983|Ga0081540_1027378|Ga0081540_10273784
Length 225
Sequence MSKKVLIIVSNAYVIGPHNRRTGNFLPEVAHPYAEFDRAKYQIDFASLTGDTPFLDALNLADDPDNLAFLVGKGWASMQKAKKLSDVDVRQYDAIFVPGGLAPMVDMPEHPLIKKVVKETYERKGAVVGAVCHGPVSLLNVKLSDGALLLAGKNISAFTNDEEENYAKADVPFELETALTKQGAIFHKTAPWQAFSIADGNLVTGQNPASAKGVAEKMIKLLEAA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2585428061 Chryseobacterium sp. CF356 Isolate Rhizosphere
3 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
4 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
5 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
6 2617270889 Nostoc punctiforme PCC 73102 Isolate Unclassified
7 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
8 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
9 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
10 2738541278 Niastella sp. CF465 Isolate Unclassified
11 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
12 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
13 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
14 2775506739 Chryseobacterium sp. 1335 Isolate Unclassified
15 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
16 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
17 2818991444 Filimonas endophytica 3197 Isolate Unclassified
18 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
19 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
20 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
21 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
22 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
23 2914759650 Rhizosphaericola mali Isolate Rhizosphere
24 2919097161 Chryseobacterium ginsenosidimutans 1394 Isolate Rhizosphere
25 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
26 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
27 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
28 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
29 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
30 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere
31 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
32 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
33 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
34 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
35 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
36 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
37 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
38 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
39 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
40 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
41 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
42 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
43 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
44 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
66 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
67 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
70 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
71 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
72 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
73 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
81 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
82 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
83 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
84 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
85 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
86 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
87 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
88 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
89 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
90 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
91 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
92 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
93 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
94 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
95 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
96 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
97 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
98 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
99 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
100 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
101 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
102 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
103 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
104 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
105 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
106 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
107 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
108 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
109 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
110 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
111 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
112 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
113 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
114 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
115 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
116 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
117 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
118 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
119 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
120 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
121 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
122 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
123 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
124 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
125 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
126 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
127 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
128 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
129 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
130 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
131 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
132 642555144 Nostoc punctiforme PCC 73102 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 81.61
Metatranscriptomes 0
Isolates 18.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.07
Nodule 1.15
Rhizoplane 1.15
Rhizosphere 63.79
Stem 0
Stem Tuber 0
Unclassified 21.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2460789 2162886007 Bacteria 1167
2 JGI25162J39368_1000022 3300002737 Bacteria 239510
3 JGI25154J39366_1005471 3300002738 Bacteria 2016
4 rootH1_10116871 3300003316 Bacteria 1331
5 rootH1_10184476 3300003316 Bacteria 1590
6 rootH2_10033108 3300003320 Bacteria 12326
7 rootL2_10132709 3300003322 Bacteria 1689
8 rootL2_10177072 3300003322 Bacteria 3577
9 rootH1_10002464 3300003323 Bacteria 35419
10 rootH1_10063847 3300003323 Bacteria 1997
11 rootH1_10214644 3300003323 Bacteria 1797
12 Ga0065165_1003790 3300005262 Bacteria 10113
13 Ga0065714_10003074 3300005288 Bacteria 8744
14 Ga0065714_10035824 3300005288 Unclassified 858
15 Ga0065714_10084490 3300005288 Bacteria 2195
16 Ga0070668_100121388 3300005347 Unclassified 2089
17 Ga0070669_100404566 3300005353 Bacteria 1117
18 Ga0070675_100011329 3300005354 Bacteria 6981
19 Ga0070675_100134512 3300005354 Bacteria 2109
20 Ga0070674_100455897 3300005356 Bacteria 1056
21 Ga0070673_100063193 3300005364 Bacteria 2945
22 Ga0070673_100211033 3300005364 Bacteria 1677
23 Ga0070688_100173022 3300005365 Bacteria 1492
24 Ga0070685_10069030 3300005466 Bacteria 2089
25 Ga0068853_100595929 3300005539 Unclassified 1049
26 Ga0070672_100464401 3300005543 Unclassified 1091
27 Ga0070665_100225127 3300005548 Bacteria 1876
28 Ga0070665_100609105 3300005548 Bacteria 1105
29 Ga0068859_100548763 3300005617 Unclassified 1250
30 Ga0068861_100298362 3300005719 Bacteria 1395
31 Ga0081540_1027378 3300005983 Bacteria 3231
32 Ga0070716_100207378 3300006173 Bacteria 1307
33 Ga0068871_100552530 3300006358 Unclassified 1043
34 Ga0097620_100548777 3300006931 Unclassified 1250
35 Ga0079104_1000212 3300006946 Bacteria 81715
36 Ga0111539_10419179 3300009094 Bacteria 1559
37 Ga0105237_10872468 3300009545 Bacteria 907
38 Ga0105239_10195092 3300010375 Bacteria 2267
39 Ga0157373_10000002 3300013100 Bacteria 750094
40 Ga0157373_10035519 3300013100 Bacteria 3578
41 Ga0157373_10278947 3300013100 Bacteria 1184
42 Ga0157371_10027683 3300013102 Bacteria 4110
43 Ga0157370_10000097 3300013104 Bacteria 99144
44 Ga0157370_10000257 3300013104 Bacteria 67219
45 Ga0157374_10044418 3300013296 Bacteria 4108
46 Ga0163162_10056304 3300013306 Bacteria 3960
47 Ga0157375_10002112 3300013308 Bacteria 17165
48 Ga0157375_10201137 3300013308 Bacteria 2148
49 Ga0157375_10547739 3300013308 Bacteria 1319
50 Ga0182006_1003218 3300015261 Bacteria 8486
51 Ga0182005_1000212 3300015265 Bacteria 38424
52 Ga0183373_1001 3300015682 Bacteria 1410374
53 Ga0163161_10007055 3300017792 Bacteria 7774
54 Ga0163161_10008424 3300017792 Bacteria 7136
55 Ga0209436_119505 3300025208 Bacteria 938
56 Ga0209437_100024 3300025233 Bacteria 592878
57 Ga0209646_1001063 3300025246 Bacteria 8235
58 Ga0207426_1021890 3300025302 Bacteria 2202
59 Ga0207681_10397615 3300025923 Bacteria 1112
60 Ga0207659_10032644 3300025926 Unclassified 3576
61 Ga0207691_10363593 3300025940 Bacteria 1237
62 Ga0207651_10037458 3300025960 Bacteria 3178
63 Ga0207668_10216381 3300025972 Bacteria 1535
64 Ga0207639_10844855 3300026041 Unclassified 854
65 Ga0207675_100071079 3300026118 Bacteria 3253
66 Ga0209281_1000309 3300027111 Bacteria 87279
67 Ga0307413_10015097 3300031824 Bacteria 3949
68 Ga0307413_10202938 3300031824 Bacteria 1433
69 Ga0307410_10006415 3300031852 Bacteria 6346
70 Ga0307406_10000003 3300031901 Bacteria 251998
71 Ga0307407_10023216 3300031903 Bacteria 3233
72 Ga0307412_10000869 3300031911 Bacteria 17361
73 Ga0307414_10000001 3300032004 Bacteria 1352954
74 Ga0307414_10140940 3300032004 Bacteria 1887
75 Ga0307414_10305877 3300032004 Bacteria 1347
76 Ga0307411_10000011 3300032005 Bacteria 204666
77 Ga0373937_0105395 3300036401 Bacteria 2620
78 Ga0439465_0001737 3300041413 Bacteria 7125
79 Ga0439458_0039437 3300042157 Bacteria 1142
80 Ga0495638_0131275 3300046460 Bacteria 1471
81 Ga0495650_0110595 3300046471 Bacteria 1021
82 Ga0495606_0001583 3300046507 Bacteria 29724
83 Ga0495606_0004530 3300046507 Bacteria 13817
84 Ga0495606_0015980 3300046507 Bacteria 5748
85 Ga0495606_0077779 3300046507 Bacteria 2071
86 Ga0495606_0161264 3300046507 Bacteria 1308
87 Ga0495606_0194757 3300046507 Bacteria 1159
88 Ga0495616_0033227 3300046513 Bacteria 2689
89 Ga0495632_0008806 3300046519 Bacteria 6147
90 Ga0495643_0003282 3300046522 Bacteria 11953
91 Ga0495643_0035125 3300046522 Bacteria 2761
92 Ga0495643_0036748 3300046522 Bacteria 2689
93 Ga0495643_0124647 3300046522 Bacteria 1298
94 Ga0495648_0184146 3300046524 Unclassified 1059
95 Ga0495663_0000037 3300046525 Bacteria 70080
96 Ga0495663_0006689 3300046525 Bacteria 3181
97 Ga0495654_0071947 3300046530 Bacteria 1638
98 Ga0495609_0000224 3300046538 Bacteria 55767
99 Ga0495633_0004789 3300046558 Bacteria 8482
100 Ga0495633_0113709 3300046558 Bacteria 1255
101 Ga0495625_0003048 3300046660 Bacteria 17182
102 Ga0495625_0027637 3300046660 Bacteria 4265
103 Ga0495625_0056614 3300046660 Bacteria 2790
104 Ga0495625_0163740 3300046660 Bacteria 1488
105 Ga0495660_0018441 3300046810 Bacteria 4012
106 Ga0495660_0083143 3300046810 Bacteria 1675
107 Ga0495681_0083079 3300047470 Bacteria 1426
108 Ga0495686_0000234 3300047472 Bacteria 101539
109 Ga0495686_0000253 3300047472 Bacteria 96076
110 Ga0496109_0000005 3300048912 Bacteria 358226
111 Ga0496115_0036978 3300048918 Unclassified 3867
112 Ga0496121_0000043 3300048924 Bacteria 341882
113 Ga0496124_0056309 3300048927 Bacteria 3317
114 Ga0496124_0138369 3300048927 Bacteria 1925
115 Ga0496124_0315917 3300048927 Bacteria 1121
116 Ga0496124_0358799 3300048927 Bacteria 1028
117 Ga0496125_0000006 3300048928 Bacteria 759385
118 Ga0496125_0121879 3300048928 Bacteria 1857
119 Ga0496126_0002160 3300048929 Bacteria 27374
120 Ga0501249_005383 3300049679 Bacteria 2615
121 Ga0501249_006548 3300049679 Bacteria 2393
122 Ga0501241_000030 3300049758 Bacteria 55589
123 Ga0501266_000006 3300049763 Bacteria 312183
124 Ga0501269_000751 3300049766 Bacteria 5226
125 Ga0501280_000092 3300049776 Bacteria 24270
126 Ga0501044_0317834 3300049823 Unclassified 1482
127 Ga0500641_0010631 3300053096 Bacteria 3330
128 Ga0500641_0038316 3300053096 Bacteria 1926
129 Ga0500556_0005491 3300053104 Bacteria 3580
130 Ga0500572_054969 3300053111 Bacteria 1196
131 Ga0500595_067582 3300053119 Bacteria 1066
132 Ga0500618_000023 3300053125 Bacteria 152444
133 Ga0500652_012795 3300053131 Bacteria 2957
134 Ga0500655_002051 3300053133 Bacteria 3746
135 Ga0500658_0000007 3300053134 Bacteria 284115
136 Ga0500658_0102424 3300053134 Unclassified 1251
137 Ga0500559_0144384 3300053136 Bacteria 1115
138 Ga0500568_0002710 3300053139 Bacteria 10277
139 Ga0500589_160617 3300053147 Bacteria 904
140 Ga0500616_0015277 3300053153 Bacteria 4395
141 Ga0500622_0001551 3300053156 Bacteria 18168
142 Ga0500645_056553 3300053730 Bacteria 1138

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053119 Ga0500595_067582 Ga0500595_067582_38_634 198
2 3300031901 Ga0307406_10000003 Ga0307406_1000000332 215
3 3300031824 Ga0307413_10015097 Ga0307413_100150973 216
4 3300031903 Ga0307407_10023216 Ga0307407_100232164 216
5 3300032004 Ga0307414_10000001 Ga0307414_100000011058 216
6 3300032005 Ga0307411_10000011 Ga0307411_100000115 216
7 3300049679 Ga0501249_006548 Ga0501249_006548_648_1442 216
8 3300049763 Ga0501266_000006 Ga0501266_000006_1262_2056 216
9 iso_pu_bacteria 2818991442 2819576062 217
10 iso_pu_bacteria 2821136567 2821138604 217
11 iso_pu_bacteria 2904467357 2904469397 217
12 iso_pu_bacteria 2818991444 2819587613 219
13 iso_pu_bacteria 2929239360 2929244545 219
14 3300032004 Ga0307414_10140940 Ga0307414_101409401 220
15 3300046530 Ga0495654_0071947 Ga0495654_0071947_28_822 220
16 3300049679 Ga0501249_005383 Ga0501249_005383_648_1442 220
17 3300053134 Ga0500658_0000007 Ga0500658_0000007_282061_282855 220
18 iso_pu_bacteria 2585428061 2587752972 220
19 iso_pu_bacteria 2585428115 2587942743 220
20 iso_pu_bacteria 2585428183 2588212625 220
21 iso_pu_bacteria 2585428187 2588233295 220
22 iso_pu_bacteria 2617270889 2617914513 220
23 iso_pu_bacteria 2738541278 2738730083 220
24 iso_pu_bacteria 2739367874 2740057986 220
25 iso_pu_bacteria 2775506739 2775672776 220
26 iso_pu_bacteria 2818991444 2819589464 220
27 iso_pu_bacteria 2914759650 2914762869 220
28 iso_pu_bacteria 2919097161 2919100407 220
29 iso_pu_bacteria 2919692658 2919692953 220
30 iso_pu_bacteria 2929154850 2929158254 220
31 iso_pu_bacteria 2945924605 2945927132 220
32 iso_pu_bacteria 2965320100 2965322623 220
33 iso_pu_bacteria 642555144 642605960 220
34 3300005262 Ga0065165_1003790 Ga0065165_100379011 221
35 3300015265 Ga0182005_1000212 Ga0182005_100021217 221
36 3300025208 Ga0209436_119505 Ga0209436_1195051 221
37 3300025302 Ga0207426_1021890 Ga0207426_10218903 221
38 3300031824 Ga0307413_10202938 Ga0307413_102029382 221
39 3300031852 Ga0307410_10006415 Ga0307410_100064154 221
40 3300049776 Ga0501280_000092 Ga0501280_000092_6318_7112 221
41 3300002738 JGI25154J39366_1005471 JGI25154J39366_10054713 222
42 3300013100 Ga0157373_10035519 Ga0157373_100355193 222
43 3300013102 Ga0157371_10027683 Ga0157371_100276833 222
44 3300013104 Ga0157370_10000257 Ga0157370_100002576 222
45 3300013306 Ga0163162_10056304 Ga0163162_100563041 222
46 3300025246 Ga0209646_1001063 Ga0209646_10010637 222
47 3300046507 Ga0495606_0194757 Ga0495606_0194757_345_1013 222
48 3300046513 Ga0495616_0033227 Ga0495616_0033227_1263_1931 222
49 3300046522 Ga0495643_0035125 Ga0495643_0035125_1256_1924 222
50 3300046660 Ga0495625_0056614 Ga0495625_0056614_2109_2777 222
51 3300046660 Ga0495625_0163740 Ga0495625_0163740_317_985 222
52 3300053133 Ga0500655_002051 Ga0500655_002051_2849_3517 222
53 3300003316 rootH1_10116871 rootH1_101168712 223
54 3300003320 rootH2_10033108 rootH2_100331084 223
55 3300003322 rootL2_10177072 rootL2_101770723 223
56 3300003323 rootH1_10063847 rootH1_100638473 223
57 3300005288 Ga0065714_10035824 Ga0065714_100358241 223
58 3300005288 Ga0065714_10084490 Ga0065714_100844901 223
59 3300005347 Ga0070668_100121388 Ga0070668_1001213882 223
60 3300005353 Ga0070669_100404566 Ga0070669_1004045661 223
61 3300005354 Ga0070675_100134512 Ga0070675_1001345123 223
62 3300005356 Ga0070674_100455897 Ga0070674_1004558971 223
63 3300005364 Ga0070673_100063193 Ga0070673_1000631934 223
64 3300005543 Ga0070672_100464401 Ga0070672_1004644012 223
65 3300005548 Ga0070665_100225127 Ga0070665_1002251273 223
66 3300005548 Ga0070665_100609105 Ga0070665_1006091052 223
67 3300005719 Ga0068861_100298362 Ga0068861_1002983622 223
68 3300006173 Ga0070716_100207378 Ga0070716_1002073781 223
69 3300009545 Ga0105237_10872468 Ga0105237_108724681 223
70 3300025923 Ga0207681_10397615 Ga0207681_103976151 223
71 3300025940 Ga0207691_10363593 Ga0207691_103635932 223
72 3300025972 Ga0207668_10216381 Ga0207668_102163812 223
73 3300026118 Ga0207675_100071079 Ga0207675_1000710794 223
74 3300048918 Ga0496115_0036978 Ga0496115_0036978_2769_3446 223
75 3300048924 Ga0496121_0000043 Ga0496121_0000043_27934_28605 223
76 3300048928 Ga0496125_0000006 Ga0496125_0000006_84531_85202 223
77 3300053104 Ga0500556_0005491 Ga0500556_0005491_37_708 223
78 3300053153 Ga0500616_0015277 Ga0500616_0015277_2888_3559 223
79 2162886007 SwRhRL2b_contig_2460789 SwRhRL2b_0558.00003700 224
80 3300002737 JGI25162J39368_1000022 JGI25162J39368_1000022133 224
81 3300003316 rootH1_10184476 rootH1_101844762 224
82 3300003322 rootL2_10132709 rootL2_101327093 224
83 3300003323 rootH1_10002464 rootH1_1000246413 224
84 3300003323 rootH1_10214644 rootH1_102146442 224
85 3300005288 Ga0065714_10003074 Ga0065714_100030742 224
86 3300005354 Ga0070675_100011329 Ga0070675_1000113297 224
87 3300005364 Ga0070673_100211033 Ga0070673_1002110332 224
88 3300005365 Ga0070688_100173022 Ga0070688_1001730223 224
89 3300005466 Ga0070685_10069030 Ga0070685_100690302 224
90 3300005539 Ga0068853_100595929 Ga0068853_1005959292 224
91 3300005617 Ga0068859_100548763 Ga0068859_1005487631 224
92 3300005983 Ga0081540_1027378 Ga0081540_10273784 224
93 3300006358 Ga0068871_100552530 Ga0068871_1005525302 224
94 3300006931 Ga0097620_100548777 Ga0097620_1005487771 224
95 3300006946 Ga0079104_1000212 Ga0079104_100021243 224
96 3300009094 Ga0111539_10419179 Ga0111539_104191792 224
97 3300010375 Ga0105239_10195092 Ga0105239_101950921 224
98 3300013100 Ga0157373_10000002 Ga0157373_10000002255 224
99 3300013100 Ga0157373_10278947 Ga0157373_102789472 224
100 3300013104 Ga0157370_10000097 Ga0157370_1000009758 224
101 3300013296 Ga0157374_10044418 Ga0157374_100444183 224
102 3300013308 Ga0157375_10002112 Ga0157375_1000211212 224
103 3300013308 Ga0157375_10201137 Ga0157375_102011372 224
104 3300013308 Ga0157375_10547739 Ga0157375_105477392 224
105 3300015261 Ga0182006_1003218 Ga0182006_10032189 224
106 3300015682 Ga0183373_1001 Ga0183373_100169 224
107 3300017792 Ga0163161_10007055 Ga0163161_100070556 224
108 3300017792 Ga0163161_10008424 Ga0163161_100084246 224
109 3300025233 Ga0209437_100024 Ga0209437_100024447 224
110 3300025926 Ga0207659_10032644 Ga0207659_100326442 224
111 3300025960 Ga0207651_10037458 Ga0207651_100374582 224
112 3300026041 Ga0207639_10844855 Ga0207639_108448552 224
113 3300027111 Ga0209281_1000309 Ga0209281_100030943 224
114 3300031911 Ga0307412_10000869 Ga0307412_100008692 224
115 3300032004 Ga0307414_10305877 Ga0307414_103058772 224
116 3300036401 Ga0373937_0105395 Ga0373937_0105395_1451_2125 224
117 3300041413 Ga0439465_0001737 Ga0439465_0001737_325_1008 224
118 3300042157 Ga0439458_0039437 Ga0439458_0039437_216_911 224
119 3300046460 Ga0495638_0131275 Ga0495638_0131275_730_1410 224
120 3300046471 Ga0495650_0110595 Ga0495650_0110595_193_873 224
121 3300046507 Ga0495606_0001583 Ga0495606_0001583_289_984 224
122 3300046507 Ga0495606_0004530 Ga0495606_0004530_688_1368 224
123 3300046507 Ga0495606_0015980 Ga0495606_0015980_698_1378 224
124 3300046507 Ga0495606_0077779 Ga0495606_0077779_1089_1769 224
125 3300046507 Ga0495606_0161264 Ga0495606_0161264_424_1104 224
126 3300046519 Ga0495632_0008806 Ga0495632_0008806_1563_2243 224
127 3300046522 Ga0495643_0003282 Ga0495643_0003282_3230_3910 224
128 3300046522 Ga0495643_0036748 Ga0495643_0036748_1527_2207 224
129 3300046522 Ga0495643_0124647 Ga0495643_0124647_67_747 224
130 3300046524 Ga0495648_0184146 Ga0495648_0184146_69_749 224
131 3300046525 Ga0495663_0000037 Ga0495663_0000037_4253_4933 224
132 3300046525 Ga0495663_0006689 Ga0495663_0006689_556_1236 224
133 3300046538 Ga0495609_0000224 Ga0495609_0000224_3093_3773 224
134 3300046558 Ga0495633_0004789 Ga0495633_0004789_4533_5213 224
135 3300046558 Ga0495633_0113709 Ga0495633_0113709_384_1061 224
136 3300046660 Ga0495625_0003048 Ga0495625_0003048_5143_5823 224
137 3300046660 Ga0495625_0027637 Ga0495625_0027637_805_1485 224
138 3300046810 Ga0495660_0018441 Ga0495660_0018441_1415_2095 224
139 3300046810 Ga0495660_0083143 Ga0495660_0083143_725_1405 224
140 3300047470 Ga0495681_0083079 Ga0495681_0083079_133_807 224
141 3300047472 Ga0495686_0000234 Ga0495686_0000234_11296_11976 224
142 3300047472 Ga0495686_0000253 Ga0495686_0000253_65218_65898 224
143 3300048912 Ga0496109_0000005 Ga0496109_0000005_55948_56622 224
144 3300048927 Ga0496124_0056309 Ga0496124_0056309_1470_2228 224
145 3300048927 Ga0496124_0138369 Ga0496124_0138369_599_1279 224
146 3300048927 Ga0496124_0315917 Ga0496124_0315917_77_757 224
147 3300048927 Ga0496124_0358799 Ga0496124_0358799_204_998 224
148 3300048928 Ga0496125_0121879 Ga0496125_0121879_373_1053 224
149 3300048929 Ga0496126_0002160 Ga0496126_0002160_22136_22891 224
150 3300049758 Ga0501241_000030 Ga0501241_000030_51798_52478 224
151 3300049766 Ga0501269_000751 Ga0501269_000751_4142_4825 224
152 3300049823 Ga0501044_0317834 Ga0501044_0317834_474_1148 224
153 3300053096 Ga0500641_0010631 Ga0500641_0010631_2191_2877 224
154 3300053096 Ga0500641_0038316 Ga0500641_0038316_233_907 224
155 3300053111 Ga0500572_054969 Ga0500572_054969_222_899 224
156 3300053125 Ga0500618_000023 Ga0500618_000023_14756_15430 224
157 3300053131 Ga0500652_012795 Ga0500652_012795_55_732 224
158 3300053134 Ga0500658_0102424 Ga0500658_0102424_232_909 224
159 3300053136 Ga0500559_0144384 Ga0500559_0144384_267_1055 224
160 3300053139 Ga0500568_0002710 Ga0500568_0002710_2432_3106 224
161 3300053147 Ga0500589_160617 Ga0500589_160617_11_688 224
162 3300053156 Ga0500622_0001551 Ga0500622_0001551_16112_16786 224
163 3300053730 Ga0500645_056553 Ga0500645_056553_199_876 224
164 iso_pu_bacteria 2585428061 2587752969 224
165 iso_pu_bacteria 2643221600 2644011323 224
166 iso_pu_bacteria 2643221716 2644642474 224
167 iso_pu_bacteria 2643221725 2644685042 224
168 iso_pu_bacteria 2739367857 2740002069 224
169 iso_pu_bacteria 2739367858 2740006885 224
170 iso_pu_bacteria 2802428842 2802653964 224
171 iso_pu_bacteria 2857613821 2857614787 224
172 iso_pu_bacteria 2857618242 2857620573 224
173 iso_pu_bacteria 2904419702 2904420104 224
174 iso_pu_bacteria 2919191525 2919193903 224

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01965

DJ-1_PfpI

DJ-1/PfpI family

26

221

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
4p5p-assembly1.cif.gz_A x-ray structure of francisella tularensis rapid encystment protein 24 kda (rep24), gene product of ftn_0841 0.9471 3 221
1u9c-assembly1.cif.gz_A crystallographic structure of apc35852 0.9403 1 223
1u9c-assembly1.cif.gz_A crystallographic structure of apc35852 0.928 1 223
4p5p-assembly1.cif.gz_A x-ray structure of francisella tularensis rapid encystment protein 24 kda (rep24), gene product of ftn_0841 0.9227 3 221
3mii-assembly1.cif.gz_B crystal structure of y0r391cp/hsp33 from saccharomyces cerevisiae 0.9107 2 222
ID Description Score Start End Superfamily
af_Q54W12_1_221_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9597 3 217 3.40.50.880
4p5pA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9425 3 221 3.40.50.880
1u9cA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9386 1 223 3.40.50.880
af_Q54W12_1_221_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9302 3 217 3.40.50.880
1u9cA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9263 1 223 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A6I3MW22-F1-model_v4 Type 1 glutamine amidotransferase domain-containing protein 1.003 100 223 GO:0005737
GO:0016740
GO:0019172
GO:0019243
AF-A0A8B4Y7V8-F1-model_v4 deleted 0.9986 1 223
AF-A0A0M9VJ74-F1-model_v4 Thiamine biosynthesis protein ThiJ 0.9986 3 222 GO:0005737
GO:0019172
GO:0019243
AF-I2GFP9-F1-model_v4 ThiJ/PfpI domain-containing protein 0.9979 150 223
AF-A0A6I3MVA3-F1-model_v4 Type 1 glutamine amidotransferase domain-containing protein 0.9932 3 125 GO:0005737
GO:0016740
GO:0019172
GO:0019243

Feature Viewer

pLDDT pTM Quality
97.03 0.94 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map