F264069

General Info

Members Datasets Scaffolds Average Seq Length
174 127 348 317

Family's Representative Sequence

Representative Sequence 3300005455|Ga0070663_100003002|Ga0070663_1000030022
Length 343
Sequence MIATRLTLVSSGRGSPLGSAVVEKRLLGRSGLRVSRMALGTMTWGGDTDAEEAASQLVAFVDAGGTLVDTADIYGEGESERVLGSLLGDLVPRDDVVLATKAVAKRTDGPFGGGASRGALLTALDGSLKRLGTDHIDLWQLHAWDEHVPLAETLSALEYAVTSGKVRYVGVSNYAGWQLASAAAGASALAPLVSTQVEYSLLERGVDREVVPAAAHHGIGLLPWAPLGRGVLTGKYRTGTPADSRGANSAYAGYVEHHRTDRAARIVQAVATAADGLGTSPLAVALAWVRDRPGVVAPVVGARDTGQLTGSLTAEDITLPPAIRSALDDVSAIEVGYPERWPR

Samples

Sample ID Description Type Environment
1 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
9 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
10 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
11 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
12 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
13 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
14 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
15 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
16 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
17 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
18 3300012478 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 Metagenome Rhizosphere
19 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
20 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
21 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
22 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
23 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
24 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
41 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
42 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
43 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
44 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
45 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
46 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
47 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
48 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
49 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
50 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
51 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
52 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
53 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
54 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
55 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
56 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
57 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
58 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
59 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
60 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
61 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
62 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
63 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
64 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
65 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
66 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
67 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
68 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
69 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
70 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
71 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
72 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
73 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
74 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
75 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
76 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
77 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
78 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
79 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
80 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
81 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
82 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
83 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
84 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
85 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
86 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
87 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
88 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
89 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
90 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
91 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
92 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
93 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
94 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
95 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
96 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
97 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
98 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
99 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
100 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
101 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
102 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
103 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
104 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
105 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
106 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
107 2582580736 Prauserella sp. Am3 Isolate Unclassified
108 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
109 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
110 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
111 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
112 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
113 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
114 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
115 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
116 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
117 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
118 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
119 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
120 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
121 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
122 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
123 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
124 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
125 2984592036 Aeromicrobium sp. SORGH_AS981 Isolate Aerial Root
126 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
127 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 87.36
Metatranscriptomes 0
Isolates 12.64

Biome Distribution

Category Percentage (%)
Aerial Root 0.57
Bulb 0
Endosphere 2.3
Nodule 0
Rhizoplane 6.32
Rhizosphere 74.14
Stem 0
Stem Tuber 0.57
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070663_100003002 3300005455 Bacteria 9629
2 rootH2_10147004 3300003320 Bacteria 1469
3 Ga0070658_10000882 3300005327 Bacteria 25672
4 Ga0070680_100176982 3300005336 Bacteria 1796
5 Ga0068868_100064489 3300005338 Bacteria 2908
6 Ga0070668_100000522 3300005347 Bacteria 25465
7 Ga0070714_100013542 3300005435 Bacteria 6538
8 Ga0070679_100195753 3300005530 Bacteria 1989
9 Ga0068853_100073942 3300005539 Bacteria 2973
10 Ga0070665_100099543 3300005548 Bacteria 2911
11 Ga0070665_100101063 3300005548 Bacteria 2888
12 Ga0068852_100010097 3300005616 Bacteria 7029
13 Ga0068863_100012881 3300005841 Bacteria 8065
14 Ga0081455_10000169 3300005937 Bacteria 80959
15 Ga0081455_10055212 3300005937 Bacteria 3380
16 Ga0081538_10000016 3300005981 Bacteria 147022
17 Ga0081539_10004658 3300005985 Bacteria 14918
18 Ga0081539_10057684 3300005985 Bacteria 2146
19 Ga0075365_10026398 3300006038 Bacteria 3687
20 Ga0075365_10048920 3300006038 Bacteria 2784
21 Ga0105238_10013732 3300009551 Bacteria 8184
22 Ga0157328_1000469 3300012478 Bacteria 1488
23 Ga0157375_10001577 3300013308 Bacteria 19613
24 Ga0163161_10158441 3300017792 Bacteria 1725
25 Ga0213873_10000101 3300021358 Bacteria 16543
26 Ga0213876_10009183 3300021384 Bacteria 5324
27 Ga0213876_10041372 3300021384 Bacteria 2435
28 Ga0213875_10000129 3300021388 Bacteria 83647
29 Ga0213875_10003015 3300021388 Bacteria 9784
30 Ga0213875_10003197 3300021388 Bacteria 9416
31 Ga0207692_10000118 3300025898 Bacteria 23840
32 Ga0207647_10069713 3300025904 Bacteria 2125
33 Ga0207660_10187882 3300025917 Bacteria 1607
34 Ga0207652_10069668 3300025921 Bacteria 3054
35 Ga0207664_10018254 3300025929 Bacteria 5159
36 Ga0207664_10242589 3300025929 Bacteria 1570
37 Ga0207686_10208280 3300025934 Bacteria 1404
38 Ga0207709_10203239 3300025935 Bacteria 1416
39 Ga0207689_10048472 3300025942 Bacteria 3504
40 Ga0207668_10006128 3300025972 Bacteria 7095
41 Ga0207677_10135255 3300026023 Bacteria 1878
42 Ga0207639_10141980 3300026041 Bacteria 2002
43 Ga0207678_10000795 3300026067 Bacteria 28948
44 Ga0207708_10158686 3300026075 Bacteria 1785
45 Ga0207674_10130875 3300026116 Bacteria 2472
46 Ga0207698_10062898 3300026142 Bacteria 2901
47 Ga0268266_10053195 3300028379 Bacteria 3478
48 Ga0307511_10000179 3300030521 Bacteria 62577
49 Ga0316177_1202601 3300030731 Bacteria 6734
50 Ga0316176_1125254 3300030732 Bacteria 2997
51 Ga0314311_1197278 3300030733 Bacteria 6708
52 Ga0307509_10035320 3300031507 Bacteria 5488
53 Ga0307509_10085934 3300031507 Bacteria 3236
54 Ga0307413_10015664 3300031824 Bacteria 3893
55 Ga0307518_10001041 3300031838 Bacteria 20741
56 Ga0307409_100580057 3300031995 Bacteria 1105
57 Ga0307416_100116756 3300032002 Bacteria 2367
58 Ga0307411_10014047 3300032005 Bacteria 4443
59 Ga0307507_10026558 3300033179 Bacteria 6236
60 Ga0307507_10061015 3300033179 Bacteria 3513
61 Ga0395899_0001236 3300037312 Bacteria 22293
62 Ga0395898_0010736 3300037466 Bacteria 9567
63 Ga0395898_0391052 3300037466 Bacteria 1326
64 Ga0436364_1142319 3300037853 Bacteria 112398
65 Ga0436364_1179679 3300037853 Bacteria 24973
66 Ga0436364_1486615 3300037853 Bacteria 11421
67 Ga0395901_0004614 3300038443 Bacteria 13905
68 Ga0436365_0387165 3300039437 Bacteria 6817
69 Ga0436365_0566665 3300039437 Bacteria 5704
70 Ga0436362_0328958 3300039453 Bacteria 56155
71 Ga0439466_0008822 3300041411 Bacteria 3792
72 Ga0439449_0027563 3300042007 Bacteria 2121
73 Ga0466972_0006998 3300044658 Bacteria 5657
74 Ga0466972_0029351 3300044658 Bacteria 2707
75 Ga0466965_0012529 3300044683 Bacteria 3989
76 Ga0466965_0022717 3300044683 Bacteria 3025
77 Ga0466965_0041404 3300044683 Bacteria 2270
78 Ga0466965_0096870 3300044683 Bacteria 1506
79 Ga0466966_0001590 3300044684 Bacteria 14591
80 Ga0466966_0010856 3300044684 Bacteria 6050
81 Ga0466961_0051294 3300044693 Bacteria 2635
82 Ga0466961_0071755 3300044693 Bacteria 2197
83 Ga0466961_0222358 3300044693 Bacteria 1163
84 Ga0466963_0003555 3300044694 Bacteria 8950
85 Ga0466963_0062854 3300044694 Bacteria 2484
86 Ga0466963_0267149 3300044694 Bacteria 1202
87 Ga0466963_0286514 3300044694 Bacteria 1158
88 Ga0466964_0072819 3300044706 Bacteria 1457
89 Ga0466971_0002729 3300044719 Bacteria 7460
90 Ga0466968_0001558 3300044735 Bacteria 8257
91 Ga0466970_0021420 3300044765 Bacteria 3366
92 Ga0466970_0037943 3300044765 Bacteria 2556
93 Ga0466970_0052099 3300044765 Bacteria 2185
94 Ga0466970_0093279 3300044765 Bacteria 1635
95 Ga0466957_0012083 3300044842 Bacteria 4993
96 Ga0466957_0151229 3300044842 Bacteria 1501
97 Ga0466960_0004685 3300044901 Bacteria 5364
98 Ga0466960_0010418 3300044901 Bacteria 3862
99 Ga0466960_0159456 3300044901 Bacteria 1210
100 Ga0466959_0001834 3300045049 Bacteria 13336
101 Ga0466959_0002297 3300045049 Bacteria 12195
102 Ga0466959_0123619 3300045049 Bacteria 1838
103 Ga0466958_0005839 3300045836 Bacteria 6661
104 Ga0466967_0000168 3300045976 Bacteria 26814
105 Ga0466967_0023773 3300045976 Bacteria 5027
106 Ga0466967_0026306 3300045976 Bacteria 4817
107 Ga0466967_0059232 3300045976 Bacteria 3389
108 Ga0466967_0135715 3300045976 Bacteria 2288
109 Ga0466967_0377133 3300045976 Bacteria 1377
110 Ga0496100_0257692 3300048903 Bacteria 1292
111 Ga0496102_0033705 3300048905 Bacteria 4604
112 Ga0496104_0023358 3300048907 Bacteria 5685
113 Ga0496108_0087955 3300048911 Bacteria 2639
114 Ga0496109_0013803 3300048912 Bacteria 7019
115 Ga0496109_0155838 3300048912 Bacteria 2139
116 Ga0496111_0050945 3300048914 Bacteria 2988
117 Ga0496112_0012775 3300048915 Bacteria 7728
118 Ga0496113_0082183 3300048916 Bacteria 2470
119 Ga0496113_0163334 3300048916 Bacteria 1761
120 Ga0496114_0016184 3300048917 Bacteria 6004
121 Ga0501038_0041126 3300049574 Bacteria 4032
122 Ga0501040_0012549 3300049576 Bacteria 5553
123 Ga0501041_0019717 3300049577 Bacteria 4029
124 Ga0501042_0431564 3300049578 Bacteria 955
125 Ga0501047_0192994 3300049581 Bacteria 1900
126 Ga0501048_0027658 3300049582 Bacteria 4118
127 Ga0501070_0001124 3300049586 Bacteria 24014
128 Ga0501070_0246962 3300049586 Bacteria 1460
129 Ga0501070_0501346 3300049586 Bacteria 975
130 Ga0501071_0000583 3300049587 Bacteria 18891
131 Ga0501071_0105028 3300049587 Bacteria 2085
132 Ga0501072_0041542 3300049588 Bacteria 3612
133 Ga0501073_0008890 3300049589 Bacteria 7426
134 Ga0501073_0159071 3300049589 Bacteria 1565
135 Ga0501074_0000289 3300049590 Bacteria 29146
136 Ga0501074_0001196 3300049590 Bacteria 17075
137 Ga0501075_0035657 3300049591 Bacteria 3710
138 Ga0501076_0009326 3300049592 Bacteria 7242
139 Ga0501077_0044102 3300049593 Bacteria 2834
140 Ga0501079_0023585 3300049741 Bacteria 4722
141 Ga0501080_0002865 3300049742 Bacteria 15175
142 Ga0501080_0027222 3300049742 Bacteria 5317
143 Ga0501080_0218679 3300049742 Bacteria 1744
144 Ga0501081_0078542 3300049743 Bacteria 2307
145 Ga0501045_0017127 3300049824 Bacteria 5146
146 nmdc:mga0yw44_26549_c1 3300050492 Bacteria 3309
147 Ga0495655_0026497 3300053083 Bacteria 1366
148 Ga0500562_010811 3300053108 Bacteria 2316
149 Ga0501082_0038878 3300060353 Bacteria 4104
150 Ga0466962_0039962 3300061719 Bacteria 2246
151 Ga0466962_0044544 3300061719 Bacteria 2122
152 Ga0530510_0110171 3300061734 Bacteria 2016
153 2515851209 2515154155 Bacteria 7985436
154 2583149982 2582580736 Bacteria 5325865
155 2586060994 2585427649 Bacteria 9053857
156 2623498854 2622736605 Bacteria 4992138
157 2676478967 2675903058 Bacteria 6822861
158 2753073072 2751185734 Bacteria 8863695
159 2795786956 2795385470 Bacteria 8317180
160 2795793055 2795385472 Bacteria 6627535
161 2809589977 2808606522 Bacteria 9488490
162 2812332786 2811994874 Bacteria 5367947
163 2827630282 2827628540 Bacteria 6858585
164 2866614913 2866612099 Bacteria 7543886
165 2870723714 2870721527 Bacteria 9689237
166 2887443951 2887443736 Bacteria 4426037
167 2891330820 2891326441 Bacteria 6439512
168 2899366646 2899359706 Bacteria 10940472
169 2899375453 2899370129 Bacteria 6781179
170 2915770508 2915768154 Bacteria 8424322
171 2917736654 2917736166 Bacteria 9690793
172 2984594763 2984592036 Bacteria 3670284
173 8003319970 8003314358 Bacteria 10575343
174 8047714911 8047710418 Bacteria 11023148
175 Ga0070663_100003002
176 rootH2_10147004
177 Ga0070658_10000882
178 Ga0070680_100176982
179 Ga0068868_100064489
180 Ga0070668_100000522
181 Ga0070714_100013542
182 Ga0070679_100195753
183 Ga0068853_100073942
184 Ga0070665_100099543
185 Ga0070665_100101063
186 Ga0068852_100010097
187 Ga0068863_100012881
188 Ga0081455_10000169
189 Ga0081455_10055212
190 Ga0081538_10000016
191 Ga0081539_10004658
192 Ga0081539_10057684
193 Ga0075365_10026398
194 Ga0075365_10048920
195 Ga0105238_10013732
196 Ga0157328_1000469
197 Ga0157375_10001577
198 Ga0163161_10158441
199 Ga0213873_10000101
200 Ga0213876_10009183
201 Ga0213876_10041372
202 Ga0213875_10000129
203 Ga0213875_10003015
204 Ga0213875_10003197
205 Ga0207692_10000118
206 Ga0207647_10069713
207 Ga0207660_10187882
208 Ga0207652_10069668
209 Ga0207664_10018254
210 Ga0207664_10242589
211 Ga0207686_10208280
212 Ga0207709_10203239
213 Ga0207689_10048472
214 Ga0207668_10006128
215 Ga0207677_10135255
216 Ga0207639_10141980
217 Ga0207678_10000795
218 Ga0207708_10158686
219 Ga0207674_10130875
220 Ga0207698_10062898
221 Ga0268266_10053195
222 Ga0307511_10000179
223 Ga0316177_1202601
224 Ga0316176_1125254
225 Ga0314311_1197278
226 Ga0307509_10035320
227 Ga0307509_10085934
228 Ga0307413_10015664
229 Ga0307518_10001041
230 Ga0307409_100580057
231 Ga0307416_100116756
232 Ga0307411_10014047
233 Ga0307507_10026558
234 Ga0307507_10061015
235 Ga0395899_0001236
236 Ga0395898_0010736
237 Ga0395898_0391052
238 Ga0436364_1142319
239 Ga0436364_1179679
240 Ga0436364_1486615
241 Ga0395901_0004614
242 Ga0436365_0387165
243 Ga0436365_0566665
244 Ga0436362_0328958
245 Ga0439466_0008822
246 Ga0439449_0027563
247 Ga0466972_0006998
248 Ga0466972_0029351
249 Ga0466965_0012529
250 Ga0466965_0022717
251 Ga0466965_0041404
252 Ga0466965_0096870
253 Ga0466966_0001590
254 Ga0466966_0010856
255 Ga0466961_0051294
256 Ga0466961_0071755
257 Ga0466961_0222358
258 Ga0466963_0003555
259 Ga0466963_0062854
260 Ga0466963_0267149
261 Ga0466963_0286514
262 Ga0466964_0072819
263 Ga0466971_0002729
264 Ga0466968_0001558
265 Ga0466970_0021420
266 Ga0466970_0037943
267 Ga0466970_0052099
268 Ga0466970_0093279
269 Ga0466957_0012083
270 Ga0466957_0151229
271 Ga0466960_0004685
272 Ga0466960_0010418
273 Ga0466960_0159456
274 Ga0466959_0001834
275 Ga0466959_0002297
276 Ga0466959_0123619
277 Ga0466958_0005839
278 Ga0466967_0000168
279 Ga0466967_0023773
280 Ga0466967_0026306
281 Ga0466967_0059232
282 Ga0466967_0135715
283 Ga0466967_0377133
284 Ga0496100_0257692
285 Ga0496102_0033705
286 Ga0496104_0023358
287 Ga0496108_0087955
288 Ga0496109_0013803
289 Ga0496109_0155838
290 Ga0496111_0050945
291 Ga0496112_0012775
292 Ga0496113_0082183
293 Ga0496113_0163334
294 Ga0496114_0016184
295 Ga0501038_0041126
296 Ga0501040_0012549
297 Ga0501041_0019717
298 Ga0501042_0431564
299 Ga0501047_0192994
300 Ga0501048_0027658
301 Ga0501070_0001124
302 Ga0501070_0246962
303 Ga0501070_0501346
304 Ga0501071_0000583
305 Ga0501071_0105028
306 Ga0501072_0041542
307 Ga0501073_0008890
308 Ga0501073_0159071
309 Ga0501074_0000289
310 Ga0501074_0001196
311 Ga0501075_0035657
312 Ga0501076_0009326
313 Ga0501077_0044102
314 Ga0501079_0023585
315 Ga0501080_0002865
316 Ga0501080_0027222
317 Ga0501080_0218679
318 Ga0501081_0078542
319 Ga0501045_0017127
320 nmdc:mga0yw44_26549_c1
321 Ga0495655_0026497
322 Ga0500562_010811
323 Ga0501082_0038878
324 Ga0466962_0039962
325 Ga0466962_0044544
326 Ga0530510_0110171
327 2515851209
328 2583149982
329 2586060994
330 2623498854
331 2676478967
332 2753073072
333 2795786956
334 2795793055
335 2809589977
336 2812332786
337 2827630282
338 2866614913
339 2870723714
340 2887443951
341 2891330820
342 2899366646
343 2899375453
344 2915770508
345 2917736654
346 2984594763
347 8003319970
348 8047714911

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

36

332

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7utf-assembly2.cif.gz_D structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9569 1 316
7utf-assembly1.cif.gz_C structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.952 1 314
7utf-assembly2.cif.gz_B structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9482 1 316
4xk2-assembly2.cif.gz_B crystal structure of aldo-keto reductase from polaromonas sp. js666 0.9396 1 319
7utf-assembly1.cif.gz_A structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.935 1 314
ID Description Score Start End Superfamily
af_C4J2K0_1_323_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9436 1 312 3.20.20.100
af_E9QGU5_66_406_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9361 1 313 3.20.20.100
af_O59826_13_339_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9256 1 318 3.20.20.100
1lqaB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9209 1 313 3.20.20.100
af_P77735_1_322_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9182 1 319 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A1G6THT9-F1-model_v4 Predicted oxidoreductase 0.9779 1 313 GO:0005829
GO:0016491
AF-A0A2I1IKZ8-F1-model_v4 Aldo/keto reductase 0.9779 1 314 GO:0005829
GO:0016491
AF-A0A6J6VAX8-F1-model_v4 Unannotated protein 0.9776 114 313 GO:0005829
GO:0016491
AF-A0A6L6ECB6-F1-model_v4 deleted 0.9765 45 313
AF-A0A6J6VAX8-F1-model_v4 Unannotated protein 0.9726 114 313 GO:0005829
GO:0016491

Map