F263476

General Info

Members Datasets Scaffolds Average Seq Length
173 140 346 239

Family's Representative Sequence

Representative Sequence 3300053087|Ga0500643_002954|Ga0500643_002954_4113_4928
Length 271
Sequence MGDEFRPSASSILALAHPSSRTQQQTRNSPGGEMNDLLESALAAHGGLDRWNQITAITVDASITGALWHVKGKPDVLKDVRLGADTKRQMLTVDYVGQDKRSVFEPQRVVIERGDGSTIDERDEPENSFDGHLLQTPWDDLHIAYFTGEALWSYLNTPFLYTWPGFVTEEIAPIEVNGETWRRLKVTFPEHIKSHTRQQISCFGPDGLLRRHDFTIDVIGGATGMLYATDYRNVDGIIIPTARRGYAWQGDYQLIPEPLLVAIDMGAITIH

Samples

Sample ID Description Type Environment
1 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
30 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
33 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
34 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
35 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
36 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
37 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
38 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
39 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
40 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
41 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
52 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
74 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
75 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
77 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
78 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
79 3300031010 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
80 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
81 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
82 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
83 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
84 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
85 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
86 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
87 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
88 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
89 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
90 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
91 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
92 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
93 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
94 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
95 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
96 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
97 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
98 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
99 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
100 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
101 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
102 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
103 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
104 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
105 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
106 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
107 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
108 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
109 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
110 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
111 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
112 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
113 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
114 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
115 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
116 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
117 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
118 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
119 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
120 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
121 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
122 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
123 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
124 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
125 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
126 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
127 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
128 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
129 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
130 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
131 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
132 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
133 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
134 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
135 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
136 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
137 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
138 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
139 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
140 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.64
Metatranscriptomes 3.47
Isolates 2.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.36
Nodule 0
Rhizoplane 5.78
Rhizosphere 86.13
Stem 0
Stem Tuber 0
Unclassified 8.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500643_002954 3300053087 Bacteria 8421
2 JGI24739J22299_10007220 3300001989 Bacteria 4179
3 JGI24737J22298_10005873 3300001990 Bacteria 4224
4 JGI24738J21930_10005861 3300002075 Bacteria 2920
5 rootL2_10198138 3300003322 Bacteria 1537
6 Ga0065715_10244686 3300005293 Bacteria 1187
7 Ga0070683_100470567 3300005329 Bacteria 1200
8 Ga0070682_100133490 3300005337 Bacteria 1683
9 Ga0070671_100055345 3300005355 Bacteria 3300
10 Ga0070667_100012043 3300005367 Bacteria 7159
11 Ga0070667_100677221 3300005367 Bacteria 953
12 Ga0070709_10098693 3300005434 Unclassified 1941
13 Ga0070714_100046457 3300005435 Bacteria 3684
14 Ga0070714_100766609 3300005435 Bacteria 933
15 Ga0070713_100062147 3300005436 Bacteria 3127
16 Ga0070710_10016023 3300005437 Bacteria 3805
17 Ga0070711_100091577 3300005439 Bacteria 2192
18 Ga0070708_100047225 3300005445 Bacteria 3802
19 Ga0070708_100265897 3300005445 Bacteria 1613
20 Ga0070708_100281254 3300005445 Unclassified 1566
21 Ga0070706_100004788 3300005467 Bacteria 12971
22 Ga0070706_100512573 3300005467 Bacteria 1116
23 Ga0070707_100051161 3300005468 Bacteria 3960
24 Ga0070707_100758085 3300005468 Bacteria 934
25 Ga0070698_100055458 3300005471 Bacteria 4018
26 Ga0070698_100064505 3300005471 Bacteria 3690
27 Ga0070698_100221641 3300005471 Bacteria 1825
28 Ga0070698_100299234 3300005471 Bacteria 1539
29 Ga0070697_100100520 3300005536 Bacteria 2402
30 Ga0070686_100010549 3300005544 Bacteria 5214
31 Ga0070695_100202739 3300005545 Bacteria 1419
32 Ga0070665_100005292 3300005548 Bacteria 13324
33 Ga0070665_100387571 3300005548 Bacteria 1405
34 Ga0070704_100484729 3300005549 Bacteria 1070
35 Ga0068855_100129988 3300005563 Bacteria 2877
36 Ga0068857_100215144 3300005577 Bacteria 1754
37 Ga0068863_100005369 3300005841 Bacteria 12635
38 Ga0068858_100086961 3300005842 Bacteria 2907
39 Ga0075363_100036313 3300006048 Bacteria 2584
40 Ga0075363_100392105 3300006048 Unclassified 815
41 Ga0075364_10002822 3300006051 Bacteria 9785
42 Ga0070712_100024113 3300006175 Bacteria 4027
43 Ga0075369_10054796 3300006186 Bacteria 1731
44 Ga0075370_10021824 3300006353 Bacteria 3510
45 Ga0075436_100209572 3300006914 Bacteria 1381
46 Ga0075435_100433528 3300007076 Unclassified 1132
47 Ga0099794_10124138 3300007265 Bacteria 1301
48 Ga0099795_10008897 3300007788 Bacteria 2890
49 Ga0105251_10104309 3300009011 Bacteria 1295
50 Ga0105244_10059208 3300009036 Bacteria 1931
51 Ga0105250_10075916 3300009092 Bacteria 1360
52 Ga0105247_10438453 3300009101 Unclassified 939
53 Ga0114129_11120437 3300009147 Bacteria 984
54 Ga0105248_10000004 3300009177 Bacteria 695244
55 Ga0105248_10003360 3300009177 Bacteria 17783
56 Ga0105248_10928073 3300009177 Bacteria 983
57 Ga0105237_10003479 3300009545 Bacteria 18673
58 Ga0105238_10326140 3300009551 Unclassified 1522
59 Ga0105238_10606437 3300009551 Bacteria 1103
60 Ga0099796_10073526 3300010159 Bacteria 1239
61 Ga0099796_10104384 3300010159 Bacteria 1071
62 Ga0105239_10081345 3300010375 Bacteria 3565
63 Ga0105246_10009180 3300011119 Bacteria 6090
64 Ga0157372_11055572 3300013307 Bacteria 940
65 Ga0163163_10031325 3300014325 Bacteria 5132
66 Ga0228598_1000054 3300024227 Bacteria 16523
67 Ga0207696_1030325 3300025711 Bacteria 1644
68 Ga0207713_1083420 3300025735 Bacteria 1143
69 Ga0207692_10015254 3300025898 Bacteria 3376
70 Ga0207647_10218072 3300025904 Bacteria 1100
71 Ga0207684_10002745 3300025910 Bacteria 17539
72 Ga0207695_10041279 3300025913 Bacteria 4939
73 Ga0207671_10015571 3300025914 Bacteria 5948
74 Ga0207693_10035677 3300025915 Bacteria 3921
75 Ga0207663_10101543 3300025916 Unclassified 1933
76 Ga0207652_10001393 3300025921 Bacteria 21486
77 Ga0207646_10000349 3300025922 Bacteria 62593
78 Ga0207646_10619278 3300025922 Bacteria 971
79 Ga0207687_10404742 3300025927 Bacteria 1123
80 Ga0207700_10010790 3300025928 Bacteria 5793
81 Ga0207664_10016417 3300025929 Bacteria 5401
82 Ga0207644_10028129 3300025931 Bacteria 3888
83 Ga0207665_10482527 3300025939 Bacteria 955
84 Ga0207711_10000008 3300025941 Bacteria 597686
85 Ga0207711_10000010 3300025941 Bacteria 557970
86 Ga0207711_10003811 3300025941 Bacteria 12971
87 Ga0207711_10918876 3300025941 Bacteria 813
88 Ga0207658_10008085 3300025986 Bacteria 7164
89 Ga0207703_10111628 3300026035 Unclassified 2334
90 Ga0207678_10414985 3300026067 Bacteria 1167
91 Ga0207641_10004533 3300026088 Bacteria 12013
92 Ga0265354_1000183 3300028016 Bacteria 11526
93 Ga0265356_1015995 3300028017 Bacteria 813
94 Ga0268264_10071120 3300028381 Bacteria 2947
95 Ga0265338_10008617 3300028800 Bacteria 12335
96 Ga0265338_10137763 3300028800 Bacteria 1916
97 Ga0265338_10307062 3300028800 Bacteria 1152
98 Ga0265770_1000266 3300030878 Bacteria 7030
99 Ga0265765_1000033 3300030879 Bacteria 6340
100 Ga0265771_1000381 3300031010 Bacteria 1559
101 Ga0265760_10003342 3300031090 Bacteria 4687
102 Ga0265760_10023138 3300031090 Bacteria 1804
103 Ga0265325_10004316 3300031241 Bacteria 9004
104 Ga0265325_10112217 3300031241 Bacteria 1323
105 Ga0265340_10045763 3300031247 Bacteria 2136
106 Ga0265340_10115249 3300031247 Unclassified 1239
107 Ga0265339_10010097 3300031249 Bacteria 5883
108 Ga0265339_10044499 3300031249 Bacteria 2449
109 Ga0265331_10016279 3300031250 Bacteria 3907
110 Ga0265316_10027274 3300031344 Bacteria 4733
111 Ga0265316_10030559 3300031344 Bacteria 4413
112 Ga0265316_10078107 3300031344 Bacteria 2541
113 Ga0265314_10025877 3300031711 Bacteria 4418
114 Ga0265342_10133735 3300031712 Unclassified 1388
115 Ga0307415_100499911 3300032126 Bacteria 1063
116 Ga0265778_010001 3300036457 Bacteria 1074
117 Ga0395898_0340073 3300037466 Bacteria 1431
118 Ga0395901_0451310 3300038443 Bacteria 1315
119 Ga0395901_0731946 3300038443 Unclassified 984
120 Ga0466969_0028790 3300044656 Bacteria 2839
121 Ga0466972_0022377 3300044658 Bacteria 3149
122 Ga0466972_0100471 3300044658 Unclassified 1369
123 Ga0466970_0004052 3300044765 Bacteria 7194
124 Ga0466960_0079172 3300044901 Bacteria 1652
125 Ga0466960_0233339 3300044901 Bacteria 1016
126 Ga0466958_0168322 3300045836 Bacteria 1387
127 Ga0495603_0064994 3300046455 Bacteria 2150
128 Ga0495629_0097010 3300046459 Bacteria 2057
129 Ga0495662_0087150 3300046476 Bacteria 1521
130 Ga0495664_0053829 3300046477 Bacteria 2393
131 Ga0495628_0262125 3300046516 Bacteria 1288
132 Ga0495648_0007365 3300046524 Bacteria 8816
133 Ga0495663_0019146 3300046525 Bacteria 1956
134 Ga0495652_0100324 3300046529 Bacteria 2348
135 Ga0495640_0007283 3300046533 Bacteria 8716
136 Ga0495668_0055325 3300046616 Unclassified 2191
137 Ga0495657_0127580 3300046675 Bacteria 1596
138 Ga0495657_0326530 3300046675 Bacteria 911
139 Ga0495613_0007894 3300046689 Bacteria 7915
140 Ga0495613_0009685 3300046689 Bacteria 7157
141 Ga0495600_0263673 3300046809 Bacteria 1094
142 Ga0495581_0036253 3300047315 Bacteria 2854
143 Ga0495604_0042859 3300047317 Bacteria 3544
144 Ga0495674_0155749 3300047319 Unclassified 1914
145 Ga0495672_0001136 3300047320 Bacteria 26902
146 Ga0495676_0017992 3300047321 Bacteria 6235
147 Ga0495675_0147528 3300047444 Bacteria 1455
148 Ga0495673_0000714 3300047469 Bacteria 32261
149 Ga0495614_0048065 3300048089 Bacteria 1830
150 Ga0496102_0014719 3300048905 Bacteria 6800
151 Ga0496103_0051924 3300048906 Bacteria 2538
152 Ga0496104_0009716 3300048907 Bacteria 8576
153 Ga0496105_0019676 3300048908 Bacteria 5446
154 Ga0496108_0208409 3300048911 Bacteria 1696
155 Ga0496109_0077388 3300048912 Bacteria 3061
156 Ga0496110_0718857 3300048913 Bacteria 901
157 Ga0496111_0011294 3300048914 Bacteria 6012
158 Ga0496112_0143789 3300048915 Bacteria 2354
159 Ga0496115_0314486 3300048918 Bacteria 1282
160 Ga0501047_0170435 3300049581 Bacteria 2046
161 nmdc:mga03n38_53135_c1 3300050490 Bacteria 1815
162 nmdc:mga03n38_59461_c1 3300050490 Bacteria 1735
163 nmdc:mga00v17_36091_c1 3300050491 Bacteria 2945
164 nmdc:mga07m45_81620_c1 3300050496 Bacteria 1846
165 nmdc:mga05p37_589086_c1 3300050507 Bacteria 1258
166 nmdc:mga0n895_441431_c1 3300050512 Bacteria 1315
167 nmdc:mga08x19_231378_c1 3300050514 Bacteria 1272
168 nmdc:mga0sz30_5556_c1 3300050516 Bacteria 2844
169 2552105706 2551306166 Bacteria 9731570
170 2616703072 2616644814 Bacteria 11555299
171 2902802386 2902799365 Bacteria 5419524
172 2919714238 2919713450 Bacteria 7431245
173 3003002572 3002998708 Bacteria 11715108
174 Ga0500643_002954
175 JGI24739J22299_10007220
176 JGI24737J22298_10005873
177 JGI24738J21930_10005861
178 rootL2_10198138
179 Ga0065715_10244686
180 Ga0070683_100470567
181 Ga0070682_100133490
182 Ga0070671_100055345
183 Ga0070667_100012043
184 Ga0070667_100677221
185 Ga0070709_10098693
186 Ga0070714_100046457
187 Ga0070714_100766609
188 Ga0070713_100062147
189 Ga0070710_10016023
190 Ga0070711_100091577
191 Ga0070708_100047225
192 Ga0070708_100265897
193 Ga0070708_100281254
194 Ga0070706_100004788
195 Ga0070706_100512573
196 Ga0070707_100051161
197 Ga0070707_100758085
198 Ga0070698_100055458
199 Ga0070698_100064505
200 Ga0070698_100221641
201 Ga0070698_100299234
202 Ga0070697_100100520
203 Ga0070686_100010549
204 Ga0070695_100202739
205 Ga0070665_100005292
206 Ga0070665_100387571
207 Ga0070704_100484729
208 Ga0068855_100129988
209 Ga0068857_100215144
210 Ga0068863_100005369
211 Ga0068858_100086961
212 Ga0075363_100036313
213 Ga0075363_100392105
214 Ga0075364_10002822
215 Ga0070712_100024113
216 Ga0075369_10054796
217 Ga0075370_10021824
218 Ga0075436_100209572
219 Ga0075435_100433528
220 Ga0099794_10124138
221 Ga0099795_10008897
222 Ga0105251_10104309
223 Ga0105244_10059208
224 Ga0105250_10075916
225 Ga0105247_10438453
226 Ga0114129_11120437
227 Ga0105248_10000004
228 Ga0105248_10003360
229 Ga0105248_10928073
230 Ga0105237_10003479
231 Ga0105238_10326140
232 Ga0105238_10606437
233 Ga0099796_10073526
234 Ga0099796_10104384
235 Ga0105239_10081345
236 Ga0105246_10009180
237 Ga0157372_11055572
238 Ga0163163_10031325
239 Ga0228598_1000054
240 Ga0207696_1030325
241 Ga0207713_1083420
242 Ga0207692_10015254
243 Ga0207647_10218072
244 Ga0207684_10002745
245 Ga0207695_10041279
246 Ga0207671_10015571
247 Ga0207693_10035677
248 Ga0207663_10101543
249 Ga0207652_10001393
250 Ga0207646_10000349
251 Ga0207646_10619278
252 Ga0207687_10404742
253 Ga0207700_10010790
254 Ga0207664_10016417
255 Ga0207644_10028129
256 Ga0207665_10482527
257 Ga0207711_10000008
258 Ga0207711_10000010
259 Ga0207711_10003811
260 Ga0207711_10918876
261 Ga0207658_10008085
262 Ga0207703_10111628
263 Ga0207678_10414985
264 Ga0207641_10004533
265 Ga0265354_1000183
266 Ga0265356_1015995
267 Ga0268264_10071120
268 Ga0265338_10008617
269 Ga0265338_10137763
270 Ga0265338_10307062
271 Ga0265770_1000266
272 Ga0265765_1000033
273 Ga0265771_1000381
274 Ga0265760_10003342
275 Ga0265760_10023138
276 Ga0265325_10004316
277 Ga0265325_10112217
278 Ga0265340_10045763
279 Ga0265340_10115249
280 Ga0265339_10010097
281 Ga0265339_10044499
282 Ga0265331_10016279
283 Ga0265316_10027274
284 Ga0265316_10030559
285 Ga0265316_10078107
286 Ga0265314_10025877
287 Ga0265342_10133735
288 Ga0307415_100499911
289 Ga0265778_010001
290 Ga0395898_0340073
291 Ga0395901_0451310
292 Ga0395901_0731946
293 Ga0466969_0028790
294 Ga0466972_0022377
295 Ga0466972_0100471
296 Ga0466970_0004052
297 Ga0466960_0079172
298 Ga0466960_0233339
299 Ga0466958_0168322
300 Ga0495603_0064994
301 Ga0495629_0097010
302 Ga0495662_0087150
303 Ga0495664_0053829
304 Ga0495628_0262125
305 Ga0495648_0007365
306 Ga0495663_0019146
307 Ga0495652_0100324
308 Ga0495640_0007283
309 Ga0495668_0055325
310 Ga0495657_0127580
311 Ga0495657_0326530
312 Ga0495613_0007894
313 Ga0495613_0009685
314 Ga0495600_0263673
315 Ga0495581_0036253
316 Ga0495604_0042859
317 Ga0495674_0155749
318 Ga0495672_0001136
319 Ga0495676_0017992
320 Ga0495675_0147528
321 Ga0495673_0000714
322 Ga0495614_0048065
323 Ga0496102_0014719
324 Ga0496103_0051924
325 Ga0496104_0009716
326 Ga0496105_0019676
327 Ga0496108_0208409
328 Ga0496109_0077388
329 Ga0496110_0718857
330 Ga0496111_0011294
331 Ga0496112_0143789
332 Ga0496115_0314486
333 Ga0501047_0170435
334 nmdc:mga03n38_53135_c1
335 nmdc:mga03n38_59461_c1
336 nmdc:mga00v17_36091_c1
337 nmdc:mga07m45_81620_c1
338 nmdc:mga05p37_589086_c1
339 nmdc:mga0n895_441431_c1
340 nmdc:mga08x19_231378_c1
341 nmdc:mga0sz30_5556_c1
342 2552105706
343 2616703072
344 2902802386
345 2919714238
346 3003002572

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6n5z-assembly1.cif.gz_B crystal structure of the snx5 px domain in complex with the sema4c 0.69 131 171
8esf-assembly1.cif.gz_A crystal structure of human nischarin px and lrr domains with engineered mutations 0.6654 130 171
5tp1-assembly2.cif.gz_B the structure of the c-terminus of virulence protein ince from chlamydia trachomatis bound to mus musculus snx5-px domain 0.6558 131 171
3bk5-assembly1.cif.gz_A crystal structure of putative outer membrane lipoprotein-sorting protein domain from vibrio parahaemolyticus 0.6364 3 237
2l33-assembly1.cif.gz_A solution nmr structure of drbm 2 domain of interleukin enhancer-binding factor 3 from homo sapiens, northeast structural genomics consortium target hr4527e 0.635 131 174
ID Description Score Start End Superfamily
af_O33271_1_245_3.40.605.10 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 0.9626 1 237 3.40.605.10
af_O33271_1_245_3.40.605.10 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 0.9587 1 237 3.40.605.10
af_A0A1D8PDU5_148_320_3.30.1520.10 Alpha Beta;2-Layer Sandwich;PX Domain;Phox-like domain 0.8112 135 169 3.30.1520.10
af_Q55A08_605_716_3.30.1520.10 Alpha Beta;2-Layer Sandwich;PX Domain;Phox-like domain 0.7608 132 173 3.30.1520.10
3p0cB00 Alpha Beta;2-Layer Sandwich;PX Domain;Phox-like domain 0.7599 133 171 3.30.1520.10
ID Description Score Start End GO Terms
AF-A0A2L2N492-F1-model_v4 Uncharacterized protein 0.9953 1 237
AF-A0A2L2N492-F1-model_v4 Uncharacterized protein 0.9911 1 237
AF-A0A7W7ZDU5-F1-model_v4 Uncharacterized protein 0.9896 1 237
AF-A0A7W7ZDU5-F1-model_v4 Uncharacterized protein 0.9855 1 237
AF-A0A2M9C9A0-F1-model_v4 Uncharacterized protein 0.9844 1 237

Map