F263388

General Info

Members Datasets Scaffolds Average Seq Length
173 123 171 437

Family's Representative Sequence

Representative Sequence 3300049573|Ga0501037_0010796|Ga0501037_0010796_1298_2701
Length 467
Sequence MARRAPFRQRLSRQAARVAGKALVIRAIAVILMSIALATQASSALSKTPIERVVTPKGIEIWLVRTMEFPMLSLQFSFLGGAAQDPAGKPGIASLAASLLDEGAGEYDARAFREQLEGNAIEISFTANRDSVRGSLKTLTDNQDKAFELLRLALTAPRFDASEIERVRSAVLANLRRASTNPGEIAKNTWYARAFPNHPYGRPVAGTLDSVPNITVEDLRGYIARNLARSNLKVAAVGAIDAATLAKLVDRAFEGLPEKADLMPVADVVPQSLGEREVIPLHVPQTVILYGGAGLKRNDPDFIPAYVLNHILGGGSFDSRLFEEVRVKRGLSYSVSSTLAALKHAGFFIGSVQTKNDRAYESVDVINSEIARLAKDGPSTEELEKAKKYLIGSYPLRFDTSAKIATNLLDMQFEELGIDYIDRRNAMVAAVTAADVRRAANRFLAGAKMLTVMVGEPVAAPAKAADQ

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
50 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
51 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
71 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
72 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
73 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
74 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
75 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
76 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
77 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
78 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
79 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
80 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
81 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
82 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
83 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
84 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
85 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
86 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
87 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
88 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
89 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
90 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
91 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
92 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
93 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
104 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
105 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
106 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
107 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
108 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
109 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
110 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
111 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
114 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
115 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
116 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
117 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
118 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
119 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
120 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
121 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
122 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
123 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.51
Nodule 0
Rhizoplane 3.47
Rhizosphere 85.55
Stem 0
Stem Tuber 0
Unclassified 3.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10067804 3300005290 Bacteria 31846
2 Ga0065715_10000553 3300005293 Bacteria 15415
3 Ga0065707_10001180 3300005295 Bacteria 17230
4 Ga0070690_100000111 3300005330 Bacteria 42445
5 Ga0070680_100012305 3300005336 Bacteria 6645
6 Ga0070680_100101211 3300005336 Bacteria 2392
7 Ga0070682_100006853 3300005337 Bacteria 6398
8 Ga0070660_100058553 3300005339 Unclassified 2986
9 Ga0070660_100110748 3300005339 Bacteria 2184
10 Ga0070689_100000055 3300005340 Bacteria 69984
11 Ga0070668_100041080 3300005347 Unclassified 3543
12 Ga0070675_100177088 3300005354 Bacteria 1842
13 Ga0070688_100000032 3300005365 Bacteria 64105
14 Ga0070701_10000034 3300005438 Bacteria 34615
15 Ga0070705_100053004 3300005440 Bacteria 2372
16 Ga0070700_100004457 3300005441 Bacteria 7314
17 Ga0070700_100206593 3300005441 Unclassified 1383
18 Ga0070694_100084186 3300005444 Bacteria 2218
19 Ga0070694_100127521 3300005444 Bacteria 1834
20 Ga0070663_100021775 3300005455 Bacteria 4270
21 Ga0070681_10003447 3300005458 Bacteria 14810
22 Ga0070681_10033069 3300005458 Bacteria 5191
23 Ga0070681_10053421 3300005458 Bacteria 4026
24 Ga0068867_100005668 3300005459 Bacteria 8846
25 Ga0070685_10000171 3300005466 Bacteria 42912
26 Ga0070707_100192852 3300005468 Bacteria 1987
27 Ga0070698_100257791 3300005471 Bacteria 1676
28 Ga0070679_100007695 3300005530 Bacteria 10088
29 Ga0070679_100041912 3300005530 Bacteria 4557
30 Ga0070697_100004851 3300005536 Bacteria 10315
31 Ga0068853_100006257 3300005539 Bacteria 9437
32 Ga0070686_100000068 3300005544 Bacteria 78188
33 Ga0070695_100028955 3300005545 Bacteria 3439
34 Ga0070695_100038054 3300005545 Bacteria 3034
35 Ga0070695_100039634 3300005545 Bacteria 2979
36 Ga0070696_100022545 3300005546 Bacteria 4279
37 Ga0070696_100036442 3300005546 Bacteria 3391
38 Ga0070696_100038862 3300005546 Bacteria 3286
39 Ga0070704_100013665 3300005549 Bacteria 5049
40 Ga0068855_100013642 3300005563 Bacteria 9800
41 Ga0070702_100014638 3300005615 Bacteria 3984
42 Ga0068859_100000818 3300005617 Bacteria 31683
43 Ga0068864_100120679 3300005618 Bacteria 2344
44 Ga0081538_10000859 3300005981 Bacteria 32758
45 Ga0081538_10007450 3300005981 Bacteria 9469
46 Ga0081538_10015232 3300005981 Bacteria 5965
47 Ga0097621_100039391 3300006237 Bacteria 3796
48 Ga0075430_100065491 3300006846 Bacteria 3053
49 Ga0075433_10017643 3300006852 Bacteria 5919
50 Ga0075433_10023803 3300006852 Bacteria 5159
51 Ga0075434_100003499 3300006871 Bacteria 14041
52 Ga0075434_100052453 3300006871 Bacteria 4052
53 Ga0075436_100011368 3300006914 Bacteria 6111
54 Ga0097620_100000818 3300006931 Bacteria 31683
55 Ga0075435_100012456 3300007076 Bacteria 6299
56 Ga0075435_100044741 3300007076 Bacteria 3547
57 Ga0105240_10029643 3300009093 Bacteria 7124
58 Ga0105240_10177278 3300009093 Bacteria 2519
59 Ga0114129_10014336 3300009147 Bacteria 11297
60 Ga0105241_10014719 3300009174 Bacteria 5725
61 Ga0105248_10000344 3300009177 Bacteria 54472
62 Ga0105249_10007334 3300009553 Bacteria 9613
63 Ga0157374_10362528 3300013296 Bacteria 1441
64 Ga0157378_10004400 3300013297 Bacteria 12402
65 Ga0157372_10007097 3300013307 Bacteria 11941
66 Ga0157380_10012039 3300014326 Bacteria 6261
67 Ga0157380_10060857 3300014326 Bacteria 3019
68 Ga0157376_10029083 3300014969 Bacteria 4400
69 Ga0207697_10024141 3300025315 Unclassified 2490
70 Ga0207654_10026410 3300025911 Bacteria 3144
71 Ga0207707_10006150 3300025912 Bacteria 10489
72 Ga0207707_10060906 3300025912 Bacteria 3283
73 Ga0207695_10031024 3300025913 Bacteria 5873
74 Ga0207693_10193253 3300025915 Bacteria 1601
75 Ga0207660_10015914 3300025917 Bacteria 4972
76 Ga0207662_10115420 3300025918 Unclassified 1678
77 Ga0207657_10116007 3300025919 Bacteria 2207
78 Ga0207652_10047717 3300025921 Bacteria 3658
79 Ga0207652_10207323 3300025921 Bacteria 1764
80 Ga0207706_10160647 3300025933 Bacteria 1975
81 Ga0207686_10010097 3300025934 Bacteria 5135
82 Ga0207670_10002552 3300025936 Bacteria 9558
83 Ga0207711_10000430 3300025941 Bacteria 43883
84 Ga0207667_10031296 3300025949 Bacteria 5744
85 Ga0207668_10096343 3300025972 Bacteria 2187
86 Ga0207668_10106034 3300025972 Bacteria 2099
87 Ga0207639_10016915 3300026041 Bacteria 5167
88 Ga0207678_10021895 3300026067 Bacteria 5604
89 Ga0207708_10000167 3300026075 Bacteria 51837
90 Ga0207648_10023869 3300026089 Bacteria 5468
91 Ga0307408_100007377 3300031548 Bacteria 7278
92 Ga0316578_10077502 3300031728 Bacteria 1974
93 Ga0373927_0019790 3300035695 Bacteria 4414
94 Ga0373933_0048081 3300035724 Bacteria 2539
95 Ga0373937_0012652 3300036401 Bacteria 7426
96 Ga0316584_0026500 3300036712 Bacteria 4261
97 Ga0373925_0011495 3300037068 Bacteria 6406
98 Ga0395898_0031938 3300037466 Bacteria 5258
99 Ga0400483_051614 3300039062 Bacteria 3327
100 Ga0400483_073608 3300039062 Bacteria 20166
101 Ga0400483_127040 3300039062 Bacteria 4760
102 Ga0400483_177469 3300039062 Bacteria 5034
103 Ga0400483_249537 3300039062 Bacteria 8145
104 Ga0436360_1243178 3300039438 Bacteria 1872
105 Ga0436360_1332884 3300039438 Bacteria 2351
106 Ga0436361_0746557 3300039447 Bacteria 2453
107 Ga0436361_0878640 3300039447 Bacteria 5939
108 Ga0495580_0023829 3300046472 Bacteria 4489
109 Ga0495580_0034141 3300046472 Bacteria 3662
110 Ga0495582_0035856 3300046473 Bacteria 2729
111 Ga0495657_0001246 3300046675 Bacteria 22219
112 Ga0495658_0068088 3300046683 Bacteria 2060
113 Ga0495604_0154826 3300047317 Bacteria 1625
114 Ga0495680_0015830 3300047322 Bacteria 6493
115 Ga0496104_0139784 3300048907 Bacteria 2327
116 Ga0496104_0155966 3300048907 Bacteria 2191
117 Ga0496106_0133000 3300048909 Bacteria 1952
118 Ga0496108_0251295 3300048911 Bacteria 1538
119 Ga0496112_0217779 3300048915 Bacteria 1866
120 Ga0496115_0135397 3300048918 Bacteria 2031
121 Ga0496126_0124542 3300048929 Bacteria 2232
122 Ga0501031_0075578 3300049568 Bacteria 2193
123 Ga0501034_0057599 3300049571 Bacteria 3906
124 Ga0501036_0015983 3300049572 Bacteria 6269
125 Ga0501036_0067442 3300049572 Bacteria 3027
126 Ga0501037_0010796 3300049573 Bacteria 6713
127 Ga0501038_0012932 3300049574 Bacteria 7614
128 Ga0501038_0028901 3300049574 Bacteria 4920
129 Ga0501039_0002412 3300049575 Bacteria 13907
130 Ga0501039_0039898 3300049575 Bacteria 3625
131 Ga0501040_0016417 3300049576 Bacteria 4901
132 Ga0501040_0107385 3300049576 Unclassified 1951
133 Ga0501046_0000011 3300049580 Bacteria 326457
134 Ga0501047_0009569 3300049581 Bacteria 9158
135 Ga0501047_0061847 3300049581 Bacteria 3612
136 Ga0501048_0007603 3300049582 Bacteria 8216
137 Ga0501068_0039734 3300049584 Bacteria 2822
138 Ga0501072_0019325 3300049588 Bacteria 5264
139 Ga0501073_0033224 3300049589 Bacteria 3674
140 Ga0501075_0012207 3300049591 Bacteria 6098
141 Ga0501076_0288082 3300049592 Bacteria 1346
142 Ga0501077_0015281 3300049593 Bacteria 4831
143 Ga0501077_0221435 3300049593 Bacteria 1203
144 Ga0501080_0014767 3300049742 Bacteria 7193
145 Ga0501081_0051838 3300049743 Unclassified 2830
146 Ga0501035_0056052 3300049822 Bacteria 3518
147 Ga0501044_0073067 3300049823 Bacteria 3486
148 Ga0501045_0038203 3300049824 Bacteria 3491
149 nmdc:mga0n895_183609_c1 3300050512 Unclassified 2123
150 nmdc:mga0n895_4146_c1 3300050512 Bacteria 11825
151 nmdc:mga0n895_53220_c1 3300050512 Bacteria 3977
152 nmdc:mga0rr50_11115_c1 3300050513 Bacteria 5745
153 nmdc:mga0rr50_3153_c1 3300050513 Bacteria 9424
154 nmdc:mga0rr50_72643_c1 3300050513 Bacteria 2628
155 nmdc:mga08x19_22_c1 3300050514 Bacteria 297462
156 nmdc:mga08x19_23040_c1 3300050514 Bacteria 3861
157 nmdc:mga0a205_8430_c1 3300050515 Bacteria 6397
158 Ga0495601_0047876 3300053077 Bacteria 2692
159 Ga0495612_0013334 3300053078 Bacteria 3311
160 Ga0500556_0000083 3300053104 Bacteria 89577
161 Ga0500556_0000166 3300053104 Bacteria 53987
162 Ga0500556_0000269 3300053104 Bacteria 41014
163 Ga0500556_0000581 3300053104 Bacteria 24102
164 Ga0500556_0000816 3300053104 Bacteria 18054
165 Ga0500556_0001475 3300053104 Bacteria 9839
166 Ga0500556_0001622 3300053104 Bacteria 8842
167 Ga0500556_0002196 3300053104 Bacteria 6549
168 Ga0500556_0002478 3300053104 Bacteria 5899
169 Ga0500562_002712 3300053108 Bacteria 4403
170 Ga0500645_031034 3300053730 Unclassified 1607
171 Ga0530510_0014078 3300061734 Bacteria 5639

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049822 Ga0501035_0056052 Ga0501035_0056052_21_1112 363
2 3300049593 Ga0501077_0221435 Ga0501077_0221435_47_1141 364
3 3300048918 Ga0496115_0135397 Ga0496115_0135397_19_1173 383
4 3300053104 Ga0500556_0000581 Ga0500556_0000581_21701_22975 391
5 3300053104 Ga0500556_0002478 Ga0500556_0002478_3369_4652 396
6 3300053104 Ga0500556_0000816 Ga0500556_0000816_14332_15615 402
7 3300005444 Ga0070694_100084186 Ga0070694_1000841862 403
8 3300005546 Ga0070696_100022545 Ga0070696_1000225454 403
9 3300005618 Ga0068864_100120679 Ga0068864_1001206792 403
10 3300046472 Ga0495580_0034141 Ga0495580_0034141_1349_2692 404
11 3300053104 Ga0500556_0002196 Ga0500556_0002196_3135_4418 404
12 3300025918 Ga0207662_10115420 Ga0207662_101154202 405
13 3300049568 Ga0501031_0075578 Ga0501031_0075578_349_1659 410
14 3300049571 Ga0501034_0057599 Ga0501034_0057599_58_1368 410
15 3300049572 Ga0501036_0067442 Ga0501036_0067442_843_2153 410
16 3300049574 Ga0501038_0028901 Ga0501038_0028901_1536_2846 410
17 3300049575 Ga0501039_0039898 Ga0501039_0039898_1357_2667 410
18 3300049576 Ga0501040_0107385 Ga0501040_0107385_676_1908 410
19 3300049581 Ga0501047_0009569 Ga0501047_0009569_1812_3122 410
20 3300049589 Ga0501073_0033224 Ga0501073_0033224_1607_2917 410
21 3300005981 Ga0081538_10000859 Ga0081538_100008597 412
22 3300048915 Ga0496112_0217779 Ga0496112_0217779_398_1636 412
23 3300005339 Ga0070660_100110748 Ga0070660_1001107481 413
24 3300009093 Ga0105240_10029643 Ga0105240_100296434 413
25 3300009093 Ga0105240_10177278 Ga0105240_101772782 413
26 3300025913 Ga0207695_10031024 Ga0207695_100310243 413
27 3300025915 Ga0207693_10193253 Ga0207693_101932532 413
28 3300025919 Ga0207657_10116007 Ga0207657_101160072 413
29 3300039438 Ga0436360_1243178 Ga0436360_1243178_13_1296 413
30 3300039438 Ga0436360_1332884 Ga0436360_1332884_390_1673 413
31 3300039447 Ga0436361_0746557 Ga0436361_0746557_816_2099 413
32 3300039447 Ga0436361_0878640 Ga0436361_0878640_1697_2980 413
33 3300048907 Ga0496104_0139784 Ga0496104_0139784_195_1490 413
34 3300048911 Ga0496108_0251295 Ga0496108_0251295_73_1374 413
35 3300048929 Ga0496126_0124542 Ga0496126_0124542_32_1315 413
36 3300031728 Ga0316578_10077502 Ga0316578_100775022 414
37 3300036712 Ga0316584_0026500 Ga0316584_0026500_2566_3897 414
38 3300039062 Ga0400483_051614 Ga0400483_051614_1656_2984 414
39 3300039062 Ga0400483_073608 Ga0400483_073608_15237_16565 414
40 3300039062 Ga0400483_127040 Ga0400483_127040_2049_3377 414
41 3300039062 Ga0400483_177469 Ga0400483_177469_806_2134 414
42 3300039062 Ga0400483_249537 Ga0400483_249537_2146_3474 414
43 3300049572 Ga0501036_0015983 Ga0501036_0015983_698_1987 414
44 3300049574 Ga0501038_0012932 Ga0501038_0012932_5893_7182 414
45 3300049575 Ga0501039_0002412 Ga0501039_0002412_7572_8861 414
46 3300049576 Ga0501040_0016417 Ga0501040_0016417_2632_3921 414
47 3300049582 Ga0501048_0007603 Ga0501048_0007603_5509_6798 414
48 3300049588 Ga0501072_0019325 Ga0501072_0019325_2750_4081 414
49 3300049591 Ga0501075_0012207 Ga0501075_0012207_3117_4406 414
50 3300049592 Ga0501076_0288082 Ga0501076_0288082_30_1319 414
51 3300049824 Ga0501045_0038203 Ga0501045_0038203_1077_2366 414
52 3300061734 Ga0530510_0014078 Ga0530510_0014078_1153_2484 414
53 3300005981 Ga0081538_10007450 Ga0081538_100074505 415
54 3300005981 Ga0081538_10015232 Ga0081538_100152325 415
55 3300005290 Ga0065712_10067804 Ga0065712_1006780413 416
56 3300005293 Ga0065715_10000553 Ga0065715_1000055315 416
57 3300005295 Ga0065707_10001180 Ga0065707_100011802 416
58 3300005330 Ga0070690_100000111 Ga0070690_1000001117 416
59 3300005336 Ga0070680_100012305 Ga0070680_1000123052 416
60 3300005336 Ga0070680_100101211 Ga0070680_1001012111 416
61 3300005337 Ga0070682_100006853 Ga0070682_1000068535 416
62 3300005339 Ga0070660_100058553 Ga0070660_1000585532 416
63 3300005340 Ga0070689_100000055 Ga0070689_10000005534 416
64 3300005347 Ga0070668_100041080 Ga0070668_1000410802 416
65 3300005354 Ga0070675_100177088 Ga0070675_1001770881 416
66 3300005365 Ga0070688_100000032 Ga0070688_10000003221 416
67 3300005438 Ga0070701_10000034 Ga0070701_100000346 416
68 3300005440 Ga0070705_100053004 Ga0070705_1000530042 416
69 3300005441 Ga0070700_100004457 Ga0070700_1000044577 416
70 3300005441 Ga0070700_100206593 Ga0070700_1002065931 416
71 3300005444 Ga0070694_100127521 Ga0070694_1001275212 416
72 3300005455 Ga0070663_100021775 Ga0070663_1000217754 416
73 3300005458 Ga0070681_10003447 Ga0070681_100034477 416
74 3300005458 Ga0070681_10033069 Ga0070681_100330692 416
75 3300005458 Ga0070681_10053421 Ga0070681_100534212 416
76 3300005459 Ga0068867_100005668 Ga0068867_1000056687 416
77 3300005466 Ga0070685_10000171 Ga0070685_1000017136 416
78 3300005468 Ga0070707_100192852 Ga0070707_1001928522 416
79 3300005471 Ga0070698_100257791 Ga0070698_1002577911 416
80 3300005530 Ga0070679_100007695 Ga0070679_1000076955 416
81 3300005530 Ga0070679_100041912 Ga0070679_1000419124 416
82 3300005536 Ga0070697_100004851 Ga0070697_1000048515 416
83 3300005539 Ga0068853_100006257 Ga0068853_1000062575 416
84 3300005544 Ga0070686_100000068 Ga0070686_10000006838 416
85 3300005545 Ga0070695_100028955 Ga0070695_1000289552 416
86 3300005545 Ga0070695_100038054 Ga0070695_1000380542 416
87 3300005545 Ga0070695_100039634 Ga0070695_1000396342 416
88 3300005546 Ga0070696_100036442 Ga0070696_1000364422 416
89 3300005546 Ga0070696_100038862 Ga0070696_1000388622 416
90 3300005549 Ga0070704_100013665 Ga0070704_1000136654 416
91 3300005563 Ga0068855_100013642 Ga0068855_1000136425 416
92 3300005615 Ga0070702_100014638 Ga0070702_1000146383 416
93 3300005617 Ga0068859_100000818 Ga0068859_10000081826 416
94 3300006237 Ga0097621_100039391 Ga0097621_1000393912 416
95 3300006846 Ga0075430_100065491 Ga0075430_1000654912 416
96 3300006852 Ga0075433_10017643 Ga0075433_100176436 416
97 3300006852 Ga0075433_10023803 Ga0075433_100238034 416
98 3300006871 Ga0075434_100003499 Ga0075434_10000349910 416
99 3300006871 Ga0075434_100052453 Ga0075434_1000524533 416
100 3300006914 Ga0075436_100011368 Ga0075436_1000113685 416
101 3300006931 Ga0097620_100000818 Ga0097620_1000008188 416
102 3300007076 Ga0075435_100012456 Ga0075435_1000124565 416
103 3300007076 Ga0075435_100044741 Ga0075435_1000447413 416
104 3300009147 Ga0114129_10014336 Ga0114129_1001433610 416
105 3300009174 Ga0105241_10014719 Ga0105241_100147192 416
106 3300009177 Ga0105248_10000344 Ga0105248_1000034414 416
107 3300009553 Ga0105249_10007334 Ga0105249_100073348 416
108 3300013296 Ga0157374_10362528 Ga0157374_103625282 416
109 3300013297 Ga0157378_10004400 Ga0157378_100044003 416
110 3300013307 Ga0157372_10007097 Ga0157372_100070975 416
111 3300014326 Ga0157380_10012039 Ga0157380_100120392 416
112 3300014326 Ga0157380_10060857 Ga0157380_100608573 416
113 3300014969 Ga0157376_10029083 Ga0157376_100290833 416
114 3300025315 Ga0207697_10024141 Ga0207697_100241412 416
115 3300025911 Ga0207654_10026410 Ga0207654_100264102 416
116 3300025912 Ga0207707_10006150 Ga0207707_100061505 416
117 3300025912 Ga0207707_10060906 Ga0207707_100609062 416
118 3300025917 Ga0207660_10015914 Ga0207660_100159142 416
119 3300025921 Ga0207652_10047717 Ga0207652_100477172 416
120 3300025921 Ga0207652_10207323 Ga0207652_102073231 416
121 3300025933 Ga0207706_10160647 Ga0207706_101606472 416
122 3300025934 Ga0207686_10010097 Ga0207686_100100975 416
123 3300025936 Ga0207670_10002552 Ga0207670_100025525 416
124 3300025941 Ga0207711_10000430 Ga0207711_100004304 416
125 3300025949 Ga0207667_10031296 Ga0207667_100312968 416
126 3300025972 Ga0207668_10096343 Ga0207668_100963432 416
127 3300025972 Ga0207668_10106034 Ga0207668_101060342 416
128 3300026041 Ga0207639_10016915 Ga0207639_100169154 416
129 3300026067 Ga0207678_10021895 Ga0207678_100218955 416
130 3300026075 Ga0207708_10000167 Ga0207708_100001673 416
131 3300026089 Ga0207648_10023869 Ga0207648_100238694 416
132 3300031548 Ga0307408_100007377 Ga0307408_1000073776 416
133 3300035695 Ga0373927_0019790 Ga0373927_0019790_190_1458 416
134 3300035724 Ga0373933_0048081 Ga0373933_0048081_1036_2412 416
135 3300036401 Ga0373937_0012652 Ga0373937_0012652_4790_6109 416
136 3300037068 Ga0373925_0011495 Ga0373925_0011495_2774_4096 416
137 3300037466 Ga0395898_0031938 Ga0395898_0031938_3263_4603 416
138 3300046472 Ga0495580_0023829 Ga0495580_0023829_1628_2950 416
139 3300046473 Ga0495582_0035856 Ga0495582_0035856_260_1603 416
140 3300046675 Ga0495657_0001246 Ga0495657_0001246_8156_9463 416
141 3300046683 Ga0495658_0068088 Ga0495658_0068088_503_1771 416
142 3300047317 Ga0495604_0154826 Ga0495604_0154826_103_1479 416
143 3300047322 Ga0495680_0015830 Ga0495680_0015830_932_2239 416
144 3300048907 Ga0496104_0155966 Ga0496104_0155966_709_2085 416
145 3300048909 Ga0496106_0133000 Ga0496106_0133000_210_1586 416
146 3300049573 Ga0501037_0010796 Ga0501037_0010796_1298_2701 416
147 3300049580 Ga0501046_0000011 Ga0501046_0000011_90682_92085 416
148 3300049581 Ga0501047_0061847 Ga0501047_0061847_545_1852 416
149 3300049584 Ga0501068_0039734 Ga0501068_0039734_941_2248 416
150 3300049593 Ga0501077_0015281 Ga0501077_0015281_1192_2565 416
151 3300049742 Ga0501080_0014767 Ga0501080_0014767_1850_3157 416
152 3300049743 Ga0501081_0051838 Ga0501081_0051838_699_2021 416
153 3300049823 Ga0501044_0073067 Ga0501044_0073067_814_2121 416
154 3300050512 nmdc:mga0n895_183609_c1 nmdc:mga0n895_183609_c1_14_1303 416
155 3300050512 nmdc:mga0n895_4146_c1 nmdc:mga0n895_4146_c1_348_1670 416
156 3300050512 nmdc:mga0n895_53220_c1 nmdc:mga0n895_53220_c1_1054_2322 416
157 3300050513 nmdc:mga0rr50_11115_c1 nmdc:mga0rr50_11115_c1_871_2199 416
158 3300050513 nmdc:mga0rr50_3153_c1 nmdc:mga0rr50_3153_c1_7398_8720 416
159 3300050513 nmdc:mga0rr50_72643_c1 nmdc:mga0rr50_72643_c1_141_1409 416
160 3300050514 nmdc:mga08x19_22_c1 nmdc:mga08x19_22_c1_140880_142208 416
161 3300050514 nmdc:mga08x19_23040_c1 nmdc:mga08x19_23040_c1_1125_2447 416
162 3300050515 nmdc:mga0a205_8430_c1 nmdc:mga0a205_8430_c1_5005_6273 416
163 3300053077 Ga0495601_0047876 Ga0495601_0047876_643_2019 416
164 3300053078 Ga0495612_0013334 Ga0495612_0013334_1666_3042 416
165 3300053104 Ga0500556_0000083 Ga0500556_0000083_835_2118 416
166 3300053104 Ga0500556_0000166 Ga0500556_0000166_48951_50234 416
167 3300053104 Ga0500556_0000269 Ga0500556_0000269_2328_3707 416
168 3300053104 Ga0500556_0000581 Ga0500556_0000581_12084_13340 416
169 3300053104 Ga0500556_0001475 Ga0500556_0001475_1292_2578 416
170 3300053104 Ga0500556_0001475 Ga0500556_0001475_4427_5710 416
171 3300053104 Ga0500556_0001622 Ga0500556_0001622_7165_8448 416
172 3300053108 Ga0500562_002712 Ga0500562_002712_2636_4015 416
173 3300053730 Ga0500645_031034 Ga0500645_031034_197_1480 416

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00675

Peptidase_M16

Insulinase (Peptidase family M16)

71

208

0.97

PF05193

Peptidase_M16_C

Peptidase M16 inactive domain

213

390

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3gwb-assembly1.cif.gz_B crystal structure of peptidase m16 inactive domain from pseudomonas fluorescens. northeast structural genomics target plr293l 0.959 1 408
3amj-assembly1.cif.gz_B the crystal structure of the heterodimer of m16b peptidase from sphingomonas sp. a1 0.9545 3 408
7v4y-assembly1.cif.gz_B ttha1264/ttha1265 complex 0.9499 3 409
3gwb-assembly1.cif.gz_A crystal structure of peptidase m16 inactive domain from pseudomonas fluorescens. northeast structural genomics target plr293l 0.9492 1 408
5hxk-assembly2.cif.gz_C structure of ttha1265 0.948 1 409
ID Description Score Start End Superfamily
af_A0A1D6G373_49_271_3.30.830.10 Alpha Beta;2-Layer Sandwich;Cytochrome Bc1 Complex; Chain A, domain 1;Metalloenzyme, LuxS/M16 peptidase-like 0.953 3 211 3.30.830.10
af_P9WHT5_241_428_3.30.830.10 Alpha Beta;2-Layer Sandwich;Cytochrome Bc1 Complex; Chain A, domain 1;Metalloenzyme, LuxS/M16 peptidase-like 0.9524 226 409 3.30.830.10
1ntkA01 Alpha Beta;2-Layer Sandwich;Cytochrome Bc1 Complex; Chain A, domain 1;Metalloenzyme, LuxS/M16 peptidase-like 0.9521 4 210 3.30.830.10
3amjC01 Alpha Beta;2-Layer Sandwich;Cytochrome Bc1 Complex; Chain A, domain 1;Metalloenzyme, LuxS/M16 peptidase-like 0.9477 3 217 3.30.830.10
3gwbB01 Alpha Beta;2-Layer Sandwich;Cytochrome Bc1 Complex; Chain A, domain 1;Metalloenzyme, LuxS/M16 peptidase-like 0.9456 4 215 3.30.830.10
ID Description Score Start End GO Terms
AF-A0A7C1X1N5-F1-model_v4 Insulinase family protein 0.9867 2 160 GO:0046872
AF-A0A846FIM1-F1-model_v4 deleted 0.9844 2 188
AF-A0A1F9BG72-F1-model_v4 Peptidase M16 0.979 4 415 GO:0046872
AF-A0A355TSQ5-F1-model_v4 Peptidase M16 N-terminal domain-containing protein 0.9787 3 128 GO:0046872
AF-A0A2V6WKZ6-F1-model_v4 Insulinase family protein 0.974 3 416 GO:0046872

Feature Viewer

pLDDT pTM Quality
95.25 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map