F263323

General Info

Members Datasets Scaffolds Average Seq Length
173 126 346 393

Family's Representative Sequence

Representative Sequence 3300048912|Ga0496109_0050527|Ga0496109_0050527_2433_3761
Length 442
Sequence MLVGDHQGATGSADASPDGRPLPGPDPRPTLSRCLGIPTAEFAGRVWGTAPLLTPAAPGAADFADLFSATAADELISARGLRTPFLRMAKNGSVLATSTFTRSGGVGAGIADQVADDKVLAQLAGGATLVLQALHRTWPPLIRFGGDLARELGHPVQINAYITPPENQGFAAHYDTHDVFVLQVAGSKRWTIHRPVIDDPLPTQTWEHRRAQVAARATEEPLIDTLLRPGDALYLPRGFLHSAVAQGEVSIHLTVGVHPVTAYDLAKELIVAAAADRELRRSLPLGVDVTDPAAMREHVEAAAKRLAVTVGGAGPADVDGVASRVGRQQVGETRPAPLGPLAQLAALRGLGPTTTLWLRPGLXXXXRPTGDRSTLDVIDSTISWPAQAHDALVVAVSGAPFRPVDLPGLDGDEQLVVARRLLREGVVIPTDPSSDVDRAPGD

Samples

Sample ID Description Type Environment
1 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
40 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
49 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
81 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
82 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
83 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
84 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
85 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
86 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
87 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
88 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
89 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
90 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
91 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
92 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
93 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
94 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
95 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
96 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
97 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
98 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
99 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
100 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
101 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
102 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
103 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
104 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
105 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
106 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
107 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
108 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
109 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
110 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
111 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
112 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
113 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
114 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
115 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
116 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
117 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
118 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
119 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
120 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
121 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
122 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
123 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
124 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
125 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
126 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.38
Metatranscriptomes 1.16
Isolates 3.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 15.61
Rhizosphere 79.77
Stem 0
Stem Tuber 0
Unclassified 1.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496109_0050527 3300048912 Bacteria 3786
2 Ga0070658_10033179 3300005327 Bacteria 4153
3 Ga0070683_100050093 3300005329 Bacteria 3865
4 Ga0070683_100050153 3300005329 Bacteria 3863
5 Ga0070683_100063193 3300005329 Bacteria 3443
6 Ga0070666_10050148 3300005335 Bacteria 2807
7 Ga0070692_10009586 3300005345 Bacteria 4371
8 Ga0070668_100019563 3300005347 Bacteria 5096
9 Ga0070668_100062816 3300005347 Bacteria 2878
10 Ga0070675_100063917 3300005354 Bacteria 3043
11 Ga0070671_100027739 3300005355 Bacteria 4662
12 Ga0070671_100046801 3300005355 Bacteria 3597
13 Ga0070659_100051709 3300005366 Bacteria 3230
14 Ga0070667_100014545 3300005367 Bacteria 6503
15 Ga0070709_10047813 3300005434 Bacteria 2666
16 Ga0070714_100000010 3300005435 Bacteria 262871
17 Ga0070710_10016669 3300005437 Bacteria 3743
18 Ga0070711_100005605 3300005439 Bacteria 7516
19 Ga0070705_100007346 3300005440 Bacteria 5422
20 Ga0068867_100173575 3300005459 Bacteria 1709
21 Ga0070685_10146875 3300005466 Bacteria 1490
22 Ga0068853_100063919 3300005539 Bacteria 3189
23 Ga0070665_100006368 3300005548 Bacteria 12036
24 Ga0070665_100060226 3300005548 Bacteria 3805
25 Ga0070665_100275803 3300005548 Bacteria 1683
26 Ga0070704_100038580 3300005549 Bacteria 3273
27 Ga0068855_100011733 3300005563 Bacteria 10592
28 Ga0068855_100040545 3300005563 Bacteria 5526
29 Ga0068855_100061191 3300005563 Bacteria 4400
30 Ga0068855_100300789 3300005563 Bacteria 1777
31 Ga0068856_100015948 3300005614 Bacteria 7263
32 Ga0068856_100060382 3300005614 Bacteria 3745
33 Ga0068856_100114010 3300005614 Bacteria 2702
34 Ga0068856_100262346 3300005614 Bacteria 1743
35 Ga0070702_100044964 3300005615 Bacteria 2495
36 Ga0068852_100006910 3300005616 Bacteria 8253
37 Ga0068866_10048380 3300005718 Bacteria 2150
38 Ga0068861_100017337 3300005719 Bacteria 5110
39 Ga0068863_100019999 3300005841 Bacteria 6403
40 Ga0068863_100033236 3300005841 Bacteria 4914
41 Ga0068858_100038060 3300005842 Bacteria 4462
42 Ga0068860_100000129 3300005843 Bacteria 122623
43 Ga0081455_10022401 3300005937 Bacteria 5905
44 Ga0081540_1002329 3300005983 Bacteria 15548
45 Ga0070717_10049959 3300006028 Bacteria 3435
46 Ga0070717_10108977 3300006028 Bacteria 2360
47 Ga0070716_100032451 3300006173 Bacteria 2848
48 Ga0070712_100004274 3300006175 Bacteria 8793
49 Ga0075433_10021956 3300006852 Bacteria 5355
50 Ga0105240_10094764 3300009093 Bacteria 3640
51 Ga0105240_10326822 3300009093 Bacteria 1746
52 Ga0111539_10054986 3300009094 Bacteria 4733
53 Ga0105245_10208831 3300009098 Bacteria 1878
54 Ga0105245_10220307 3300009098 Bacteria 1831
55 Ga0105245_10272744 3300009098 Bacteria 1650
56 Ga0105245_10284052 3300009098 Bacteria 1619
57 Ga0105247_10017271 3300009101 Bacteria 4330
58 Ga0105241_10115417 3300009174 Bacteria 2155
59 Ga0105242_10015861 3300009176 Bacteria 5854
60 Ga0105238_10122144 3300009551 Bacteria 2584
61 Ga0105249_10008002 3300009553 Bacteria 9211
62 Ga0105249_10318635 3300009553 Bacteria 1565
63 Ga0105239_10024324 3300010375 Bacteria 6672
64 Ga0157369_10034662 3300013105 Bacteria 5537
65 Ga0157372_10034711 3300013307 Bacteria 5548
66 Ga0163163_10073686 3300014325 Bacteria 3405
67 Ga0157379_10042404 3300014968 Bacteria 4063
68 Ga0197907_10329491 3300020069 Bacteria 1276
69 Ga0206353_10108259 3300020082 Bacteria 2544
70 Ga0207653_10030347 3300025885 Unclassified 1744
71 Ga0207688_10004085 3300025901 Bacteria 7954
72 Ga0207680_10006320 3300025903 Bacteria 5718
73 Ga0207699_10067507 3300025906 Bacteria 2174
74 Ga0207705_10228889 3300025909 Bacteria 1413
75 Ga0207695_10109047 3300025913 Bacteria 2751
76 Ga0207671_10057766 3300025914 Bacteria 2876
77 Ga0207693_10002058 3300025915 Bacteria 17569
78 Ga0207694_10143415 3300025924 Bacteria 1921
79 Ga0207687_10007836 3300025927 Bacteria 7003
80 Ga0207687_10198225 3300025927 Bacteria 1567
81 Ga0207664_10000009 3300025929 Bacteria 299246
82 Ga0207644_10018702 3300025931 Bacteria 4690
83 Ga0207690_10040702 3300025932 Bacteria 3040
84 Ga0207665_10003265 3300025939 Bacteria 10862
85 Ga0207661_10023197 3300025944 Bacteria 4687
86 Ga0207667_10037353 3300025949 Bacteria 5192
87 Ga0207667_10202603 3300025949 Bacteria 2035
88 Ga0207712_10068520 3300025961 Bacteria 2543
89 Ga0207668_10042410 3300025972 Bacteria 3081
90 Ga0207640_10043973 3300025981 Bacteria 2858
91 Ga0207658_10045239 3300025986 Bacteria 3208
92 Ga0207677_10014904 3300026023 Bacteria 4554
93 Ga0207639_10006550 3300026041 Bacteria 7919
94 Ga0207708_10011450 3300026075 Bacteria 6608
95 Ga0207702_10085804 3300026078 Bacteria 2744
96 Ga0207641_10001632 3300026088 Bacteria 21867
97 Ga0207675_100027374 3300026118 Bacteria 5309
98 Ga0207698_10004503 3300026142 Bacteria 8502
99 Ga0268266_10000654 3300028379 Bacteria 46877
100 Ga0268266_10149035 3300028379 Bacteria 2107
101 Ga0268264_10000196 3300028381 Bacteria 123687
102 Ga0307411_10043181 3300032005 Bacteria 2883
103 Ga0373928_0007356 3300035084 Bacteria 2124
104 Ga0373940_0004221 3300035088 Bacteria 3021
105 Ga0373939_0015589 3300035114 Unclassified 1991
106 Ga0373931_0004322 3300035691 Bacteria 6481
107 Ga0436364_0439002 3300037853 Bacteria 1473
108 Ga0436364_1267691 3300037853 Bacteria 5730
109 Ga0436365_1317731 3300039437 Bacteria 2627
110 Ga0436361_0506064 3300039447 Bacteria 5849
111 Ga0451791_0293308 3300041451 Bacteria 2059
112 Ga0451793_0838073 3300041452 Bacteria 6314
113 Ga0451797_0939916 3300041453 Bacteria 5029
114 Ga0451841_0464187 3300041498 Bacteria 1913
115 Ga0466969_0018516 3300044656 Bacteria 3627
116 Ga0466972_0099562 3300044658 Bacteria 1376
117 Ga0466966_0004744 3300044684 Bacteria 8946
118 Ga0466961_0013901 3300044693 Bacteria 5157
119 Ga0466961_0025527 3300044693 Bacteria 3800
120 Ga0466961_0029721 3300044693 Bacteria 3511
121 Ga0466963_0001182 3300044694 Bacteria 13717
122 Ga0466963_0032253 3300044694 Bacteria 3391
123 Ga0466963_0119904 3300044694 Bacteria 1809
124 Ga0466963_0222473 3300044694 Bacteria 1322
125 Ga0466971_0002674 3300044719 Bacteria 7527
126 Ga0466971_0070092 3300044719 Bacteria 1592
127 Ga0466970_0024151 3300044765 Bacteria 3178
128 Ga0466970_0077129 3300044765 Bacteria 1796
129 Ga0466959_0031122 3300045049 Bacteria 3949
130 Ga0466959_0047389 3300045049 Bacteria 3161
131 Ga0466958_0003684 3300045836 Bacteria 7999
132 Ga0466967_0001433 3300045976 Bacteria 13837
133 Ga0466967_0002058 3300045976 Bacteria 12291
134 Ga0466967_0014186 3300045976 Bacteria 6195
135 Ga0466967_0016289 3300045976 Bacteria 5857
136 Ga0466967_0144309 3300045976 Bacteria 2219
137 Ga0466967_0236412 3300045976 Bacteria 1741
138 Ga0496100_0112644 3300048903 Bacteria 1893
139 Ga0496101_0064056 3300048904 Bacteria 2677
140 Ga0496102_0035059 3300048905 Bacteria 4516
141 Ga0496102_0038657 3300048905 Bacteria 4308
142 Ga0496102_0284619 3300048905 Bacteria 1558
143 Ga0496103_0021716 3300048906 Bacteria 3863
144 Ga0496103_0078221 3300048906 Bacteria 2077
145 Ga0496104_0004858 3300048907 Bacteria 11710
146 Ga0496104_0008203 3300048907 Bacteria 9274
147 Ga0496104_0181211 3300048907 Bacteria 2017
148 Ga0496105_0135133 3300048908 Bacteria 2032
149 Ga0496109_0005990 3300048912 Bacteria 10214
150 Ga0496109_0102468 3300048912 Bacteria 2656
151 Ga0496110_0010336 3300048913 Bacteria 7586
152 Ga0496110_0021350 3300048913 Bacteria 5479
153 Ga0496111_0011388 3300048914 Bacteria 5989
154 Ga0496112_0050826 3300048915 Bacteria 4065
155 Ga0496113_0036589 3300048916 Bacteria 3597
156 Ga0496113_0135275 3300048916 Bacteria 1936
157 Ga0496114_0036667 3300048917 Bacteria 4054
158 Ga0496114_0116103 3300048917 Bacteria 2297
159 Ga0496114_0148015 3300048917 Bacteria 2036
160 Ga0496115_0199167 3300048918 Bacteria 1654
161 Ga0496119_0000217 3300048922 Bacteria 82068
162 Ga0496120_0014124 3300048923 Bacteria 5333
163 Ga0501044_0047916 3300049823 Bacteria 4419
164 nmdc:mga08y16_26733_c1 3300050511 Bacteria 6080
165 nmdc:mga0n895_19423_c1 3300050512 Bacteria 6317
166 nmdc:mga0a205_27871_c1 3300050515 Bacteria 5397
167 Ga0501084_0028667 3300054114 Bacteria 4655
168 2904770481 2904765812 Bacteria 5369154
169 2904771561 2904770941 Bacteria 5580202
170 2908812352 2908811453 Bacteria 5478616
171 2919422930 2919420072 Bacteria 5390363
172 2919435538 2919432681 Bacteria 5390474
173 8047710822 8047710418 Bacteria 11023148
174 Ga0496109_0050527
175 Ga0070658_10033179
176 Ga0070683_100050093
177 Ga0070683_100050153
178 Ga0070683_100063193
179 Ga0070666_10050148
180 Ga0070692_10009586
181 Ga0070668_100019563
182 Ga0070668_100062816
183 Ga0070675_100063917
184 Ga0070671_100027739
185 Ga0070671_100046801
186 Ga0070659_100051709
187 Ga0070667_100014545
188 Ga0070709_10047813
189 Ga0070714_100000010
190 Ga0070710_10016669
191 Ga0070711_100005605
192 Ga0070705_100007346
193 Ga0068867_100173575
194 Ga0070685_10146875
195 Ga0068853_100063919
196 Ga0070665_100006368
197 Ga0070665_100060226
198 Ga0070665_100275803
199 Ga0070704_100038580
200 Ga0068855_100011733
201 Ga0068855_100040545
202 Ga0068855_100061191
203 Ga0068855_100300789
204 Ga0068856_100015948
205 Ga0068856_100060382
206 Ga0068856_100114010
207 Ga0068856_100262346
208 Ga0070702_100044964
209 Ga0068852_100006910
210 Ga0068866_10048380
211 Ga0068861_100017337
212 Ga0068863_100019999
213 Ga0068863_100033236
214 Ga0068858_100038060
215 Ga0068860_100000129
216 Ga0081455_10022401
217 Ga0081540_1002329
218 Ga0070717_10049959
219 Ga0070717_10108977
220 Ga0070716_100032451
221 Ga0070712_100004274
222 Ga0075433_10021956
223 Ga0105240_10094764
224 Ga0105240_10326822
225 Ga0111539_10054986
226 Ga0105245_10208831
227 Ga0105245_10220307
228 Ga0105245_10272744
229 Ga0105245_10284052
230 Ga0105247_10017271
231 Ga0105241_10115417
232 Ga0105242_10015861
233 Ga0105238_10122144
234 Ga0105249_10008002
235 Ga0105249_10318635
236 Ga0105239_10024324
237 Ga0157369_10034662
238 Ga0157372_10034711
239 Ga0163163_10073686
240 Ga0157379_10042404
241 Ga0197907_10329491
242 Ga0206353_10108259
243 Ga0207653_10030347
244 Ga0207688_10004085
245 Ga0207680_10006320
246 Ga0207699_10067507
247 Ga0207705_10228889
248 Ga0207695_10109047
249 Ga0207671_10057766
250 Ga0207693_10002058
251 Ga0207694_10143415
252 Ga0207687_10007836
253 Ga0207687_10198225
254 Ga0207664_10000009
255 Ga0207644_10018702
256 Ga0207690_10040702
257 Ga0207665_10003265
258 Ga0207661_10023197
259 Ga0207667_10037353
260 Ga0207667_10202603
261 Ga0207712_10068520
262 Ga0207668_10042410
263 Ga0207640_10043973
264 Ga0207658_10045239
265 Ga0207677_10014904
266 Ga0207639_10006550
267 Ga0207708_10011450
268 Ga0207702_10085804
269 Ga0207641_10001632
270 Ga0207675_100027374
271 Ga0207698_10004503
272 Ga0268266_10000654
273 Ga0268266_10149035
274 Ga0268264_10000196
275 Ga0307411_10043181
276 Ga0373928_0007356
277 Ga0373940_0004221
278 Ga0373939_0015589
279 Ga0373931_0004322
280 Ga0436364_0439002
281 Ga0436364_1267691
282 Ga0436365_1317731
283 Ga0436361_0506064
284 Ga0451791_0293308
285 Ga0451793_0838073
286 Ga0451797_0939916
287 Ga0451841_0464187
288 Ga0466969_0018516
289 Ga0466972_0099562
290 Ga0466966_0004744
291 Ga0466961_0013901
292 Ga0466961_0025527
293 Ga0466961_0029721
294 Ga0466963_0001182
295 Ga0466963_0032253
296 Ga0466963_0119904
297 Ga0466963_0222473
298 Ga0466971_0002674
299 Ga0466971_0070092
300 Ga0466970_0024151
301 Ga0466970_0077129
302 Ga0466959_0031122
303 Ga0466959_0047389
304 Ga0466958_0003684
305 Ga0466967_0001433
306 Ga0466967_0002058
307 Ga0466967_0014186
308 Ga0466967_0016289
309 Ga0466967_0144309
310 Ga0466967_0236412
311 Ga0496100_0112644
312 Ga0496101_0064056
313 Ga0496102_0035059
314 Ga0496102_0038657
315 Ga0496102_0284619
316 Ga0496103_0021716
317 Ga0496103_0078221
318 Ga0496104_0004858
319 Ga0496104_0008203
320 Ga0496104_0181211
321 Ga0496105_0135133
322 Ga0496109_0005990
323 Ga0496109_0102468
324 Ga0496110_0010336
325 Ga0496110_0021350
326 Ga0496111_0011388
327 Ga0496112_0050826
328 Ga0496113_0036589
329 Ga0496113_0135275
330 Ga0496114_0036667
331 Ga0496114_0116103
332 Ga0496114_0148015
333 Ga0496115_0199167
334 Ga0496119_0000217
335 Ga0496120_0014124
336 Ga0501044_0047916
337 nmdc:mga08y16_26733_c1
338 nmdc:mga0n895_19423_c1
339 nmdc:mga0a205_27871_c1
340 Ga0501084_0028667
341 2904770481
342 2904771561
343 2908812352
344 2919422930
345 2919435538
346 8047710822

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08007

JmjC_2

JmjC domain

143

265

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
4la3-assembly2.cif.gz_B crystal structure of dimethylsulphoniopropionate (dmsp) lyase dddq y131a in complex with dmsp 0.9358 133 233
4fag-assembly1.cif.gz_A crystal structure of the salicylate 1,2-dioxygenase from pseudoaminobacter salicylatoxidans w104y mutant in complex with gentisate 0.9108 133 233
3nst-assembly1.cif.gz_A crystal structure of salicylate 1,2-dioxygenase g106a mutant from pseudoaminobacter salicylatoxidans 0.9016 133 233
2phd-assembly1.cif.gz_C crystal structure determination of a salicylate 1,2-dioxygenase from pseudaminobacter salicylatoxidans 0.9015 133 233
3nw4-assembly1.cif.gz_A crystal structure of salicylate 1,2-dioxygenase g106a mutant from pseudoaminobacter salicylatoxidans in complex with gentisate 0.9011 133 233
ID Description Score Start End Superfamily
3fjsA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.911 133 236 2.60.120.10
3nvcA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9025 133 233 2.60.120.10
af_P17410_9_96_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.899 133 234 2.60.120.10
5fpxA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8882 133 235 2.60.120.10
4e2gD00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8851 133 240 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A1I2E604-F1-model_v4 Cupin superfamily protein 0.966 7 404 GO:0032453
GO:0051864
AF-A0A4R8C7D9-F1-model_v4 Cupin superfamily protein 0.9644 6 404 GO:0032453
GO:0051864
AF-G8RSS5-F1-model_v4 JmjC domain-containing protein 0.9639 8 404 GO:0032453
GO:0051864
AF-A0A1X1WRI7-F1-model_v4 Cupin 0.9638 8 404 GO:0032453
GO:0051864
AF-A0A426R0T6-F1-model_v4 Cupin 0.9634 1 404 GO:0032453
GO:0051864

Map