F263257

General Info

Members Datasets Scaffolds Average Seq Length
173 119 346 216

Family's Representative Sequence

Representative Sequence 3300046675|Ga0495657_0095802|Ga0495657_0095802_1014_1739
Length 241
Sequence MKGIFITFEGTEGSGKSTHVQLLAERLRAEGRIVRVLREPGGTPIGEEIRHTLKHSQTNHAMTPEAELLLMNASRAQLVREVIRPALAAGEIVLCDRFYDSTVAYQGYGRRLDLDVVRAVVEFAVGDTRPDLTLFLSVPIRISEERRLARQQATLLDVPFGNKKPEGCAKLSFSEPLRDRMEEADRDFFERVEQGYKSIAAADPVRVCTIDSTQPLETVRSAVWQRTEQLLAQANRRPTSR

Samples

Sample ID Description Type Environment
1 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
21 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
22 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
23 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
24 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
25 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
27 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
30 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
31 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
32 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
33 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
34 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
35 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
36 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
37 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
38 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
39 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
51 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
52 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
53 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
54 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
55 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
56 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
57 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
58 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
59 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
60 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
61 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
62 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
63 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
64 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
65 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
66 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
67 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
68 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
69 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
70 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
71 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
72 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
73 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
74 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
75 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
76 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
77 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
78 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
79 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
80 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
81 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
82 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
83 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
84 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
85 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
86 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
87 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
88 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
89 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
90 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
91 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
92 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
93 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
94 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
95 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
96 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
97 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
98 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
99 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
100 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
101 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
102 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
103 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
104 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
105 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
106 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
107 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
108 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
109 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
110 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
118 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
119 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.58
Rhizosphere 91.91
Stem 0
Stem Tuber 0
Unclassified 24.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495657_0095802 3300046675 Bacteria 1897
2 Ga0070683_100106384 3300005329 Bacteria 2645
3 Ga0070690_100000664 3300005330 Bacteria 17506
4 Ga0070670_100888646 3300005331 Unclassified 807
5 Ga0070666_10207204 3300005335 Bacteria 1380
6 Ga0070682_100166353 3300005337 Bacteria 1528
7 Ga0070691_10005206 3300005341 Bacteria 5910
8 Ga0070675_100361855 3300005354 Unclassified 1288
9 Ga0070667_100112357 3300005367 Unclassified 2363
10 Ga0070714_100016232 3300005435 Bacteria 6006
11 Ga0070713_100039074 3300005436 Bacteria 3849
12 Ga0070694_100442179 3300005444 Bacteria 1025
13 Ga0070663_100057679 3300005455 Bacteria 2786
14 Ga0070699_100029795 3300005518 Archaea 4707
15 Ga0070684_100046179 3300005535 Bacteria 3774
16 Ga0070686_100014986 3300005544 Bacteria 4480
17 Ga0070686_100077721 3300005544 Bacteria 2189
18 Ga0068855_100001277 3300005563 Bacteria 31186
19 Ga0068855_100073685 3300005563 Bacteria 3966
20 Ga0068856_100248340 3300005614 Bacteria 1794
21 Ga0068859_100098691 3300005617 Unclassified 2975
22 Ga0068858_100043104 3300005842 Bacteria 4184
23 Ga0068862_100822535 3300005844 Unclassified 908
24 Ga0068871_100653173 3300006358 Bacteria 960
25 Ga0075428_100007506 3300006844 Bacteria 12085
26 Ga0075428_100495015 3300006844 Bacteria 1308
27 Ga0075431_100236042 3300006847 Bacteria 1862
28 Ga0097620_100098697 3300006931 Unclassified 2975
29 Ga0105240_10025299 3300009093 Bacteria 7804
30 Ga0105240_10139289 3300009093 Bacteria 2902
31 Ga0111539_10031176 3300009094 Bacteria 6479
32 Ga0114129_10581210 3300009147 Bacteria 1454
33 Ga0105238_10102865 3300009551 Bacteria 2838
34 Ga0157374_10016862 3300013296 Bacteria 6427
35 Ga0157374_10270851 3300013296 Unclassified 1674
36 Ga0157372_10749631 3300013307 Unclassified 1135
37 Ga0157375_10000070 3300013308 Bacteria 108417
38 Ga0163163_10000114 3300014325 Bacteria 86190
39 Ga0163163_10321366 3300014325 Bacteria 1601
40 Ga0157380_10562528 3300014326 Unclassified 1121
41 Ga0157376_10101922 3300014969 Bacteria 2510
42 Ga0163161_10292940 3300017792 Bacteria 1280
43 Ga0213875_10008815 3300021388 Bacteria 5148
44 Ga0213875_10017392 3300021388 Bacteria 3472
45 Ga0213875_10080158 3300021388 Bacteria 1523
46 Ga0213871_10000955 3300021441 Bacteria 4473
47 Ga0207680_10193846 3300025903 Bacteria 1381
48 Ga0207695_10106608 3300025913 Bacteria 2788
49 Ga0207694_10061801 3300025924 Bacteria 2915
50 Ga0207664_10009977 3300025929 Bacteria 6692
51 Ga0207670_10279948 3300025936 Bacteria 1299
52 Ga0207661_10383998 3300025944 Unclassified 1271
53 Ga0207667_10000223 3300025949 Bacteria 79717
54 Ga0207667_10010131 3300025949 Bacteria 11038
55 Ga0207703_10570143 3300026035 Bacteria 1069
56 Ga0207676_10449310 3300026095 Bacteria 1215
57 Ga0207674_10571938 3300026116 Bacteria 1092
58 Ga0268265_10488598 3300028380 Unclassified 1158
59 Ga0268265_10713759 3300028380 Unclassified 970
60 Ga0265337_1080660 3300028556 Unclassified 890
61 Ga0265319_1085774 3300028563 Unclassified 997
62 Ga0265323_10000659 3300028653 Bacteria 18837
63 Ga0265323_10003211 3300028653 Bacteria 7281
64 Ga0265323_10010273 3300028653 Unclassified 3800
65 Ga0265323_10031651 3300028653 Bacteria 1965
66 Ga0265323_10047485 3300028653 Bacteria 1535
67 Ga0265338_10002612 3300028800 Bacteria 26603
68 Ga0265338_10010673 3300028800 Bacteria 10733
69 Ga0265338_10068823 3300028800 Bacteria 3046
70 Ga0265338_10151021 3300028800 Bacteria 1805
71 Ga0265338_10184082 3300028800 Bacteria 1590
72 Ga0265324_10001481 3300029957 Bacteria 13328
73 Ga0265324_10038413 3300029957 Bacteria 1661
74 Ga0265332_10158849 3300031238 Unclassified 945
75 Ga0265320_10006269 3300031240 Bacteria 7516
76 Ga0265320_10042616 3300031240 Bacteria 2250
77 Ga0265339_10007046 3300031249 Bacteria 7298
78 Ga0265331_10213176 3300031250 Bacteria 869
79 Ga0265327_10008470 3300031251 Bacteria 7650
80 Ga0265316_10089171 3300031344 Unclassified 2354
81 Ga0265316_10134826 3300031344 Bacteria 1858
82 Ga0265314_10234460 3300031711 Bacteria 1062
83 Ga0265342_10107753 3300031712 Unclassified 1580
84 Ga0316576_10348161 3300031727 Bacteria 1103
85 Ga0316585_10089100 3300032137 Bacteria 1008
86 Ga0373926_0023233 3300035083 Bacteria 2153
87 Ga0373945_0048565 3300035116 Bacteria 1555
88 Ga0373954_0018363 3300035118 Bacteria 3148
89 Ga0373956_0080404 3300035119 Bacteria 1495
90 Ga0373955_0514765 3300035172 Unclassified 731
91 Ga0316574_0196635 3300035398 Bacteria 1296
92 Ga0373924_0057567 3300035410 Bacteria 1621
93 Ga0373935_0190478 3300035692 Bacteria 1412
94 Ga0373927_0019804 3300035695 Bacteria 4411
95 Ga0373927_0515855 3300035695 Unclassified 790
96 Ga0373937_0182216 3300036401 Unclassified 1972
97 Ga0373937_0420787 3300036401 Unclassified 1268
98 Ga0373937_0697878 3300036401 Bacteria 961
99 Ga0316582_0064469 3300036647 Bacteria 2357
100 Ga0316584_0507171 3300036712 Bacteria 847
101 Ga0373925_0000831 3300037068 Bacteria 28499
102 Ga0373925_0608092 3300037068 Unclassified 900
103 Ga0395900_0308650 3300037418 Unclassified 1566
104 Ga0395905_0206409 3300037471 Unclassified 1841
105 Ga0395905_0505369 3300037471 Bacteria 1109
106 Ga0436364_0253728 3300037853 Bacteria 1791
107 Ga0436364_1173246 3300037853 Unclassified 2526
108 Ga0436364_1360638 3300037853 Bacteria 1352
109 Ga0436364_1429808 3300037853 Bacteria 1941
110 Ga0436364_1479504 3300037853 Bacteria 20531
111 Ga0436364_1536838 3300037853 Bacteria 5446
112 Ga0436365_1547303 3300039437 Bacteria 897
113 Ga0436360_0042660 3300039438 Bacteria 4248
114 Ga0436361_0497854 3300039447 Bacteria 12254
115 Ga0436363_0004805 3300039450 Bacteria 2246
116 Ga0436363_1195984 3300039450 Unclassified 1312
117 Ga0436363_1274633 3300039450 Bacteria 1475
118 Ga0436362_0430517 3300039453 Bacteria 1374
119 Ga0436362_0668229 3300039453 Bacteria 948
120 Ga0436362_0710537 3300039453 Bacteria 576
121 Ga0436362_0715202 3300039453 Bacteria 5845
122 Ga0436362_1116436 3300039453 Bacteria 1405
123 Ga0451577_0011335 3300042876 Bacteria 8441
124 Ga0451577_0139922 3300042876 Bacteria 2174
125 Ga0451577_0322689 3300042876 Unclassified 1400
126 Ga0453684_0004422 3300044712 Bacteria 29690
127 Ga0453684_0010410 3300044712 Bacteria 15914
128 Ga0453684_0024514 3300044712 Bacteria 8814
129 Ga0453684_0188573 3300044712 Bacteria 2414
130 Ga0453684_0835732 3300044712 Bacteria 991
131 Ga0451576_0072786 3300045051 Bacteria 3576
132 Ga0451576_0301764 3300045051 Bacteria 1675
133 Ga0466958_0160044 3300045836 Unclassified 1422
134 Ga0495592_0000059 3300046454 Bacteria 100782
135 Ga0495592_0291782 3300046454 Bacteria 1063
136 Ga0495653_0463373 3300046463 Unclassified 795
137 Ga0495662_0128228 3300046476 Bacteria 1247
138 Ga0495664_0060775 3300046477 Bacteria 2250
139 Ga0495618_0002546 3300046514 Bacteria 11674
140 Ga0495618_0002957 3300046514 Bacteria 10772
141 Ga0495628_0000266 3300046516 Bacteria 46653
142 Ga0495628_0286223 3300046516 Unclassified 1223
143 Ga0495630_0138416 3300046517 Unclassified 1850
144 Ga0495630_0253257 3300046517 Bacteria 1345
145 Ga0495652_0178946 3300046529 Unclassified 1630
146 Ga0495652_0232650 3300046529 Bacteria 1377
147 Ga0495640_0017569 3300046533 Bacteria 5326
148 Ga0495586_0000656 3300046535 Bacteria 19850
149 Ga0495586_0073941 3300046535 Unclassified 1864
150 Ga0495645_0139049 3300046543 Unclassified 1696
151 Ga0495645_0270434 3300046543 Unclassified 1122
152 Ga0495634_0001903 3300046642 Bacteria 17891
153 Ga0495634_0446923 3300046642 Bacteria 763
154 Ga0495635_0147045 3300046663 Unclassified 1604
155 Ga0495599_0012024 3300046678 Bacteria 5327
156 Ga0495599_0067907 3300046678 Unclassified 2226
157 Ga0495658_0431992 3300046683 Unclassified 841
158 Ga0495613_0109410 3300046689 Unclassified 1992
159 Ga0495674_0046095 3300047319 Bacteria 3870
160 Ga0495680_0217667 3300047322 Bacteria 1365
161 Ga0495684_0048404 3300047471 Bacteria 3251
162 Ga0496107_0263992 3300048910 Bacteria 1281
163 Ga0501031_0000844 3300049568 Bacteria 18435
164 Ga0501032_0074042 3300049569 Bacteria 2269
165 Ga0501033_0005912 3300049570 Bacteria 9610
166 Ga0501033_0172875 3300049570 Unclassified 1551
167 Ga0501034_0250949 3300049571 Unclassified 1714
168 Ga0501039_0076420 3300049575 Bacteria 2604
169 Ga0501043_0408559 3300049579 Bacteria 1025
170 Ga0501046_0078582 3300049580 Bacteria 2552
171 Ga0501044_0000275 3300049823 Bacteria 65642
172 nmdc:mga06r32_546626_c1 3300050510 Unclassified 1132
173 nmdc:mga08y16_36790_c1 3300050511 Bacteria 5140
174 Ga0495657_0095802
175 Ga0070683_100106384
176 Ga0070690_100000664
177 Ga0070670_100888646
178 Ga0070666_10207204
179 Ga0070682_100166353
180 Ga0070691_10005206
181 Ga0070675_100361855
182 Ga0070667_100112357
183 Ga0070714_100016232
184 Ga0070713_100039074
185 Ga0070694_100442179
186 Ga0070663_100057679
187 Ga0070699_100029795
188 Ga0070684_100046179
189 Ga0070686_100014986
190 Ga0070686_100077721
191 Ga0068855_100001277
192 Ga0068855_100073685
193 Ga0068856_100248340
194 Ga0068859_100098691
195 Ga0068858_100043104
196 Ga0068862_100822535
197 Ga0068871_100653173
198 Ga0075428_100007506
199 Ga0075428_100495015
200 Ga0075431_100236042
201 Ga0097620_100098697
202 Ga0105240_10025299
203 Ga0105240_10139289
204 Ga0111539_10031176
205 Ga0114129_10581210
206 Ga0105238_10102865
207 Ga0157374_10016862
208 Ga0157374_10270851
209 Ga0157372_10749631
210 Ga0157375_10000070
211 Ga0163163_10000114
212 Ga0163163_10321366
213 Ga0157380_10562528
214 Ga0157376_10101922
215 Ga0163161_10292940
216 Ga0213875_10008815
217 Ga0213875_10017392
218 Ga0213875_10080158
219 Ga0213871_10000955
220 Ga0207680_10193846
221 Ga0207695_10106608
222 Ga0207694_10061801
223 Ga0207664_10009977
224 Ga0207670_10279948
225 Ga0207661_10383998
226 Ga0207667_10000223
227 Ga0207667_10010131
228 Ga0207703_10570143
229 Ga0207676_10449310
230 Ga0207674_10571938
231 Ga0268265_10488598
232 Ga0268265_10713759
233 Ga0265337_1080660
234 Ga0265319_1085774
235 Ga0265323_10000659
236 Ga0265323_10003211
237 Ga0265323_10010273
238 Ga0265323_10031651
239 Ga0265323_10047485
240 Ga0265338_10002612
241 Ga0265338_10010673
242 Ga0265338_10068823
243 Ga0265338_10151021
244 Ga0265338_10184082
245 Ga0265324_10001481
246 Ga0265324_10038413
247 Ga0265332_10158849
248 Ga0265320_10006269
249 Ga0265320_10042616
250 Ga0265339_10007046
251 Ga0265331_10213176
252 Ga0265327_10008470
253 Ga0265316_10089171
254 Ga0265316_10134826
255 Ga0265314_10234460
256 Ga0265342_10107753
257 Ga0316576_10348161
258 Ga0316585_10089100
259 Ga0373926_0023233
260 Ga0373945_0048565
261 Ga0373954_0018363
262 Ga0373956_0080404
263 Ga0373955_0514765
264 Ga0316574_0196635
265 Ga0373924_0057567
266 Ga0373935_0190478
267 Ga0373927_0019804
268 Ga0373927_0515855
269 Ga0373937_0182216
270 Ga0373937_0420787
271 Ga0373937_0697878
272 Ga0316582_0064469
273 Ga0316584_0507171
274 Ga0373925_0000831
275 Ga0373925_0608092
276 Ga0395900_0308650
277 Ga0395905_0206409
278 Ga0395905_0505369
279 Ga0436364_0253728
280 Ga0436364_1173246
281 Ga0436364_1360638
282 Ga0436364_1429808
283 Ga0436364_1479504
284 Ga0436364_1536838
285 Ga0436365_1547303
286 Ga0436360_0042660
287 Ga0436361_0497854
288 Ga0436363_0004805
289 Ga0436363_1195984
290 Ga0436363_1274633
291 Ga0436362_0430517
292 Ga0436362_0668229
293 Ga0436362_0710537
294 Ga0436362_0715202
295 Ga0436362_1116436
296 Ga0451577_0011335
297 Ga0451577_0139922
298 Ga0451577_0322689
299 Ga0453684_0004422
300 Ga0453684_0010410
301 Ga0453684_0024514
302 Ga0453684_0188573
303 Ga0453684_0835732
304 Ga0451576_0072786
305 Ga0451576_0301764
306 Ga0466958_0160044
307 Ga0495592_0000059
308 Ga0495592_0291782
309 Ga0495653_0463373
310 Ga0495662_0128228
311 Ga0495664_0060775
312 Ga0495618_0002546
313 Ga0495618_0002957
314 Ga0495628_0000266
315 Ga0495628_0286223
316 Ga0495630_0138416
317 Ga0495630_0253257
318 Ga0495652_0178946
319 Ga0495652_0232650
320 Ga0495640_0017569
321 Ga0495586_0000656
322 Ga0495586_0073941
323 Ga0495645_0139049
324 Ga0495645_0270434
325 Ga0495634_0001903
326 Ga0495634_0446923
327 Ga0495635_0147045
328 Ga0495599_0012024
329 Ga0495599_0067907
330 Ga0495658_0431992
331 Ga0495613_0109410
332 Ga0495674_0046095
333 Ga0495680_0217667
334 Ga0495684_0048404
335 Ga0496107_0263992
336 Ga0501031_0000844
337 Ga0501032_0074042
338 Ga0501033_0005912
339 Ga0501033_0172875
340 Ga0501034_0250949
341 Ga0501039_0076420
342 Ga0501043_0408559
343 Ga0501046_0078582
344 Ga0501044_0000275
345 nmdc:mga06r32_546626_c1
346 nmdc:mga08y16_36790_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02223

Thymidylate_kin

Thymidylate kinase

8

223

0.96

PF13521

AAA_28

AAA domain

5

156

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
5x8a-assembly1.cif.gz_B crystal structure of atp bound thymidylate kinase from thermus thermophilus hb8 0.9713 1 199
5h56-assembly1.cif.gz_B adp and dtdp bound crystal structure of thymidylate kinase (aq_969) from aquifex aeolicus vf5 0.9702 1 199
5xb5-assembly1.cif.gz_A crystal structure of r90a mutant of thymidylate kinase (aq_969) from aquifex aeolicus vf5 0.9691 1 198
5xb5-assembly1.cif.gz_B crystal structure of r90a mutant of thymidylate kinase (aq_969) from aquifex aeolicus vf5 0.9687 1 199
5xbh-assembly1.cif.gz_B crystal structure of r145e mutant of thymidylate kinase (aq_969) from aquifex aeolicus vf5 0.9684 1 201
ID Description Score Start End Superfamily
2z0hB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9572 2 193 3.40.50.300
2pbrA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9545 1 203 3.40.50.300
2pbrA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9497 1 203 3.40.50.300
5x7jB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9364 1 201 3.40.50.300
2z0hB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.936 2 193 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7Z9PX59-F1-model_v4 Thymidylate kinase (EC 2.7.4.9) (dTMP kinase) 0.9851 1 201 GO:0004798
GO:0005524
GO:0005829
GO:0006227
GO:0006233
GO:0006235
AF-A0A2H5YS08-F1-model_v4 Thymidylate kinase (EC 2.7.4.9) (dTMP kinase) 0.9838 1 199 GO:0004798
GO:0005524
GO:0005829
GO:0006227
GO:0006233
GO:0006235
AF-A0A7X2D882-F1-model_v4 dTMP kinase (EC 2.7.4.9) 0.9813 1 128 GO:0004798
GO:0005524
GO:0005829
GO:0006227
GO:0006233
GO:0006235
AF-A0A2E9AER3-F1-model_v4 Thymidylate kinase (EC 2.7.4.9) (dTMP kinase) 0.9811 1 202 GO:0004798
GO:0005524
GO:0005829
GO:0006227
GO:0006233
GO:0006235
AF-A0A2E8HJ12-F1-model_v4 Thymidylate kinase (EC 2.7.4.9) (dTMP kinase) 0.9811 1 199 GO:0004798
GO:0005524
GO:0005829
GO:0006227
GO:0006233
GO:0006235

Map