F262796

General Info

Members Datasets Scaffolds Average Seq Length
173 139 346 188

Family's Representative Sequence

Representative Sequence 3300025936|Ga0207670_10121039|Ga0207670_101210392
Length 208
Sequence MSGRTQSRCACLFDSLPVGYSISRMKPLFFPSPAEFRHWLAQHHATATELLVGFHKVASGKPSLTWPESVDEALCVGWIDGVRKRIDEHAYTIRFTPRRTGSIWSAVNIRRVQALTAEGRMQPAGLKAFAARKENKSGIYAYEQRQAELVEPYAGLLRKNKAAWTFFQAQPPSYRKRMCWWLISAKQEATRLKRLEKLIAASAGGKRI

Samples

Sample ID Description Type Environment
1 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
37 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
58 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
79 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
80 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
81 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
82 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
83 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
84 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
85 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
86 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
87 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
88 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
89 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
90 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
91 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
92 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
93 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
94 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
95 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
96 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
97 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
98 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
99 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
100 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
101 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
102 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
103 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
104 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
105 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
106 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
107 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
108 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
109 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
110 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
111 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
112 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
113 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
114 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
115 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
116 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
117 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
118 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
119 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
120 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
121 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
122 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
123 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
124 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
125 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
126 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
127 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
128 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
129 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
130 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
131 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
132 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
133 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
134 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
135 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
136 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
137 2643221585 Pelomonas sp. Root662 Isolate Unclassified
138 2643221656 Pelomonas sp. Root405 Isolate Unclassified
139 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.27
Metatranscriptomes 0
Isolates 1.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.16
Nodule 0
Rhizoplane 2.31
Rhizosphere 93.64
Stem 0
Stem Tuber 0
Unclassified 17.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207670_10121039 3300025936 Bacteria 1902
2 JGI25404J52841_10018190 3300003659 Bacteria 1523
3 Ga0065712_10133597 3300005290 Bacteria 1521
4 Ga0070658_10156431 3300005327 Unclassified 1911
5 Ga0070666_10010998 3300005335 Bacteria 5671
6 Ga0070666_10290925 3300005335 Bacteria 1162
7 Ga0070689_100023298 3300005340 Bacteria 4634
8 Ga0070689_100257507 3300005340 Unclassified 1441
9 Ga0070687_100174254 3300005343 Bacteria 1283
10 Ga0070674_100480396 3300005356 Bacteria 1031
11 Ga0070673_100479223 3300005364 Bacteria 1123
12 Ga0070688_100021361 3300005365 Bacteria 3781
13 Ga0070688_100034883 3300005365 Bacteria 3052
14 Ga0070705_100064007 3300005440 Bacteria 2195
15 Ga0070705_100769340 3300005440 Unclassified 763
16 Ga0070694_100108378 3300005444 Unclassified 1975
17 Ga0070708_100012206 3300005445 Bacteria 7007
18 Ga0070681_10090872 3300005458 Unclassified 3003
19 Ga0070685_10011254 3300005466 Bacteria 4682
20 Ga0070706_100032631 3300005467 Unclassified 4804
21 Ga0070707_100001981 3300005468 Bacteria 19599
22 Ga0070707_100350812 3300005468 Bacteria 1433
23 Ga0070698_100004607 3300005471 Bacteria 15141
24 Ga0070679_100043962 3300005530 Unclassified 4449
25 Ga0070697_100065526 3300005536 Bacteria 2969
26 Ga0070697_100586608 3300005536 Unclassified 979
27 Ga0068853_100813442 3300005539 Bacteria 895
28 Ga0070672_100048284 3300005543 Bacteria 3307
29 Ga0070686_100015579 3300005544 Bacteria 4407
30 Ga0070704_100034766 3300005549 Unclassified 3421
31 Ga0070664_100258841 3300005564 Bacteria 1565
32 Ga0070664_100696719 3300005564 Bacteria 946
33 Ga0068854_100038517 3300005578 Bacteria 3363
34 Ga0068859_100039199 3300005617 Unclassified 4752
35 Ga0068859_100120347 3300005617 Bacteria 2692
36 Ga0068864_100432276 3300005618 Bacteria 1256
37 Ga0068861_100118443 3300005719 Bacteria 2133
38 Ga0068863_100013321 3300005841 Bacteria 7930
39 Ga0068863_100165103 3300005841 Unclassified 2123
40 Ga0068858_100421541 3300005842 Bacteria 1283
41 Ga0068858_100514256 3300005842 Bacteria 1157
42 Ga0068860_100232457 3300005843 Bacteria 1792
43 Ga0068860_100264536 3300005843 Bacteria 1677
44 Ga0068862_101215452 3300005844 Bacteria 753
45 Ga0081540_1000307 3300005983 Bacteria 50460
46 Ga0070717_10031308 3300006028 Bacteria 4278
47 Ga0070717_10586818 3300006028 Bacteria 1011
48 Ga0075363_100337004 3300006048 Bacteria 879
49 Ga0070716_100024137 3300006173 Bacteria 3234
50 Ga0070712_100197194 3300006175 Unclassified 1579
51 Ga0075366_10486944 3300006195 Bacteria 762
52 Ga0097621_100356633 3300006237 Bacteria 1302
53 Ga0068871_100394835 3300006358 Bacteria 1231
54 Ga0075433_10003958 3300006852 Bacteria 11475
55 Ga0075434_100000240 3300006871 Bacteria 38105
56 Ga0075429_100401657 3300006880 Bacteria 1200
57 Ga0075436_100304468 3300006914 Bacteria 1143
58 Ga0097620_100039198 3300006931 Unclassified 4752
59 Ga0097620_100120352 3300006931 Bacteria 2692
60 Ga0075435_100003081 3300007076 Bacteria 11250
61 Ga0105240_10241773 3300009093 Bacteria 2092
62 Ga0105240_10812851 3300009093 Bacteria 1012
63 Ga0114129_10007425 3300009147 Bacteria 15607
64 Ga0105249_10002101 3300009553 Bacteria 17281
65 Ga0105249_11521349 3300009553 Unclassified 741
66 Ga0157378_10010894 3300013297 Bacteria 7952
67 Ga0163162_10069494 3300013306 Unclassified 3574
68 Ga0157372_10058384 3300013307 Unclassified 4313
69 Ga0163163_10132418 3300014325 Bacteria 2534
70 Ga0163163_10521630 3300014325 Bacteria 1250
71 Ga0157380_10728154 3300014326 Unclassified 1000
72 Ga0157376_10047946 3300014969 Bacteria 3530
73 Ga0157376_10112541 3300014969 Bacteria 2398
74 Ga0213876_10037184 3300021384 Bacteria 2568
75 Ga0207680_10204757 3300025903 Bacteria 1347
76 Ga0207680_10342926 3300025903 Bacteria 1048
77 Ga0207705_10001653 3300025909 Bacteria 17702
78 Ga0207684_10037730 3300025910 Unclassified 4100
79 Ga0207707_10011523 3300025912 Bacteria 7700
80 Ga0207695_10365781 3300025913 Bacteria 1328
81 Ga0207652_10025868 3300025921 Bacteria 4883
82 Ga0207646_10018411 3300025922 Bacteria 6515
83 Ga0207646_10021504 3300025922 Bacteria 5961
84 Ga0207650_10468324 3300025925 Unclassified 1050
85 Ga0207687_10162466 3300025927 Bacteria 1715
86 Ga0207700_10279974 3300025928 Bacteria 1434
87 Ga0207644_10185838 3300025931 Bacteria 1632
88 Ga0207670_10067276 3300025936 Bacteria 2464
89 Ga0207665_10035216 3300025939 Bacteria 3322
90 Ga0207651_10410213 3300025960 Bacteria 1154
91 Ga0207712_10033782 3300025961 Unclassified 3460
92 Ga0207640_10008152 3300025981 Bacteria 5804
93 Ga0207703_10297988 3300026035 Unclassified 1470
94 Ga0207641_10013838 3300026088 Bacteria 6618
95 Ga0207676_10119883 3300026095 Unclassified 2216
96 Ga0207676_10182939 3300026095 Bacteria 1837
97 Ga0207674_11243945 3300026116 Bacteria 714
98 Ga0207675_100036661 3300026118 Bacteria 4574
99 Ga0265334_10081604 3300028573 Unclassified 1190
100 Ga0265328_10079581 3300031239 Bacteria 1208
101 Ga0265329_10005886 3300031242 Unclassified 4914
102 Ga0265339_10027411 3300031249 Bacteria 3252
103 Ga0265314_10007242 3300031711 Bacteria 9642
104 Ga0265314_10244239 3300031711 Unclassified 1034
105 Ga0307412_10550391 3300031911 Bacteria 969
106 Ga0307409_100206685 3300031995 Bacteria 1761
107 Ga0307409_100315064 3300031995 Bacteria 1462
108 Ga0307416_100069348 3300032002 Bacteria 2917
109 Ga0307416_100171523 3300032002 Bacteria 2020
110 Ga0373935_0902433 3300035692 Unclassified 655
111 Ga0373933_0301493 3300035724 Bacteria 1037
112 Ga0373933_0538006 3300035724 Bacteria 766
113 Ga0373937_0006364 3300036401 Bacteria 10184
114 Ga0373937_0046440 3300036401 Bacteria 3972
115 Ga0373937_0664234 3300036401 Unclassified 988
116 Ga0395900_0888646 3300037418 Unclassified 815
117 Ga0395905_0214902 3300037471 Bacteria 1801
118 Ga0395901_0805839 3300038443 Unclassified 928
119 Ga0436365_0756093 3300039437 Bacteria 7131
120 Ga0436365_1377854 3300039437 Unclassified 766
121 Ga0451807_1033508 3300041486 Bacteria 1199
122 Ga0451577_0000012 3300042876 Bacteria 575467
123 Ga0451577_0910504 3300042876 Bacteria 792
124 Ga0453684_0237309 3300044712 Bacteria 2101
125 Ga0495592_0420514 3300046454 Bacteria 843
126 Ga0495629_0086596 3300046459 Bacteria 2185
127 Ga0495653_0004208 3300046463 Bacteria 11654
128 Ga0495653_0205017 3300046463 Bacteria 1336
129 Ga0495650_0000147 3300046471 Bacteria 160862
130 Ga0495650_0001576 3300046471 Bacteria 21399
131 Ga0495582_0014579 3300046473 Bacteria 4318
132 Ga0495605_0050294 3300046474 Bacteria 2034
133 Ga0495608_0079261 3300046511 Bacteria 2136
134 Ga0495618_0005578 3300046514 Bacteria 7654
135 Ga0495648_0011165 3300046524 Bacteria 6786
136 Ga0495587_0019619 3300046536 Bacteria 4183
137 Ga0495587_0252479 3300046536 Bacteria 991
138 Ga0495609_0000988 3300046538 Bacteria 20320
139 Ga0495645_0471338 3300046543 Bacteria 789
140 Ga0495634_0563273 3300046642 Bacteria 664
141 Ga0495635_0045524 3300046663 Bacteria 3028
142 Ga0495658_0346493 3300046683 Bacteria 944
143 Ga0495658_0367615 3300046683 Bacteria 915
144 Ga0495613_0096408 3300046689 Bacteria 2139
145 Ga0495613_0193412 3300046689 Bacteria 1437
146 Ga0495670_0099988 3300046691 Bacteria 1493
147 Ga0495649_0121680 3300046694 Bacteria 1380
148 Ga0495589_0030941 3300046794 Bacteria 2695
149 Ga0495674_0530732 3300047319 Bacteria 939
150 Ga0495672_0001063 3300047320 Bacteria 28042
151 Ga0495676_0047977 3300047321 Bacteria 3448
152 Ga0495683_0006854 3300047323 Bacteria 6192
153 Ga0495675_0126834 3300047444 Bacteria 1588
154 Ga0495626_0029690 3300048091 Bacteria 2644
155 Ga0496102_0191218 3300048905 Bacteria 1929
156 Ga0496104_0886733 3300048907 Bacteria 797
157 Ga0496108_0266148 3300048911 Bacteria 1492
158 Ga0495678_002325 3300049459 Bacteria 13090
159 Ga0495682_0069071 3300049460 Bacteria 1272
160 Ga0501075_0367268 3300049591 Bacteria 1097
161 Ga0501076_0651721 3300049592 Bacteria 869
162 nmdc:mga05p37_5045_c1 3300050507 Bacteria 13768
163 nmdc:mga0n895_24048_c1 3300050512 Bacteria 5736
164 nmdc:mga0rr50_849_c1 3300050513 Bacteria 16428
165 nmdc:mga08x19_115534_c1 3300050514 Bacteria 1794
166 nmdc:mga0a205_2352_c1 3300050515 Bacteria 16687
167 Ga0495601_0067716 3300053077 Bacteria 2275
168 Ga0495595_0259734 3300053084 Bacteria 870
169 Ga0495619_0198743 3300053085 Bacteria 1388
170 Ga0501082_0805408 3300060353 Bacteria 822
171 2643934161 2643221585 Bacteria 5812563
172 2644315648 2643221656 Bacteria 5809961
173 2809142375 2808606418 Bacteria 6724496
174 Ga0207670_10121039
175 JGI25404J52841_10018190
176 Ga0065712_10133597
177 Ga0070658_10156431
178 Ga0070666_10010998
179 Ga0070666_10290925
180 Ga0070689_100023298
181 Ga0070689_100257507
182 Ga0070687_100174254
183 Ga0070674_100480396
184 Ga0070673_100479223
185 Ga0070688_100021361
186 Ga0070688_100034883
187 Ga0070705_100064007
188 Ga0070705_100769340
189 Ga0070694_100108378
190 Ga0070708_100012206
191 Ga0070681_10090872
192 Ga0070685_10011254
193 Ga0070706_100032631
194 Ga0070707_100001981
195 Ga0070707_100350812
196 Ga0070698_100004607
197 Ga0070679_100043962
198 Ga0070697_100065526
199 Ga0070697_100586608
200 Ga0068853_100813442
201 Ga0070672_100048284
202 Ga0070686_100015579
203 Ga0070704_100034766
204 Ga0070664_100258841
205 Ga0070664_100696719
206 Ga0068854_100038517
207 Ga0068859_100039199
208 Ga0068859_100120347
209 Ga0068864_100432276
210 Ga0068861_100118443
211 Ga0068863_100013321
212 Ga0068863_100165103
213 Ga0068858_100421541
214 Ga0068858_100514256
215 Ga0068860_100232457
216 Ga0068860_100264536
217 Ga0068862_101215452
218 Ga0081540_1000307
219 Ga0070717_10031308
220 Ga0070717_10586818
221 Ga0075363_100337004
222 Ga0070716_100024137
223 Ga0070712_100197194
224 Ga0075366_10486944
225 Ga0097621_100356633
226 Ga0068871_100394835
227 Ga0075433_10003958
228 Ga0075434_100000240
229 Ga0075429_100401657
230 Ga0075436_100304468
231 Ga0097620_100039198
232 Ga0097620_100120352
233 Ga0075435_100003081
234 Ga0105240_10241773
235 Ga0105240_10812851
236 Ga0114129_10007425
237 Ga0105249_10002101
238 Ga0105249_11521349
239 Ga0157378_10010894
240 Ga0163162_10069494
241 Ga0157372_10058384
242 Ga0163163_10132418
243 Ga0163163_10521630
244 Ga0157380_10728154
245 Ga0157376_10047946
246 Ga0157376_10112541
247 Ga0213876_10037184
248 Ga0207680_10204757
249 Ga0207680_10342926
250 Ga0207705_10001653
251 Ga0207684_10037730
252 Ga0207707_10011523
253 Ga0207695_10365781
254 Ga0207652_10025868
255 Ga0207646_10018411
256 Ga0207646_10021504
257 Ga0207650_10468324
258 Ga0207687_10162466
259 Ga0207700_10279974
260 Ga0207644_10185838
261 Ga0207670_10067276
262 Ga0207665_10035216
263 Ga0207651_10410213
264 Ga0207712_10033782
265 Ga0207640_10008152
266 Ga0207703_10297988
267 Ga0207641_10013838
268 Ga0207676_10119883
269 Ga0207676_10182939
270 Ga0207674_11243945
271 Ga0207675_100036661
272 Ga0265334_10081604
273 Ga0265328_10079581
274 Ga0265329_10005886
275 Ga0265339_10027411
276 Ga0265314_10007242
277 Ga0265314_10244239
278 Ga0307412_10550391
279 Ga0307409_100206685
280 Ga0307409_100315064
281 Ga0307416_100069348
282 Ga0307416_100171523
283 Ga0373935_0902433
284 Ga0373933_0301493
285 Ga0373933_0538006
286 Ga0373937_0006364
287 Ga0373937_0046440
288 Ga0373937_0664234
289 Ga0395900_0888646
290 Ga0395905_0214902
291 Ga0395901_0805839
292 Ga0436365_0756093
293 Ga0436365_1377854
294 Ga0451807_1033508
295 Ga0451577_0000012
296 Ga0451577_0910504
297 Ga0453684_0237309
298 Ga0495592_0420514
299 Ga0495629_0086596
300 Ga0495653_0004208
301 Ga0495653_0205017
302 Ga0495650_0000147
303 Ga0495650_0001576
304 Ga0495582_0014579
305 Ga0495605_0050294
306 Ga0495608_0079261
307 Ga0495618_0005578
308 Ga0495648_0011165
309 Ga0495587_0019619
310 Ga0495587_0252479
311 Ga0495609_0000988
312 Ga0495645_0471338
313 Ga0495634_0563273
314 Ga0495635_0045524
315 Ga0495658_0346493
316 Ga0495658_0367615
317 Ga0495613_0096408
318 Ga0495613_0193412
319 Ga0495670_0099988
320 Ga0495649_0121680
321 Ga0495589_0030941
322 Ga0495674_0530732
323 Ga0495672_0001063
324 Ga0495676_0047977
325 Ga0495683_0006854
326 Ga0495675_0126834
327 Ga0495626_0029690
328 Ga0496102_0191218
329 Ga0496104_0886733
330 Ga0496108_0266148
331 Ga0495678_002325
332 Ga0495682_0069071
333 Ga0501075_0367268
334 Ga0501076_0651721
335 nmdc:mga05p37_5045_c1
336 nmdc:mga0n895_24048_c1
337 nmdc:mga0rr50_849_c1
338 nmdc:mga08x19_115534_c1
339 nmdc:mga0a205_2352_c1
340 Ga0495601_0067716
341 Ga0495595_0259734
342 Ga0495619_0198743
343 Ga0501082_0805408
344 2643934161
345 2644315648
346 2809142375

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13376

OmdA

Bacteriocin-protection, YdeI or OmpD-Associated

146

205

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ux6-assembly1.cif.gz_B crystal structure of mfng, an l- and d-tyrosine o-methyltransferase from the marformycin biosynthesis pathway of streptomyces drozdowiczii, with sah bound at 1.35 a resolution (p212121 - form i) 0.7765 9 74
7ux6-assembly1.cif.gz_A crystal structure of mfng, an l- and d-tyrosine o-methyltransferase from the marformycin biosynthesis pathway of streptomyces drozdowiczii, with sah bound at 1.35 a resolution (p212121 - form i) 0.759 3 72
8bic-assembly1.cif.gz_A o-methyltransferase plu4891 in complex with sah 0.7471 3 71
8h3t-assembly1.cif.gz_B the crystal structure of alph 0.7376 8 72
8bij-assembly1.cif.gz_B o-methyltransferase plu4894 (mutant i88m, w91l, c97y, s142l, g146v, y258m, l270f, s309y) in complex with sah 0.7353 25 73
ID Description Score Start End Superfamily
af_Q7ZVJ8_3_201_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7974 25 70 3.40.50.150
3i9fA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7641 11 74 3.40.50.150
2ip2A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7448 9 72 3.40.50.150
af_Q9ZU24_113_362_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7378 3 72 3.40.50.150
3hnrA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7125 3 72 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A2V8MZK2-F1-model_v4 Bacteriocin-protection protein 0.9992 1 74
AF-A0A3D4ISG6-F1-model_v4 Bacteriocin-protection protein 0.9952 1 104
AF-A0A2V9BKB9-F1-model_v4 Bacteriocin-protection protein 0.9866 1 74
AF-A0A2H6LMP4-F1-model_v4 Uncharacterized protein 0.984 3 106
AF-A0A521FUJ3-F1-model_v4 Bacteriocin-protection, YdeI or OmpD-Associated 0.9839 4 106

Map