F262775

General Info

Members Datasets Scaffolds Average Seq Length
173 129 346 187

Family's Representative Sequence

Representative Sequence 3300025922|Ga0207646_10125577|Ga0207646_101255775
Length 185
Sequence MAKLIYSAITSLDGYVADEDGNFDWAAPDEEVHSFVNDLERPVGTYLYGRRMYEVMVFWETAHTLGDQPFIQDFAEIWQAADKIVYSKTLAAVSSARTRIERDFDPEAVRQLKARGGGDITVGGPDLAAEAIKAGLVDEYHLFMAPIVVGGGKQSLPSNVRLQLELLDERRFGNGVVHLRYRTRT

Samples

Sample ID Description Type Environment
1 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
14 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
15 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
16 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
17 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
18 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
19 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
20 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
21 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
22 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
23 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
24 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
25 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
26 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
27 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
28 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
41 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
42 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
43 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
44 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
45 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
46 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
47 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
48 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
49 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
50 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
51 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
52 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
53 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
54 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
55 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
56 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
57 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
58 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
59 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
60 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
61 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
62 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
63 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
64 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
65 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
66 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
67 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
68 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
69 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
70 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
71 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
72 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
73 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
74 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
75 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
76 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
77 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
78 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
79 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
80 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
81 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
82 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
83 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
84 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
85 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
86 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
87 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
89 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
90 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
92 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
93 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
94 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
95 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
96 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
97 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
98 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
99 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
100 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
101 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
102 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
103 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
104 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
105 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
106 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
108 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
109 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
110 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
111 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
112 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
113 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
114 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
115 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
116 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
117 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
118 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
119 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
120 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
121 2501939600 Micromonospora sp. L5 Isolate Unclassified
122 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
123 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
124 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
125 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
126 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
127 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
128 2867369537 Streptomyces sp. Z26 Isolate Unclassified
129 649633069 Micromonospora sp. L5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.22
Metatranscriptomes 0.58
Isolates 5.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.47
Nodule 0
Rhizoplane 4.62
Rhizosphere 84.97
Stem 0
Stem Tuber 0
Unclassified 1.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207646_10125577 3300025922 Bacteria 2307
2 rootL2_10019413 3300003322 Bacteria 2914
3 rootH1_10059114 3300003323 Bacteria 2162
4 Ga0070690_100705345 3300005330 Bacteria 775
5 Ga0070689_100849501 3300005340 Bacteria 805
6 Ga0070669_100989832 3300005353 Bacteria 721
7 Ga0070675_100153089 3300005354 Bacteria 1978
8 Ga0070671_100342579 3300005355 Bacteria 1275
9 Ga0070710_10103238 3300005437 Bacteria 1701
10 Ga0070694_100210721 3300005444 Bacteria 1453
11 Ga0070707_100015496 3300005468 Bacteria 7154
12 Ga0070707_100028666 3300005468 Bacteria 5298
13 Ga0070707_100097562 3300005468 Bacteria 2846
14 Ga0070698_100687717 3300005471 Bacteria 965
15 Ga0068854_100239334 3300005578 Bacteria 1444
16 Ga0068860_100298292 3300005843 Bacteria 1578
17 Ga0081455_10433698 3300005937 Bacteria 902
18 Ga0081539_10117476 3300005985 Bacteria 1327
19 Ga0070717_10193265 3300006028 Bacteria 1779
20 Ga0070717_10453540 3300006028 Bacteria 1156
21 Ga0075365_10002782 3300006038 Bacteria 8748
22 Ga0075364_10024620 3300006051 Bacteria 3824
23 Ga0075428_100001862 3300006844 Bacteria 22599
24 Ga0075428_100385015 3300006844 Bacteria 1503
25 Ga0075428_100818667 3300006844 Bacteria 989
26 Ga0111539_10233449 3300009094 Bacteria 2141
27 Ga0111539_10245691 3300009094 Bacteria 2084
28 Ga0111539_11165071 3300009094 Bacteria 896
29 Ga0105242_10955941 3300009176 Bacteria 861
30 Ga0105249_11315950 3300009553 Bacteria 794
31 Ga0105239_10472872 3300010375 Bacteria 1423
32 Ga0105246_10987291 3300011119 Bacteria 761
33 Ga0163162_10139271 3300013306 Bacteria 2538
34 Ga0157375_11801511 3300013308 Bacteria 726
35 Ga0207684_10167080 3300025910 Bacteria 1896
36 Ga0207707_10351932 3300025912 Bacteria 1269
37 Ga0207663_10024170 3300025916 Bacteria 3497
38 Ga0207660_10436436 3300025917 Bacteria 1058
39 Ga0207646_10066171 3300025922 Bacteria 3226
40 Ga0207646_10071052 3300025922 Bacteria 3109
41 Ga0207646_11226254 3300025922 Bacteria 657
42 Ga0207687_10049174 3300025927 Bacteria 2931
43 Ga0207700_10954617 3300025928 Bacteria 767
44 Ga0207664_10766586 3300025929 Bacteria 868
45 Ga0207706_10001313 3300025933 Bacteria 24928
46 Ga0207689_11184125 3300025942 Bacteria 643
47 Ga0207675_100000976 3300026118 Bacteria 28407
48 Ga0268265_10370769 3300028380 Bacteria 1314
49 Ga0268264_10212689 3300028381 Bacteria 1776
50 Ga0307515_10190280 3300028794 Bacteria 1965
51 Ga0265760_10139736 3300031090 Bacteria 788
52 Ga0265325_10043068 3300031241 Bacteria 2357
53 Ga0265340_10405608 3300031247 Bacteria 601
54 Ga0265339_10035124 3300031249 Bacteria 2814
55 Ga0307408_100779138 3300031548 Bacteria 866
56 Ga0265313_10000571 3300031595 Bacteria 38441
57 Ga0307508_10015007 3300031616 Bacteria 7062
58 Ga0316576_10138777 3300031727 Bacteria 1830
59 Ga0307405_10329879 3300031731 Bacteria 1169
60 Ga0307413_11163857 3300031824 Bacteria 669
61 Ga0307410_10359120 3300031852 Bacteria 1166
62 Ga0307406_11033112 3300031901 Bacteria 706
63 Ga0307407_10013943 3300031903 Bacteria 3918
64 Ga0307407_10180620 3300031903 Bacteria 1398
65 Ga0307412_10024308 3300031911 Bacteria 3740
66 Ga0307412_10141317 3300031911 Bacteria 1764
67 Ga0307412_11603617 3300031911 Bacteria 594
68 Ga0307409_100018330 3300031995 Bacteria 4703
69 Ga0307416_100051545 3300032002 Bacteria 3288
70 Ga0307416_100235712 3300032002 Bacteria 1768
71 Ga0307416_100717455 3300032002 Bacteria 1090
72 Ga0307414_10316289 3300032004 Bacteria 1327
73 Ga0307411_10190999 3300032005 Bacteria 1564
74 Ga0307415_100004755 3300032126 Bacteria 7107
75 Ga0307415_100361841 3300032126 Bacteria 1225
76 Ga0373962_0001465 3300035242 Bacteria 5583
77 Ga0373935_0115713 3300035692 Bacteria 1785
78 Ga0373925_0013801 3300037068 Bacteria 5845
79 Ga0395900_1158585 3300037418 Bacteria 689
80 Ga0395905_0799483 3300037471 Bacteria 846
81 Ga0451807_1237807 3300041486 Unclassified 631
82 Ga0466965_0387906 3300044683 Bacteria 770
83 Ga0495590_0101579 3300046457 Bacteria 1022
84 Ga0495584_0066703 3300046491 Bacteria 1810
85 Ga0495616_0162874 3300046513 Bacteria 1002
86 Ga0495632_0189184 3300046519 Bacteria 940
87 Ga0495663_0212242 3300046525 Bacteria 678
88 Ga0495621_0245224 3300046539 Bacteria 731
89 Ga0495670_0268949 3300046691 Bacteria 910
90 Ga0495589_0202261 3300046794 Bacteria 937
91 Ga0495600_0236061 3300046809 Bacteria 1166
92 Ga0496108_0305160 3300048911 Bacteria 1387
93 Ga0496108_0317848 3300048911 Bacteria 1357
94 Ga0496109_0375042 3300048912 Bacteria 1344
95 Ga0496110_0346235 3300048913 Bacteria 1354
96 Ga0496111_0295907 3300048914 Bacteria 1200
97 Ga0496112_0359182 3300048915 Bacteria 1399
98 Ga0496112_0613470 3300048915 Unclassified 1019
99 Ga0501033_0027751 3300049570 Bacteria 4256
100 Ga0501034_0006839 3300049571 Bacteria 12203
101 Ga0501034_0272347 3300049571 Bacteria 1634
102 Ga0501034_0294061 3300049571 Bacteria 1562
103 Ga0501036_0146112 3300049572 Bacteria 1994
104 Ga0501037_0131173 3300049573 Bacteria 1797
105 Ga0501038_0021687 3300049574 Bacteria 5762
106 Ga0501039_0019265 3300049575 Bacteria 5233
107 Ga0501039_0179962 3300049575 Bacteria 1663
108 Ga0501039_0315515 3300049575 Bacteria 1229
109 Ga0501040_0010940 3300049576 Bacteria 5934
110 Ga0501041_0009663 3300049577 Bacteria 5685
111 Ga0501042_0001332 3300049578 Bacteria 14421
112 Ga0501042_0290459 3300049578 Bacteria 1181
113 Ga0501046_0021487 3300049580 Bacteria 5325
114 Ga0501048_0013341 3300049582 Bacteria 6097
115 Ga0501067_0003726 3300049583 Bacteria 8396
116 Ga0501067_0161956 3300049583 Bacteria 1246
117 Ga0501068_0081870 3300049584 Bacteria 1982
118 Ga0501068_0117043 3300049584 Bacteria 1660
119 Ga0501068_0163614 3300049584 Bacteria 1403
120 Ga0501069_0360805 3300049585 Bacteria 857
121 Ga0501070_0068929 3300049586 Bacteria 2928
122 Ga0501070_0503646 3300049586 Bacteria 973
123 Ga0501071_0005000 3300049587 Bacteria 8474
124 Ga0501071_0012890 3300049587 Bacteria 5688
125 Ga0501071_0200991 3300049587 Bacteria 1497
126 Ga0501072_0009086 3300049588 Bacteria 7546
127 Ga0501072_0094574 3300049588 Bacteria 2374
128 Ga0501072_0316375 3300049588 Bacteria 1240
129 Ga0501072_0376992 3300049588 Bacteria 1126
130 Ga0501074_0015627 3300049590 Bacteria 5517
131 Ga0501075_0009169 3300049591 Bacteria 6915
132 Ga0501075_0103462 3300049591 Bacteria 2164
133 Ga0501076_0032006 3300049592 Bacteria 4104
134 Ga0501076_0513769 3300049592 Bacteria 987
135 Ga0501077_0032271 3300049593 Bacteria 3334
136 Ga0501077_0236028 3300049593 Bacteria 1162
137 Ga0501079_0004032 3300049741 Bacteria 10870
138 Ga0501079_0595235 3300049741 Bacteria 870
139 Ga0501080_0022325 3300049742 Bacteria 5862
140 Ga0501080_0090077 3300049742 Bacteria 2850
141 Ga0501080_0135053 3300049742 Bacteria 2283
142 Ga0501081_0003191 3300049743 Bacteria 10423
143 Ga0501083_0315088 3300049744 Bacteria 1017
144 Ga0501035_0526605 3300049822 Bacteria 970
145 Ga0501045_0021155 3300049824 Bacteria 4651
146 nmdc:mga0yw44_141_c1 3300050492 Bacteria 24781
147 nmdc:mga05p37_10151_c1 3300050507 Bacteria 11176
148 nmdc:mga0qj67_992912_c1 3300050509 Bacteria 659
149 nmdc:mga08y16_967945_c1 3300050511 Bacteria 833
150 nmdc:mga0n895_485850_c1 3300050512 Bacteria 1245
151 Ga0495619_0331947 3300053085 Bacteria 1053
152 Ga0500646_0001943 3300053090 Bacteria 5398
153 Ga0500594_0032320 3300053118 Bacteria 1385
154 Ga0500616_0000641 3300053153 Bacteria 42089
155 Ga0501084_0020740 3300054114 Bacteria 5481
156 Ga0501084_0411900 3300054114 Bacteria 1142
157 Ga0590075_041864 3300059424 Bacteria 1171
158 Ga0501082_0039244 3300060353 Bacteria 4085
159 Ga0501082_0449809 3300060353 Bacteria 1125
160 Ga0501082_1039814 3300060353 Bacteria 716
161 Ga0530510_0004848 3300061734 Bacteria 9311
162 Ga0530510_0386885 3300061734 Bacteria 1053
163 Ga0530510_0576459 3300061734 Bacteria 855
164 Ga0530510_0784329 3300061734 Bacteria 727
165 2501944796 2501939600 Bacteria 6907073
166 2645721096 2643221961 Bacteria 3919167
167 2832010017 2832004796 Bacteria 6538017
168 2856863711 2856858025 Bacteria 7255264
169 2858908448 2858902515 Bacteria 7086037
170 2866067230 2866065130 Bacteria 6518152
171 2867307615 2867302475 Bacteria 7087181
172 2867374368 2867369537 Bacteria 6501581
173 649814532 649633069 Bacteria 6962533
174 Ga0207646_10125577
175 rootL2_10019413
176 rootH1_10059114
177 Ga0070690_100705345
178 Ga0070689_100849501
179 Ga0070669_100989832
180 Ga0070675_100153089
181 Ga0070671_100342579
182 Ga0070710_10103238
183 Ga0070694_100210721
184 Ga0070707_100015496
185 Ga0070707_100028666
186 Ga0070707_100097562
187 Ga0070698_100687717
188 Ga0068854_100239334
189 Ga0068860_100298292
190 Ga0081455_10433698
191 Ga0081539_10117476
192 Ga0070717_10193265
193 Ga0070717_10453540
194 Ga0075365_10002782
195 Ga0075364_10024620
196 Ga0075428_100001862
197 Ga0075428_100385015
198 Ga0075428_100818667
199 Ga0111539_10233449
200 Ga0111539_10245691
201 Ga0111539_11165071
202 Ga0105242_10955941
203 Ga0105249_11315950
204 Ga0105239_10472872
205 Ga0105246_10987291
206 Ga0163162_10139271
207 Ga0157375_11801511
208 Ga0207684_10167080
209 Ga0207707_10351932
210 Ga0207663_10024170
211 Ga0207660_10436436
212 Ga0207646_10066171
213 Ga0207646_10071052
214 Ga0207646_11226254
215 Ga0207687_10049174
216 Ga0207700_10954617
217 Ga0207664_10766586
218 Ga0207706_10001313
219 Ga0207689_11184125
220 Ga0207675_100000976
221 Ga0268265_10370769
222 Ga0268264_10212689
223 Ga0307515_10190280
224 Ga0265760_10139736
225 Ga0265325_10043068
226 Ga0265340_10405608
227 Ga0265339_10035124
228 Ga0307408_100779138
229 Ga0265313_10000571
230 Ga0307508_10015007
231 Ga0316576_10138777
232 Ga0307405_10329879
233 Ga0307413_11163857
234 Ga0307410_10359120
235 Ga0307406_11033112
236 Ga0307407_10013943
237 Ga0307407_10180620
238 Ga0307412_10024308
239 Ga0307412_10141317
240 Ga0307412_11603617
241 Ga0307409_100018330
242 Ga0307416_100051545
243 Ga0307416_100235712
244 Ga0307416_100717455
245 Ga0307414_10316289
246 Ga0307411_10190999
247 Ga0307415_100004755
248 Ga0307415_100361841
249 Ga0373962_0001465
250 Ga0373935_0115713
251 Ga0373925_0013801
252 Ga0395900_1158585
253 Ga0395905_0799483
254 Ga0451807_1237807
255 Ga0466965_0387906
256 Ga0495590_0101579
257 Ga0495584_0066703
258 Ga0495616_0162874
259 Ga0495632_0189184
260 Ga0495663_0212242
261 Ga0495621_0245224
262 Ga0495670_0268949
263 Ga0495589_0202261
264 Ga0495600_0236061
265 Ga0496108_0305160
266 Ga0496108_0317848
267 Ga0496109_0375042
268 Ga0496110_0346235
269 Ga0496111_0295907
270 Ga0496112_0359182
271 Ga0496112_0613470
272 Ga0501033_0027751
273 Ga0501034_0006839
274 Ga0501034_0272347
275 Ga0501034_0294061
276 Ga0501036_0146112
277 Ga0501037_0131173
278 Ga0501038_0021687
279 Ga0501039_0019265
280 Ga0501039_0179962
281 Ga0501039_0315515
282 Ga0501040_0010940
283 Ga0501041_0009663
284 Ga0501042_0001332
285 Ga0501042_0290459
286 Ga0501046_0021487
287 Ga0501048_0013341
288 Ga0501067_0003726
289 Ga0501067_0161956
290 Ga0501068_0081870
291 Ga0501068_0117043
292 Ga0501068_0163614
293 Ga0501069_0360805
294 Ga0501070_0068929
295 Ga0501070_0503646
296 Ga0501071_0005000
297 Ga0501071_0012890
298 Ga0501071_0200991
299 Ga0501072_0009086
300 Ga0501072_0094574
301 Ga0501072_0316375
302 Ga0501072_0376992
303 Ga0501074_0015627
304 Ga0501075_0009169
305 Ga0501075_0103462
306 Ga0501076_0032006
307 Ga0501076_0513769
308 Ga0501077_0032271
309 Ga0501077_0236028
310 Ga0501079_0004032
311 Ga0501079_0595235
312 Ga0501080_0022325
313 Ga0501080_0090077
314 Ga0501080_0135053
315 Ga0501081_0003191
316 Ga0501083_0315088
317 Ga0501035_0526605
318 Ga0501045_0021155
319 nmdc:mga0yw44_141_c1
320 nmdc:mga05p37_10151_c1
321 nmdc:mga0qj67_992912_c1
322 nmdc:mga08y16_967945_c1
323 nmdc:mga0n895_485850_c1
324 Ga0495619_0331947
325 Ga0500646_0001943
326 Ga0500594_0032320
327 Ga0500616_0000641
328 Ga0501084_0020740
329 Ga0501084_0411900
330 Ga0590075_041864
331 Ga0501082_0039244
332 Ga0501082_0449809
333 Ga0501082_1039814
334 Ga0530510_0004848
335 Ga0530510_0386885
336 Ga0530510_0576459
337 Ga0530510_0784329
338 2501944796
339 2645721096
340 2832010017
341 2856863711
342 2858908448
343 2866067230
344 2867307615
345 2867374368
346 649814532

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

2

178

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
6pf7-assembly1.cif.gz_B crystal structure of ts-dhfr from cryptosporidium hominis in complex with nadph, fdump and 2-(4-((2-amino-4-oxo-4,7-dihydro-3h-pyrrolo[2,3-d]pyrimidin-5-yl)methyl)benzamido)benzoic acid 0.7295 1 143
6nq3-assembly1.cif.gz_C-3 crystal structure of a suz12-rbbp4-phf19-jarid2 heterotetrameric complex 0.7291 163 185
6ojs-assembly1.cif.gz_A crystal structure of ts-dhfr from cryptosporidium hominis in complex with nadph, fdump, mtx and 2-amino-4-oxo-4,7-dihydro-pyrrolo[2,3-d]pyrimidine-methyl-phenyl-d-glutamic acid 0.7231 1 143
2oip-assembly2.cif.gz_D crystal structure of the s290g active site mutant of ts-dhfr from cryptosporidium hominis 0.7229 1 143
3hj3-assembly2.cif.gz_D crystal structure of the chts-dhfr f207a non-active site mutant 0.7225 1 143
ID Description Score Start End Superfamily
af_K7LD07_1244_1331_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7919 156 184 2.40.50.140
af_Q95XM3_146_248_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.693 156 185 3.10.450.50
1qzfA01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.6647 1 187 3.40.430.10
5ecxB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.6606 3 182 3.40.430.10
2gd9B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.6467 3 183 3.40.430.10
ID Description Score Start End GO Terms
AF-A0A6J4VDS3-F1-model_v4 Dihydrofolate reductase (EC 1.5.1.3) 0.9703 1 145 GO:0004146
GO:0008703
GO:0009231
AF-A0A529UW95-F1-model_v4 deleted 0.9458 1 147
AF-A0A4S0LIP9-F1-model_v4 deleted 0.9395 1 91
AF-A0A6J4VDS3-F1-model_v4 Dihydrofolate reductase (EC 1.5.1.3) 0.9386 1 145 GO:0004146
GO:0008703
GO:0009231
AF-A0A7X6NGW5-F1-model_v4 deleted 0.938 1 142

Map