F262376

General Info

Members Datasets Scaffolds Average Seq Length
173 140 153 285

Family's Representative Sequence

Representative Sequence 3300006048|Ga0075363_100196305|Ga0075363_1001963051
Length 313
Sequence MYPLVRELAATDAPIRIPVAVTCRILGFSKQAFYHWLREPVSDRTWDEAHLINAAYDIHADDPAFGYRFIADELAEQGFTASERRVWRLCSQHKLWSMFAKDVVDAARPAHRSMTTTCSDSSPHHDQTSCGSRISPNTAQLGFQQSSQHLLEGVAVAGIQAGTGKLYLCAIKDVYSNRIVGYSIDSRMKASLAVSALRMSISRREPEGTVVHSDRGSQFRSKKFVRVLANNGLVGSMGRVGACGDNASMESFFSLLQNNVLDTRRWATQQELRIAIVTWIERTYHRRRRQRALGKLTPIEYEMIMTPANMLAA

Samples

Sample ID Description Type Environment
1 2582580736 Prauserella sp. Am3 Isolate Unclassified
2 2643221553 Microbacterium sp. Root553 Isolate Unclassified
3 2643221692 Nocardia sp. Root136 Isolate Unclassified
4 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
5 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
6 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
7 2857479173 Micrococcus sp. R-74225 Isolate Unclassified
8 2857710386 Brevibacterium sp. R-73093 Isolate Unclassified
9 2870801768 Micrococcus endophyticus DSM 17945 Isolate Unclassified
10 2904430863 Curtobacterium oceanosedimentum 1519 Isolate Rhizosphere
11 2904501621 Curtobacterium sp. 1909 Isolate Unclassified
12 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
13 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
14 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
15 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
16 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
33 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
34 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
37 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
38 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
39 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
40 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
60 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
61 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
62 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
63 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
64 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
65 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
66 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
67 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
68 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
69 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
70 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
71 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
72 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
73 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
74 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
75 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
76 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
77 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
78 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
79 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
80 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
81 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
82 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
83 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
84 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
85 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
86 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
87 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
88 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
89 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
90 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
91 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
92 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
93 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
94 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
95 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
96 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
97 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
98 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
99 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
100 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
101 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
102 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
103 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
104 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
105 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
106 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
107 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
108 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
109 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
110 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
111 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
112 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
113 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
126 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
127 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
128 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
130 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
131 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
132 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
133 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
134 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
135 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
136 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
137 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
138 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
139 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
140 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 87.28
Metatranscriptomes 1.16
Isolates 11.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.51
Nodule 0
Rhizoplane 8.09
Rhizosphere 76.88
Stem 0
Stem Tuber 0
Unclassified 7.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1005001 3300001977 Bacteria 2076
2 JGI24737J22298_10039168 3300001990 Bacteria 1458
3 JGI24744J21845_10024312 3300002077 Bacteria 1185
4 JGI25405J52794_10016908 3300003911 Bacteria 1444
5 JGI25405J52794_10020443 3300003911 Bacteria 1333
6 Ga0070658_10353763 3300005327 Bacteria 1257
7 Ga0070677_10060034 3300005333 Bacteria 1565
8 Ga0070680_100230245 3300005336 Bacteria 1565
9 Ga0068868_100378695 3300005338 Bacteria 1217
10 Ga0070668_100019000 3300005347 Bacteria 5164
11 Ga0070714_100327247 3300005435 Bacteria 1434
12 Ga0070713_100251836 3300005436 Bacteria 1611
13 Ga0070713_100367426 3300005436 Bacteria 1338
14 Ga0070711_100239695 3300005439 Bacteria 1417
15 Ga0070663_100240910 3300005455 Bacteria 1427
16 Ga0070684_100383330 3300005535 Bacteria 1295
17 Ga0068853_100251471 3300005539 Bacteria 1622
18 Ga0070672_100225889 3300005543 Bacteria 1571
19 Ga0068856_100181951 3300005614 Bacteria 2115
20 Ga0081455_10059973 3300005937 Bacteria 3210
21 Ga0070717_10385579 3300006028 Bacteria 1257
22 Ga0075365_10127424 3300006038 Bacteria 1760
23 Ga0075365_10193772 3300006038 Bacteria 1423
24 Ga0075363_100196305 3300006048 Bacteria 1152
25 Ga0075364_10226565 3300006051 Bacteria 1269
26 Ga0105245_10221560 3300009098 Bacteria 1826
27 Ga0105247_10168964 3300009101 Bacteria 1453
28 Ga0105238_10566517 3300009551 Bacteria 1141
29 Ga0105029_101921 3300009984 Bacteria 1325
30 Ga0105246_10032063 3300011119 Bacteria 3482
31 Ga0157371_10332721 3300013102 Bacteria 1104
32 Ga0157370_10120246 3300013104 Bacteria 2452
33 Ga0157369_10362643 3300013105 Bacteria 1504
34 Ga0157369_10457597 3300013105 Bacteria 1321
35 Ga0157374_10433663 3300013296 Bacteria 1314
36 Ga0157372_10065314 3300013307 Bacteria 4085
37 Ga0157372_10393365 3300013307 Bacteria 1615
38 Ga0157372_10394884 3300013307 Bacteria 1612
39 Ga0163163_10193472 3300014325 Bacteria 2082
40 Ga0209051_1049074 3300025303 Bacteria 1425
41 Ga0207647_10061507 3300025904 Bacteria 2291
42 Ga0207705_10288670 3300025909 Bacteria 1257
43 Ga0207660_10306861 3300025917 Bacteria 1265
44 Ga0207659_10411106 3300025926 Bacteria 1133
45 Ga0207700_10280292 3300025928 Bacteria 1434
46 Ga0207700_10371371 3300025928 Bacteria 1249
47 Ga0207664_10342397 3300025929 Bacteria 1322
48 Ga0207690_10280999 3300025932 Bacteria 1296
49 Ga0207665_10158174 3300025939 Bacteria 1628
50 Ga0207668_10220528 3300025972 Bacteria 1522
51 Ga0207639_10259326 3300026041 Bacteria 1519
52 Ga0207678_10056380 3300026067 Bacteria 3382
53 Ga0207702_10419368 3300026078 Bacteria 1294
54 Ga0265334_10065307 3300028573 Bacteria 1365
55 Ga0265338_10222831 3300028800 Bacteria 1407
56 Ga0265330_10086663 3300031235 Bacteria 1346
57 Ga0265320_10098709 3300031240 Bacteria 1346
58 Ga0265325_10076677 3300031241 Bacteria 1667
59 Ga0265340_10110324 3300031247 Bacteria 1272
60 Ga0265339_10118567 3300031249 Bacteria 1362
61 Ga0265316_10124230 3300031344 Bacteria 1947
62 Ga0307408_100265543 3300031548 Bacteria 1422
63 Ga0307408_100419145 3300031548 Bacteria 1154
64 Ga0265313_10078141 3300031595 Bacteria 1509
65 Ga0307508_10260433 3300031616 Bacteria 1329
66 Ga0265342_10146298 3300031712 Bacteria 1315
67 Ga0307405_10136887 3300031731 Bacteria 1701
68 Ga0307410_10186491 3300031852 Bacteria 1574
69 Ga0307406_10239788 3300031901 Bacteria 1359
70 Ga0307407_10175252 3300031903 Bacteria 1416
71 Ga0307412_10196546 3300031911 Bacteria 1528
72 Ga0307409_100274585 3300031995 Bacteria 1554
73 Ga0307416_100427534 3300032002 Bacteria 1370
74 Ga0307415_100146323 3300032126 Bacteria 1812
75 Ga0373950_0024449 3300034818 Bacteria 1086
76 Ga0373937_0482594 3300036401 Bacteria 1177
77 Ga0316584_0227037 3300036712 Bacteria 1370
78 Ga0373925_0006708 3300037068 Bacteria 8446
79 Ga0395898_0343828 3300037466 Bacteria 1423
80 Ga0395901_0469495 3300038443 Bacteria 1285
81 Ga0451802_0474110 3300041460 Bacteria 2325
82 Ga0451833_1219930 3300041491 Bacteria 1151
83 Ga0466965_0059436 3300044683 Bacteria 1908
84 Ga0466966_0210107 3300044684 Bacteria 1176
85 Ga0466959_0285072 3300045049 Bacteria 1133
86 Ga0466967_0408738 3300045976 Bacteria 1322
87 Ga0495606_0009073 3300046507 Bacteria 8480
88 Ga0495608_0210426 3300046511 Bacteria 1223
89 Ga0495631_0097496 3300046518 Bacteria 1265
90 Ga0495643_0109074 3300046522 Bacteria 1409
91 Ga0495643_0126025 3300046522 Bacteria 1289
92 Ga0495642_0063823 3300046528 Bacteria 1531
93 Ga0495668_0005384 3300046616 Bacteria 8705
94 Ga0495668_0134977 3300046616 Bacteria 1350
95 Ga0495625_0007868 3300046660 Bacteria 9184
96 Ga0495588_0004131 3300046674 Bacteria 6394
97 Ga0495669_0046373 3300046684 Bacteria 1939
98 Ga0495581_0037494 3300047315 Bacteria 2806
99 Ga0495683_0043972 3300047323 Bacteria 2247
100 Ga0495677_0057252 3300047445 Bacteria 1440
101 Ga0495626_0004002 3300048091 Bacteria 9211
102 Ga0496100_0183260 3300048903 Bacteria 1515
103 Ga0496101_0583939 3300048904 Bacteria 883
104 Ga0496104_0369655 3300048907 Bacteria 1346
105 Ga0496105_0222409 3300048908 Bacteria 1536
106 Ga0496108_0143511 3300048911 Bacteria 2057
107 Ga0496108_0188205 3300048911 Bacteria 1789
108 Ga0496108_0257353 3300048911 Bacteria 1519
109 Ga0496109_0414522 3300048912 Bacteria 1273
110 Ga0496112_0043721 3300048915 Bacteria 4387
111 Ga0496112_0227439 3300048915 Bacteria 1820
112 Ga0496112_0346937 3300048915 Bacteria 1427
113 Ga0496113_0472454 3300048916 Bacteria 1007
114 Ga0496114_0327048 3300048917 Bacteria 1355
115 Ga0501031_0035014 3300049568 Bacteria 3275
116 Ga0501032_0037127 3300049569 Bacteria 3323
117 Ga0501033_0000832 3300049570 Bacteria 28163
118 Ga0501033_0001716 3300049570 Bacteria 19176
119 Ga0501033_0143410 3300049570 Bacteria 1726
120 Ga0501034_0049847 3300049571 Bacteria 4224
121 Ga0501034_0410244 3300049571 Bacteria 1277
122 Ga0501036_0003881 3300049572 Bacteria 11993
123 Ga0501037_0042522 3300049573 Bacteria 3338
124 Ga0501037_0044019 3300049573 Bacteria 3279
125 Ga0501038_0076572 3300049574 Bacteria 2825
126 Ga0501039_0010922 3300049575 Bacteria 6920
127 Ga0501043_0022724 3300049579 Bacteria 4918
128 Ga0501043_0117345 3300049579 Bacteria 2088
129 Ga0501043_0191890 3300049579 Bacteria 1588
130 Ga0501046_0000808 3300049580 Bacteria 30409
131 Ga0501047_0052084 3300049581 Bacteria 3955
132 Ga0501047_0087467 3300049581 Bacteria 2993
133 Ga0501048_0000813 3300049582 Bacteria 22946
134 Ga0501070_0026568 3300049586 Bacteria 4857
135 Ga0501073_0029243 3300049589 Bacteria 3937
136 Ga0501080_0289831 3300049742 Bacteria 1486
137 Ga0501035_0142382 3300049822 Bacteria 2084
138 Ga0501044_0022162 3300049823 Bacteria 6772
139 Ga0501044_0049586 3300049823 Bacteria 4334
140 Ga0501044_0119819 3300049823 Bacteria 2633
141 Ga0501044_0165703 3300049823 Bacteria 2184
142 nmdc:mga0yw44_153201_c1 3300050492 Bacteria 1505
143 nmdc:mga0yw44_183317_c1 3300050492 Bacteria 1379
144 nmdc:mga0yw44_97964_c1 3300050492 Bacteria 1863
145 Ga0495619_0071145 3300053085 Bacteria 2327
146 Ga0500641_0014190 3300053096 Bacteria 2937
147 Ga0500556_0001515 3300053104 Bacteria 9587
148 Ga0500652_001308 3300053131 Bacteria 7866
149 Ga0500658_0072068 3300053134 Bacteria 1460
150 Ga0500634_0097195 3300053161 Bacteria 1482
151 Ga0587090_000064 3300059510 Bacteria 5852
152 Ga0587115_006943 3300059626 Bacteria 1323
153 Ga0466962_0104015 3300061719 Bacteria 1364

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025926 Ga0207659_10411106 Ga0207659_104111062 229
2 3300053161 Ga0500634_0097195 Ga0500634_0097195_595_1314 233
3 iso_pu_bacteria 2643221553 2643783603 236
4 3300048911 Ga0496108_0188205 Ga0496108_0188205_837_1559 239
5 3300037068 Ga0373925_0006708 Ga0373925_0006708_513_1274 241
6 3300048915 Ga0496112_0043721 Ga0496112_0043721_29_790 253
7 iso_pu_bacteria 2751185788 2753303924 264
8 iso_pu_bacteria 2582580736 2583153035 265
9 3300046511 Ga0495608_0210426 Ga0495608_0210426_194_1012 266
10 3300013307 Ga0157372_10394884 Ga0157372_103948842 268
11 3300003911 JGI25405J52794_10016908 JGI25405J52794_100169082 269
12 3300003911 JGI25405J52794_10020443 JGI25405J52794_100204432 269
13 3300005455 Ga0070663_100240910 Ga0070663_1002409102 269
14 3300005937 Ga0081455_10059973 Ga0081455_100599733 269
15 3300006051 Ga0075364_10226565 Ga0075364_102265652 269
16 3300013105 Ga0157369_10457597 Ga0157369_104575971 269
17 3300013307 Ga0157372_10065314 Ga0157372_100653145 269
18 3300026067 Ga0207678_10056380 Ga0207678_100563803 269
19 3300031548 Ga0307408_100419145 Ga0307408_1004191451 269
20 3300048904 Ga0496101_0583939 Ga0496101_0583939_50_865 269
21 3300049573 Ga0501037_0042522 Ga0501037_0042522_36_851 269
22 iso_pu_bacteria 8003314358 8003323741 271
23 3300038443 Ga0395901_0469495 Ga0395901_0469495_152_1015 272
24 3300005347 Ga0070668_100019000 Ga0070668_1000190005 274
25 3300025972 Ga0207668_10220528 Ga0207668_102205283 274
26 3300031548 Ga0307408_100265543 Ga0307408_1002655432 278
27 3300031731 Ga0307405_10136887 Ga0307405_101368872 278
28 3300031852 Ga0307410_10186491 Ga0307410_101864913 278
29 3300031901 Ga0307406_10239788 Ga0307406_102397883 278
30 3300031903 Ga0307407_10175252 Ga0307407_101752521 278
31 3300031911 Ga0307412_10196546 Ga0307412_101965463 278
32 3300031995 Ga0307409_100274585 Ga0307409_1002745851 278
33 3300032002 Ga0307416_100427534 Ga0307416_1004275342 278
34 3300032126 Ga0307415_100146323 Ga0307415_1001463234 278
35 3300048911 Ga0496108_0257353 Ga0496108_0257353_499_1356 278
36 3300048915 Ga0496112_0346937 Ga0496112_0346937_227_1093 278
37 3300050492 nmdc:mga0yw44_97964_c1 nmdc:mga0yw44_97964_c1_280_1158 278
38 3300049823 Ga0501044_0165703 Ga0501044_0165703_369_1256 280
39 3300005327 Ga0070658_10353763 Ga0070658_103537632 281
40 3300005336 Ga0070680_100230245 Ga0070680_1002302452 281
41 3300005338 Ga0068868_100378695 Ga0068868_1003786952 281
42 3300005435 Ga0070714_100327247 Ga0070714_1003272471 281
43 3300005436 Ga0070713_100251836 Ga0070713_1002518361 281
44 3300005439 Ga0070711_100239695 Ga0070711_1002396951 281
45 3300005535 Ga0070684_100383330 Ga0070684_1003833302 281
46 3300005539 Ga0068853_100251471 Ga0068853_1002514713 281
47 3300005614 Ga0068856_100181951 Ga0068856_1001819512 281
48 3300006028 Ga0070717_10385579 Ga0070717_103855791 281
49 3300006038 Ga0075365_10127424 Ga0075365_101274243 281
50 3300006038 Ga0075365_10193772 Ga0075365_101937721 281
51 3300009098 Ga0105245_10221560 Ga0105245_102215603 281
52 3300009101 Ga0105247_10168964 Ga0105247_101689641 281
53 3300009551 Ga0105238_10566517 Ga0105238_105665171 281
54 3300009984 Ga0105029_101921 Ga0105029_1019211 281
55 3300011119 Ga0105246_10032063 Ga0105246_100320634 281
56 3300013102 Ga0157371_10332721 Ga0157371_103327212 281
57 3300013104 Ga0157370_10120246 Ga0157370_101202462 281
58 3300013296 Ga0157374_10433663 Ga0157374_104336631 281
59 3300013307 Ga0157372_10393365 Ga0157372_103933652 281
60 3300014325 Ga0163163_10193472 Ga0163163_101934724 281
61 3300025303 Ga0209051_1049074 Ga0209051_10490741 281
62 3300025904 Ga0207647_10061507 Ga0207647_100615072 281
63 3300025909 Ga0207705_10288670 Ga0207705_102886702 281
64 3300025917 Ga0207660_10306861 Ga0207660_103068612 281
65 3300025928 Ga0207700_10280292 Ga0207700_102802921 281
66 3300025929 Ga0207664_10342397 Ga0207664_103423971 281
67 3300025932 Ga0207690_10280999 Ga0207690_102809991 281
68 3300025939 Ga0207665_10158174 Ga0207665_101581742 281
69 3300026041 Ga0207639_10259326 Ga0207639_102593262 281
70 3300026078 Ga0207702_10419368 Ga0207702_104193682 281
71 3300028573 Ga0265334_10065307 Ga0265334_100653072 281
72 3300028800 Ga0265338_10222831 Ga0265338_102228313 281
73 3300031235 Ga0265330_10086663 Ga0265330_100866633 281
74 3300031240 Ga0265320_10098709 Ga0265320_100987093 281
75 3300031241 Ga0265325_10076677 Ga0265325_100766772 281
76 3300031247 Ga0265340_10110324 Ga0265340_101103242 281
77 3300031249 Ga0265339_10118567 Ga0265339_101185672 281
78 3300031344 Ga0265316_10124230 Ga0265316_101242303 281
79 3300031595 Ga0265313_10078141 Ga0265313_100781413 281
80 3300031616 Ga0307508_10260433 Ga0307508_102604332 281
81 3300031712 Ga0265342_10146298 Ga0265342_101462982 281
82 3300036401 Ga0373937_0482594 Ga0373937_0482594_296_1162 281
83 3300037466 Ga0395898_0343828 Ga0395898_0343828_514_1377 281
84 3300044683 Ga0466965_0059436 Ga0466965_0059436_368_1231 281
85 3300044684 Ga0466966_0210107 Ga0466966_0210107_263_1126 281
86 3300045049 Ga0466959_0285072 Ga0466959_0285072_37_900 281
87 3300045976 Ga0466967_0408738 Ga0466967_0408738_107_970 281
88 3300046518 Ga0495631_0097496 Ga0495631_0097496_39_902 281
89 3300046522 Ga0495643_0109074 Ga0495643_0109074_413_1276 281
90 3300046522 Ga0495643_0126025 Ga0495643_0126025_411_1274 281
91 3300046528 Ga0495642_0063823 Ga0495642_0063823_223_1086 281
92 3300046616 Ga0495668_0134977 Ga0495668_0134977_117_980 281
93 3300046674 Ga0495588_0004131 Ga0495588_0004131_5115_5978 281
94 3300047315 Ga0495581_0037494 Ga0495581_0037494_1272_2135 281
95 3300047445 Ga0495677_0057252 Ga0495677_0057252_525_1388 281
96 3300048903 Ga0496100_0183260 Ga0496100_0183260_419_1285 281
97 3300048907 Ga0496104_0369655 Ga0496104_0369655_303_1169 281
98 3300048908 Ga0496105_0222409 Ga0496105_0222409_622_1488 281
99 3300048911 Ga0496108_0143511 Ga0496108_0143511_418_1284 281
100 3300048912 Ga0496109_0414522 Ga0496109_0414522_361_1227 281
101 3300048915 Ga0496112_0227439 Ga0496112_0227439_93_959 281
102 3300048916 Ga0496113_0472454 Ga0496113_0472454_93_959 281
103 3300048917 Ga0496114_0327048 Ga0496114_0327048_118_984 281
104 3300049570 Ga0501033_0143410 Ga0501033_0143410_501_1376 281
105 3300049571 Ga0501034_0410244 Ga0501034_0410244_31_906 281
106 3300049579 Ga0501043_0117345 Ga0501043_0117345_361_1236 281
107 3300049579 Ga0501043_0191890 Ga0501043_0191890_375_1253 281
108 3300049581 Ga0501047_0087467 Ga0501047_0087467_554_1429 281
109 3300049822 Ga0501035_0142382 Ga0501035_0142382_515_1390 281
110 3300049823 Ga0501044_0049586 Ga0501044_0049586_1841_2716 281
111 3300050492 nmdc:mga0yw44_153201_c1 nmdc:mga0yw44_153201_c1_601_1464 281
112 3300050492 nmdc:mga0yw44_183317_c1 nmdc:mga0yw44_183317_c1_131_994 281
113 3300053085 Ga0495619_0071145 Ga0495619_0071145_801_1664 281
114 3300053096 Ga0500641_0014190 Ga0500641_0014190_544_1407 281
115 3300053104 Ga0500556_0001515 Ga0500556_0001515_93_1010 281
116 3300059510 Ga0587090_000064 Ga0587090_000064_545_1423 281
117 3300059626 Ga0587115_006943 Ga0587115_006943_89_967 281
118 3300061719 Ga0466962_0104015 Ga0466962_0104015_390_1253 281
119 iso_pu_bacteria 2816332119 2816420632 281
120 iso_pu_bacteria 2816332119 2816422499 281
121 iso_pu_bacteria 2816332119 2816422558 281
122 iso_pu_bacteria 2816332119 2816423104 281
123 iso_pu_bacteria 2816332119 2816423646 281
124 iso_pu_bacteria 2816332119 2816424703 281
125 iso_pu_bacteria 2816332119 2816425049 281
126 iso_pu_bacteria 2857479173 2857481379 281
127 iso_pu_bacteria 2857710386 2857712734 281
128 iso_pu_bacteria 2974315732 2974315838 281
129 3300053131 Ga0500652_001308 Ga0500652_001308_6417_7265 282
130 3300053134 Ga0500658_0072068 Ga0500658_0072068_361_1242 282
131 iso_pu_bacteria 2643221553 2643783882 282
132 3300006048 Ga0075363_100196305 Ga0075363_1001963051 283
133 3300046684 Ga0495669_0046373 Ga0495669_0046373_929_1816 283
134 3300049568 Ga0501031_0035014 Ga0501031_0035014_1909_2778 283
135 3300049569 Ga0501032_0037127 Ga0501032_0037127_1113_1982 283
136 3300049570 Ga0501033_0001716 Ga0501033_0001716_3004_3873 283
137 3300049571 Ga0501034_0049847 Ga0501034_0049847_2569_3438 283
138 3300049572 Ga0501036_0003881 Ga0501036_0003881_10245_11114 283
139 3300049573 Ga0501037_0044019 Ga0501037_0044019_1531_2400 283
140 3300049574 Ga0501038_0076572 Ga0501038_0076572_852_1721 283
141 3300049575 Ga0501039_0010922 Ga0501039_0010922_3928_4797 283
142 3300049579 Ga0501043_0022724 Ga0501043_0022724_1504_2373 283
143 3300049580 Ga0501046_0000808 Ga0501046_0000808_19120_19989 283
144 3300049581 Ga0501047_0052084 Ga0501047_0052084_1664_2533 283
145 3300049582 Ga0501048_0000813 Ga0501048_0000813_20144_21013 283
146 3300049586 Ga0501070_0026568 Ga0501070_0026568_1741_2610 283
147 3300049589 Ga0501073_0029243 Ga0501073_0029243_2401_3270 283
148 3300049742 Ga0501080_0289831 Ga0501080_0289831_193_1062 283
149 3300049823 Ga0501044_0022162 Ga0501044_0022162_4202_5071 283
150 iso_pu_bacteria 2904430863 2904431162 283
151 iso_pu_bacteria 2904501621 2904502595 283
152 3300036712 Ga0316584_0227037 Ga0316584_0227037_86_955 284
153 3300001977 JGI24746J21847_1005001 JGI24746J21847_10050013 285
154 3300001990 JGI24737J22298_10039168 JGI24737J22298_100391682 285
155 3300002077 JGI24744J21845_10024312 JGI24744J21845_100243121 285
156 3300005333 Ga0070677_10060034 Ga0070677_100600342 285
157 3300005436 Ga0070713_100367426 Ga0070713_1003674261 285
158 3300005543 Ga0070672_100225889 Ga0070672_1002258893 285
159 3300013105 Ga0157369_10362643 Ga0157369_103626432 285
160 3300025928 Ga0207700_10371371 Ga0207700_103713711 285
161 3300034818 Ga0373950_0024449 Ga0373950_0024449_173_1030 285
162 3300041460 Ga0451802_0474110 Ga0451802_0474110_895_1794 285
163 3300041491 Ga0451833_1219930 Ga0451833_1219930_155_1054 285
164 3300046507 Ga0495606_0009073 Ga0495606_0009073_2072_2932 285
165 3300046616 Ga0495668_0005384 Ga0495668_0005384_2079_2939 285
166 3300046660 Ga0495625_0007868 Ga0495625_0007868_6293_7153 285
167 3300047323 Ga0495683_0043972 Ga0495683_0043972_151_1011 285
168 3300048091 Ga0495626_0004002 Ga0495626_0004002_2081_2941 285
169 3300049570 Ga0501033_0000832 Ga0501033_0000832_15588_16463 285
170 3300049823 Ga0501044_0119819 Ga0501044_0119819_1726_2601 285
171 iso_pu_bacteria 2643221692 2644512732 285
172 iso_pu_bacteria 2744054611 2744955464 285
173 iso_pu_bacteria 2870801768 2870803360 285

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13333

rve_2

Integrase core domain

250

304

0.97

PF13683

rve_3

Integrase core domain

231

298

0.95

PF00665

rve

Integrase core domain

152

243

0.94

PF13276

HTH_21

HTH-like domain

45

101

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ue1-assembly1.cif.gz_B hiv-1 integrase catalytic core domain mutant (kgd) in complex with inhibitor grl-142 0.825 120 253
1asv-assembly1.cif.gz_A avian sarcoma virus integrase catalytic core domain 0.8063 116 252
2x6s-assembly2.cif.gz_D human foamy virus integrase - catalytic core. magnesium-bound structure. 0.7989 119 237
7jn3-assembly1.cif.gz_H cryo-em structure of rous sarcoma virus cleaved synaptic complex (csc) with hiv-1 integrase strand transfer inhibitor mk-2048 0.7942 116 249
7ku7-assembly1.cif.gz_F cryo-em structure of rous sarcoma virus cleaved synaptic complex (csc) with hiv-1 integrase strand transfer inhibitor mk-2048. cluster identified by 3-dimensional variability analysis in cryosparc. 0.7913 118 248
ID Description Score Start End Superfamily
af_Q47718_102_174_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9544 113 183 3.30.420.10
af_P9WKH9_102_261_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9405 116 253 3.30.420.10
af_Q47718_102_174_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9172 113 183 3.30.420.10
af_P0CF80_124_283_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9071 115 274 3.30.420.10
af_P0CF80_124_283_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9016 115 274 3.30.420.10
ID Description Score Start End GO Terms
AF-A0A1V3SM83-F1-model_v4 Transposase 0.9705 115 206 GO:0003676
GO:0015074
AF-A0A246JJB7-F1-model_v4 IS3 family transposase 0.9655 123 260 GO:0003676
GO:0015074
AF-A0A4D4KWJ8-F1-model_v4 Integrase catalytic domain-containing protein 0.9647 106 188 GO:0003676
GO:0015074
AF-A0A2H0P6T9-F1-model_v4 IS3 family transposase 0.9633 115 256 GO:0003676
GO:0015074
AF-A0A4R5IIF9-F1-model_v4 IS3 family transposase 0.9588 103 253 GO:0003676
GO:0015074

Feature Viewer

pLDDT pTM Quality
81.54 0.63 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map