F262325

General Info

Members Datasets Scaffolds Average Seq Length
173 110 346 157

Family's Representative Sequence

Representative Sequence 3300005719|Ga0068861_100565999|Ga0068861_1005659992
Length 150
Sequence MIDSGGPAPDFTLNDQDGKPVTLSDLRGKWALVYFYPMADTPGCTAQACSARDHSADYEAANAVVLGVSPDSVEDLHKFADKYGLAFTLLSDEGGKVAQRYGAWIEKDGYHFNERSSVLVDPEGNIARVFPKVKPAEHDELVLGALNELA

Samples

Sample ID Description Type Environment
1 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
2 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
3 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
4 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
5 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
6 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
7 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
8 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
9 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
10 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
11 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
12 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
13 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
14 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
15 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
16 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
17 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
18 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
19 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
20 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
21 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
22 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
23 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
24 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
36 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
37 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
38 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
39 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
40 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
41 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
42 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
43 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
44 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
45 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
46 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
47 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
48 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
49 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
50 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
51 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
52 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
53 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
54 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
55 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
56 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
57 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
58 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
59 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
60 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
61 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
62 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
63 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
64 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
65 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
66 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
67 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
68 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
69 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
70 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
71 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
72 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
73 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
74 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
75 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
76 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
77 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
78 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
79 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
80 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
81 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
82 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
83 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
84 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
85 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
86 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
87 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
88 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
89 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
90 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
91 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
92 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
93 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
94 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
95 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
96 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
97 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
98 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
99 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
100 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
101 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
102 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
103 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
105 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
106 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
107 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
108 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
109 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
110 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.42
Metatranscriptomes 0.58
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 9.83
Rhizosphere 74.57
Stem 0
Stem Tuber 0
Unclassified 0.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068861_100565999 3300005719 Bacteria 1038
2 Ga0070682_100000032 3300005337 Bacteria 155141
3 Ga0070668_100762752 3300005347 Bacteria 857
4 Ga0070714_100037174 3300005435 Bacteria 4090
5 Ga0070714_100901241 3300005435 Bacteria 859
6 Ga0070713_100040110 3300005436 Bacteria 3805
7 Ga0070713_100116076 3300005436 Bacteria 2341
8 Ga0070710_10071294 3300005437 Bacteria 2003
9 Ga0070693_100025130 3300005547 Bacteria 3203
10 Ga0070664_100090653 3300005564 Bacteria 2646
11 Ga0068858_100068710 3300005842 Bacteria 3283
12 Ga0081455_10076666 3300005937 Bacteria 2753
13 Ga0070717_10189699 3300006028 Bacteria 1796
14 Ga0070717_10529488 3300006028 Bacteria 1066
15 Ga0070717_10532092 3300006028 Bacteria 1064
16 Ga0070712_100002787 3300006175 Bacteria 10793
17 Ga0075428_100605845 3300006844 Bacteria 1170
18 Ga0075430_100267964 3300006846 Bacteria 1414
19 Ga0075430_100652029 3300006846 Bacteria 868
20 Ga0105247_10080181 3300009101 Bacteria 2055
21 Ga0114129_10531145 3300009147 Bacteria 1532
22 Ga0157369_12061413 3300013105 Bacteria 579
23 Ga0157372_10871299 3300013307 Bacteria 1045
24 Ga0157375_12703387 3300013308 Bacteria 593
25 Ga0206356_10196433 3300020070 Bacteria 788
26 Ga0213874_10003162 3300021377 Bacteria 3628
27 Ga0213874_10146896 3300021377 Bacteria 820
28 Ga0213876_10023928 3300021384 Bacteria 3225
29 Ga0213876_10037237 3300021384 Bacteria 2566
30 Ga0213876_10056925 3300021384 Bacteria 2064
31 Ga0213876_10075112 3300021384 Bacteria 1785
32 Ga0213876_10202187 3300021384 Bacteria 1056
33 Ga0213875_10030756 3300021388 Bacteria 2541
34 Ga0213875_10074756 3300021388 Bacteria 1581
35 Ga0207692_10045468 3300025898 Bacteria 2196
36 Ga0207692_10468618 3300025898 Bacteria 795
37 Ga0207710_10066702 3300025900 Bacteria 1642
38 Ga0207699_10092252 3300025906 Bacteria 1903
39 Ga0207693_10003621 3300025915 Bacteria 13198
40 Ga0207664_10265421 3300025929 Bacteria 1502
41 Ga0207644_10706835 3300025931 Bacteria 841
42 Ga0207661_10075688 3300025944 Bacteria 2763
43 Ga0207679_10117000 3300025945 Bacteria 2115
44 Ga0207668_10514338 3300025972 Bacteria 1032
45 Ga0207703_10084108 3300026035 Bacteria 2660
46 Ga0207675_100572343 3300026118 Bacteria 1130
47 Ga0307408_100129746 3300031548 Bacteria 1965
48 Ga0307405_10489574 3300031731 Bacteria 983
49 Ga0307410_10879389 3300031852 Bacteria 766
50 Ga0307406_10072953 3300031901 Bacteria 2255
51 Ga0307406_10370772 3300031901 Bacteria 1125
52 Ga0307409_100082311 3300031995 Bacteria 2605
53 Ga0307409_100489038 3300031995 Bacteria 1196
54 Ga0307416_101013755 3300032002 Bacteria 933
55 Ga0307415_100009401 3300032126 Bacteria 5476
56 Ga0307415_100063728 3300032126 Bacteria 2562
57 Ga0316585_10059762 3300032137 Bacteria 1230
58 Ga0373924_0014254 3300035410 Bacteria 3002
59 Ga0373935_0786603 3300035692 Bacteria 702
60 Ga0373933_0055863 3300035724 Bacteria 2369
61 Ga0373937_0034517 3300036401 Bacteria 4601
62 Ga0316584_0058999 3300036712 Bacteria 2873
63 Ga0316584_0075690 3300036712 Bacteria 2522
64 Ga0395900_0565600 3300037418 Bacteria 1080
65 Ga0395898_0063119 3300037466 Bacteria 3595
66 Ga0395898_0102077 3300037466 Bacteria 2754
67 Ga0395898_0182462 3300037466 Bacteria 2006
68 Ga0395905_0029618 3300037471 Bacteria 5159
69 Ga0436364_0409817 3300037853 Bacteria 1169
70 Ga0436364_0649964 3300037853 Bacteria 11355
71 Ga0436364_0752511 3300037853 Bacteria 619
72 Ga0436364_0859011 3300037853 Bacteria 686
73 Ga0436364_1340105 3300037853 Bacteria 1491
74 Ga0436364_1406113 3300037853 Bacteria 4338
75 Ga0395901_0013362 3300038443 Bacteria 8343
76 Ga0395901_0383261 3300038443 Bacteria 1447
77 Ga0436365_0226538 3300039437 Bacteria 1366
78 Ga0436365_1085630 3300039437 Bacteria 7646
79 Ga0436365_1119421 3300039437 Bacteria 1804
80 Ga0436365_1242127 3300039437 Bacteria 19090
81 Ga0436365_1352347 3300039437 Bacteria 5574
82 Ga0436365_1553003 3300039437 Bacteria 2850
83 Ga0436361_0005155 3300039447 Bacteria 716
84 Ga0436363_0275177 3300039450 Bacteria 88978
85 Ga0436363_0347307 3300039450 Bacteria 769
86 Ga0436363_1010160 3300039450 Bacteria 4033
87 Ga0436363_1354558 3300039450 Unclassified 1521
88 Ga0436363_1464408 3300039450 Bacteria 1035
89 Ga0436363_1587204 3300039450 Bacteria 1361
90 Ga0436362_0712885 3300039453 Bacteria 2519
91 Ga0436362_0875519 3300039453 Bacteria 1849
92 Ga0436362_1231934 3300039453 Bacteria 794
93 Ga0466969_0075198 3300044656 Bacteria 1619
94 Ga0466969_0463883 3300044656 Bacteria 577
95 Ga0466966_0041298 3300044684 Bacteria 2964
96 Ga0466966_0372194 3300044684 Bacteria 858
97 Ga0466961_0041100 3300044693 Bacteria 2964
98 Ga0466961_0500822 3300044693 Bacteria 733
99 Ga0466963_0007014 3300044694 Bacteria 6707
100 Ga0466963_0007261 3300044694 Bacteria 6606
101 Ga0466963_0252998 3300044694 Bacteria 1236
102 Ga0466963_0446919 3300044694 Bacteria 912
103 Ga0466968_0562589 3300044735 Bacteria 573
104 Ga0466970_0028813 3300044765 Bacteria 2920
105 Ga0466957_0029759 3300044842 Bacteria 3258
106 Ga0466957_1372676 3300044842 Bacteria 514
107 Ga0466959_0002886 3300045049 Bacteria 11090
108 Ga0466959_0096846 3300045049 Bacteria 2115
109 Ga0466959_0514984 3300045049 Bacteria 808
110 Ga0466959_0763575 3300045049 Bacteria 647
111 Ga0466959_0772180 3300045049 Bacteria 643
112 Ga0466958_0000903 3300045836 Bacteria 13331
113 Ga0466958_0017788 3300045836 Bacteria 4116
114 Ga0466958_0186913 3300045836 Bacteria 1316
115 Ga0495592_0435356 3300046454 Bacteria 824
116 Ga0495629_0102079 3300046459 Bacteria 2001
117 Ga0495651_0041256 3300046462 Bacteria 3585
118 Ga0495653_0142430 3300046463 Bacteria 1684
119 Ga0495605_0275013 3300046474 Bacteria 717
120 Ga0495584_0098200 3300046491 Bacteria 1480
121 Ga0495596_0081993 3300046500 Bacteria 1252
122 Ga0495608_0010775 3300046511 Bacteria 6372
123 Ga0495608_0049520 3300046511 Bacteria 2789
124 Ga0495608_0065656 3300046511 Bacteria 2376
125 Ga0495618_0457912 3300046514 Bacteria 773
126 Ga0495628_0234077 3300046516 Bacteria 1376
127 Ga0495630_0242604 3300046517 Bacteria 1377
128 Ga0495642_0241902 3300046528 Bacteria 789
129 Ga0495587_0093386 3300046536 Bacteria 1737
130 Ga0495587_0173401 3300046536 Bacteria 1224
131 Ga0495667_0002959 3300046559 Bacteria 11397
132 Ga0495657_0055505 3300046675 Bacteria 2641
133 Ga0495599_0012353 3300046678 Bacteria 5261
134 Ga0495623_0138161 3300046679 Bacteria 1452
135 Ga0495646_0018810 3300046680 Bacteria 4375
136 Ga0495613_0074721 3300046689 Bacteria 2468
137 Ga0495624_0687270 3300046690 Bacteria 608
138 Ga0495600_0015782 3300046809 Bacteria 4782
139 Ga0495581_0195693 3300047315 Bacteria 1183
140 Ga0495674_0037713 3300047319 Bacteria 4342
141 Ga0495676_0297583 3300047321 Bacteria 1089
142 Ga0495680_0040885 3300047322 Bacteria 3690
143 Ga0495593_0162468 3300047673 Bacteria 1127
144 Ga0495602_0202292 3300048088 Bacteria 1514
145 Ga0495602_0251294 3300048088 Bacteria 1317
146 Ga0496101_0314686 3300048904 Bacteria 1228
147 Ga0496104_0039956 3300048907 Bacteria 4395
148 Ga0496104_0281478 3300048907 Bacteria 1576
149 Ga0496105_0334249 3300048908 Bacteria 1212
150 Ga0496107_0824524 3300048910 Bacteria 678
151 Ga0496109_1248382 3300048912 Bacteria 679
152 Ga0496109_1747947 3300048912 Bacteria 555
153 Ga0496109_1927080 3300048912 Bacteria 523
154 Ga0496111_0243841 3300048914 Bacteria 1334
155 Ga0496112_0043803 3300048915 Bacteria 4382
156 Ga0496112_0139791 3300048915 Bacteria 2391
157 Ga0496112_0523539 3300048915 Bacteria 1120
158 Ga0496112_0910040 3300048915 Bacteria 801
159 Ga0496113_0009885 3300048916 Bacteria 6284
160 Ga0496113_0823037 3300048916 Bacteria 737
161 Ga0496114_0129225 3300048917 Bacteria 2180
162 Ga0496115_0860337 3300048918 Bacteria 702
163 Ga0501042_0618324 3300049578 Bacteria 788
164 Ga0501076_0372338 3300049592 Bacteria 1174
165 nmdc:mga05p37_479967_c1 3300050507 Bacteria 1432
166 nmdc:mga0qj67_813264_c1 3300050509 Bacteria 739
167 Ga0495612_0007532 3300053078 Bacteria 4450
168 Ga0495612_0036781 3300053078 Bacteria 1987
169 Ga0495595_0006589 3300053084 Bacteria 4740
170 Ga0495595_0030451 3300053084 Bacteria 2421
171 Ga0495619_0026013 3300053085 Bacteria 3762
172 Ga0495619_0383943 3300053085 Bacteria 971
173 Ga0501084_0828133 3300054114 Bacteria 779
174 Ga0068861_100565999
175 Ga0070682_100000032
176 Ga0070668_100762752
177 Ga0070714_100037174
178 Ga0070714_100901241
179 Ga0070713_100040110
180 Ga0070713_100116076
181 Ga0070710_10071294
182 Ga0070693_100025130
183 Ga0070664_100090653
184 Ga0068858_100068710
185 Ga0081455_10076666
186 Ga0070717_10189699
187 Ga0070717_10529488
188 Ga0070717_10532092
189 Ga0070712_100002787
190 Ga0075428_100605845
191 Ga0075430_100267964
192 Ga0075430_100652029
193 Ga0105247_10080181
194 Ga0114129_10531145
195 Ga0157369_12061413
196 Ga0157372_10871299
197 Ga0157375_12703387
198 Ga0206356_10196433
199 Ga0213874_10003162
200 Ga0213874_10146896
201 Ga0213876_10023928
202 Ga0213876_10037237
203 Ga0213876_10056925
204 Ga0213876_10075112
205 Ga0213876_10202187
206 Ga0213875_10030756
207 Ga0213875_10074756
208 Ga0207692_10045468
209 Ga0207692_10468618
210 Ga0207710_10066702
211 Ga0207699_10092252
212 Ga0207693_10003621
213 Ga0207664_10265421
214 Ga0207644_10706835
215 Ga0207661_10075688
216 Ga0207679_10117000
217 Ga0207668_10514338
218 Ga0207703_10084108
219 Ga0207675_100572343
220 Ga0307408_100129746
221 Ga0307405_10489574
222 Ga0307410_10879389
223 Ga0307406_10072953
224 Ga0307406_10370772
225 Ga0307409_100082311
226 Ga0307409_100489038
227 Ga0307416_101013755
228 Ga0307415_100009401
229 Ga0307415_100063728
230 Ga0316585_10059762
231 Ga0373924_0014254
232 Ga0373935_0786603
233 Ga0373933_0055863
234 Ga0373937_0034517
235 Ga0316584_0058999
236 Ga0316584_0075690
237 Ga0395900_0565600
238 Ga0395898_0063119
239 Ga0395898_0102077
240 Ga0395898_0182462
241 Ga0395905_0029618
242 Ga0436364_0409817
243 Ga0436364_0649964
244 Ga0436364_0752511
245 Ga0436364_0859011
246 Ga0436364_1340105
247 Ga0436364_1406113
248 Ga0395901_0013362
249 Ga0395901_0383261
250 Ga0436365_0226538
251 Ga0436365_1085630
252 Ga0436365_1119421
253 Ga0436365_1242127
254 Ga0436365_1352347
255 Ga0436365_1553003
256 Ga0436361_0005155
257 Ga0436363_0275177
258 Ga0436363_0347307
259 Ga0436363_1010160
260 Ga0436363_1354558
261 Ga0436363_1464408
262 Ga0436363_1587204
263 Ga0436362_0712885
264 Ga0436362_0875519
265 Ga0436362_1231934
266 Ga0466969_0075198
267 Ga0466969_0463883
268 Ga0466966_0041298
269 Ga0466966_0372194
270 Ga0466961_0041100
271 Ga0466961_0500822
272 Ga0466963_0007014
273 Ga0466963_0007261
274 Ga0466963_0252998
275 Ga0466963_0446919
276 Ga0466968_0562589
277 Ga0466970_0028813
278 Ga0466957_0029759
279 Ga0466957_1372676
280 Ga0466959_0002886
281 Ga0466959_0096846
282 Ga0466959_0514984
283 Ga0466959_0763575
284 Ga0466959_0772180
285 Ga0466958_0000903
286 Ga0466958_0017788
287 Ga0466958_0186913
288 Ga0495592_0435356
289 Ga0495629_0102079
290 Ga0495651_0041256
291 Ga0495653_0142430
292 Ga0495605_0275013
293 Ga0495584_0098200
294 Ga0495596_0081993
295 Ga0495608_0010775
296 Ga0495608_0049520
297 Ga0495608_0065656
298 Ga0495618_0457912
299 Ga0495628_0234077
300 Ga0495630_0242604
301 Ga0495642_0241902
302 Ga0495587_0093386
303 Ga0495587_0173401
304 Ga0495667_0002959
305 Ga0495657_0055505
306 Ga0495599_0012353
307 Ga0495623_0138161
308 Ga0495646_0018810
309 Ga0495613_0074721
310 Ga0495624_0687270
311 Ga0495600_0015782
312 Ga0495581_0195693
313 Ga0495674_0037713
314 Ga0495676_0297583
315 Ga0495680_0040885
316 Ga0495593_0162468
317 Ga0495602_0202292
318 Ga0495602_0251294
319 Ga0496101_0314686
320 Ga0496104_0039956
321 Ga0496104_0281478
322 Ga0496105_0334249
323 Ga0496107_0824524
324 Ga0496109_1248382
325 Ga0496109_1747947
326 Ga0496109_1927080
327 Ga0496111_0243841
328 Ga0496112_0043803
329 Ga0496112_0139791
330 Ga0496112_0523539
331 Ga0496112_0910040
332 Ga0496113_0009885
333 Ga0496113_0823037
334 Ga0496114_0129225
335 Ga0496115_0860337
336 Ga0501042_0618324
337 Ga0501076_0372338
338 nmdc:mga05p37_479967_c1
339 nmdc:mga0qj67_813264_c1
340 Ga0495612_0007532
341 Ga0495612_0036781
342 Ga0495595_0006589
343 Ga0495595_0030451
344 Ga0495619_0026013
345 Ga0495619_0383943
346 Ga0501084_0828133

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

4

129

0.98

PF08534

Redoxin

Redoxin

3

145

0.93

PF02630

SCO1-SenC

SCO1/SenC

8

126

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ixr-assembly1.cif.gz_A crystal structure of xylella fastidiosa prxq c47s mutant 0.9473 1 154
5enu-assembly2.cif.gz_B crystal structure of an alkyl hyroperoxide reductase from burkholderia ambifaria 0.9422 1 152
3gkm-assembly1.cif.gz_A insights into the alkyl peroxide reduction activity of xanthomonas campestris bacterioferritin comigratory protein from the trapped intermediate/ligand complex structures 0.9357 3 154
3drn-assembly2.cif.gz_B the crystal structure of bcp1 from sulfolobus sulfataricus 0.9325 2 155
3gkn-assembly1.cif.gz_A insights into the alkyl peroxide reduction activity of xanthomonas campestris bacterioferritin comigratory protein from the trapped intermediate/ligand complex structures 0.9302 1 152
ID Description Score Start End Superfamily
af_P0AE52_4_156_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9841 2 152 3.40.30.10
af_Q2G280_3_151_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9779 3 150 3.40.30.10
af_Q2G280_3_151_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9651 3 150 3.40.30.10
af_P0AE52_4_156_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9651 2 152 3.40.30.10
af_P9WIE1_7_157_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9578 2 151 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A3N5YXX7-F1-model_v4 deleted 0.9982 1 102
AF-A0A6G3HNR1-F1-model_v4 deleted 0.9942 1 96
AF-A0A511SYM8-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9922 1 151 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-A0A2H0S8Z9-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9916 7 150 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-K2DNC9-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9908 6 152 GO:0005737
GO:0008379
GO:0034599
GO:0045454

Map