F262273
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 173 | 118 | 173 | 208 |
Family's Representative Sequence
| Representative Sequence | 3300005563|Ga0068855_100025845|Ga0068855_1000258455 |
| Length | 226 |
| Sequence | MYFFSATEKMAVGVQYIEMALILTALGVFIILLASELWWRYKNPQSELSRKFVHITVGTFVAFWPFFLNWNQIRLLALGFAVTVVVSKTFHIFRAIHSVQRPTWGEVYFALVVGLLTFVTHSKSIYAASLLQMSLADGLAAVVGVRFGKRHRYKVLGHPKSYLGTATFLVVSVLLLVGYIVTGHDLAVSHLIGLAILASLGENFGVAGLDNLFVPLLVALVLTKIG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 6 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 15 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 18 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 20 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 21 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 22 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 23 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 24 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 25 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 26 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 27 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 28 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 29 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 30 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 31 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 32 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009986 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG | Metagenome | Rhizosphere |
| 37 | 3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Metagenome | Rhizosphere |
| 38 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 72 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 74 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 75 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 76 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 77 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 78 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 79 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 80 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 81 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 82 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 83 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 84 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 85 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 86 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 87 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 88 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 89 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 90 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 91 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 92 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 93 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 94 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 95 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 96 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 97 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 98 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 99 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 100 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 101 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 102 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 103 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 104 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 105 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 106 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 107 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 108 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 109 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 110 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 111 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 112 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 113 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 114 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 115 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 116 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 117 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 118 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 20.23 |
| Nodule | 0 |
| Rhizoplane | 1.16 |
| Rhizosphere | 77.46 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.16 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1004084 | 3300001915 | Bacteria | 3313 |
| 2 | JGI24740J21852_10003850 | 3300001979 | Bacteria | 6513 |
| 3 | JGI24737J22298_10000010 | 3300001990 | Bacteria | 55828 |
| 4 | JGI24735J21928_10000052 | 3300002067 | Bacteria | 50482 |
| 5 | rootH2_10118052 | 3300003320 | Bacteria | 1087 |
| 6 | rootH1_10237707 | 3300003323 | Bacteria | 1302 |
| 7 | Ga0070658_10000110 | 3300005327 | Bacteria | 73137 |
| 8 | Ga0070658_10003611 | 3300005327 | Bacteria | 12676 |
| 9 | Ga0070680_100054292 | 3300005336 | Bacteria | 3271 |
| 10 | Ga0070660_100014556 | 3300005339 | Bacteria | 5672 |
| 11 | Ga0070660_100662546 | 3300005339 | Unclassified | 874 |
| 12 | Ga0070674_100000920 | 3300005356 | Bacteria | 15341 |
| 13 | Ga0070674_100038701 | 3300005356 | Bacteria | 3216 |
| 14 | Ga0070673_100000135 | 3300005364 | Bacteria | 35068 |
| 15 | Ga0070688_100406794 | 3300005365 | Bacteria | 1008 |
| 16 | Ga0070678_100023024 | 3300005456 | Bacteria | 4143 |
| 17 | Ga0068867_100008149 | 3300005459 | Bacteria | 7403 |
| 18 | Ga0070685_10000153 | 3300005466 | Bacteria | 45555 |
| 19 | Ga0070679_100009863 | 3300005530 | Bacteria | 9035 |
| 20 | Ga0070679_100038240 | 3300005530 | Bacteria | 4770 |
| 21 | Ga0070679_100623251 | 3300005530 | Bacteria | 1022 |
| 22 | Ga0068853_100010610 | 3300005539 | Bacteria | 7453 |
| 23 | Ga0070665_100089540 | 3300005548 | Bacteria | 3083 |
| 24 | Ga0070665_100126568 | 3300005548 | Bacteria | 2557 |
| 25 | Ga0068855_100000001 | 3300005563 | Bacteria | 818777 |
| 26 | Ga0068855_100001696 | 3300005563 | Bacteria | 27546 |
| 27 | Ga0068855_100025845 | 3300005563 | Bacteria | 7022 |
| 28 | Ga0068857_100019314 | 3300005577 | Bacteria | 5983 |
| 29 | Ga0068856_100000002 | 3300005614 | Bacteria | 372816 |
| 30 | Ga0068856_100029459 | 3300005614 | Bacteria | 5362 |
| 31 | Ga0081455_10000008 | 3300005937 | Bacteria | 256558 |
| 32 | Ga0075365_10023480 | 3300006038 | Bacteria | 3880 |
| 33 | Ga0075365_10386897 | 3300006038 | Unclassified | 987 |
| 34 | Ga0075368_10003024 | 3300006042 | Bacteria | 5560 |
| 35 | Ga0075364_10014289 | 3300006051 | Unclassified | 4904 |
| 36 | Ga0075364_10014372 | 3300006051 | Bacteria | 4891 |
| 37 | Ga0075367_10000064 | 3300006178 | Bacteria | 26426 |
| 38 | Ga0075366_10000007 | 3300006195 | Bacteria | 104412 |
| 39 | Ga0075366_10000390 | 3300006195 | Bacteria | 20368 |
| 40 | Ga0068871_100104069 | 3300006358 | Bacteria | 2381 |
| 41 | Ga0068865_100021905 | 3300006881 | Bacteria | 4161 |
| 42 | Ga0068865_100252964 | 3300006881 | Unclassified | 1391 |
| 43 | Ga0105240_10000003 | 3300009093 | Bacteria | 1183681 |
| 44 | Ga0105245_10000034 | 3300009098 | Bacteria | 147951 |
| 45 | Ga0105245_10003608 | 3300009098 | Bacteria | 13810 |
| 46 | Ga0105243_10000001 | 3300009148 | Bacteria | 1156578 |
| 47 | Ga0105241_10000003 | 3300009174 | Bacteria | 839043 |
| 48 | Ga0105242_10000001 | 3300009176 | Bacteria | 574039 |
| 49 | Ga0105237_10017776 | 3300009545 | Bacteria | 7372 |
| 50 | Ga0105237_10493770 | 3300009545 | Bacteria | 1231 |
| 51 | Ga0105237_10647794 | 3300009545 | Unclassified | 1063 |
| 52 | Ga0105033_100115 | 3300009986 | Bacteria | 6148 |
| 53 | Ga0105028_100260 | 3300009993 | Bacteria | 5760 |
| 54 | Ga0105239_10016426 | 3300010375 | Bacteria | 8184 |
| 55 | Ga0105239_10061147 | 3300010375 | Bacteria | 4134 |
| 56 | Ga0105239_11291569 | 3300010375 | Unclassified | 842 |
| 57 | Ga0157373_10013501 | 3300013100 | Bacteria | 5989 |
| 58 | Ga0157369_10000054 | 3300013105 | Bacteria | 162631 |
| 59 | Ga0157369_10401184 | 3300013105 | Bacteria | 1422 |
| 60 | Ga0157374_10001007 | 3300013296 | Bacteria | 24406 |
| 61 | Ga0157374_10109096 | 3300013296 | Bacteria | 2661 |
| 62 | Ga0157378_10092108 | 3300013297 | Bacteria | 2757 |
| 63 | Ga0157372_10009002 | 3300013307 | Bacteria | 10613 |
| 64 | Ga0157375_10490715 | 3300013308 | Bacteria | 1393 |
| 65 | Ga0157375_10601917 | 3300013308 | Bacteria | 1258 |
| 66 | Ga0163163_11307106 | 3300014325 | Bacteria | 787 |
| 67 | Ga0157380_10312336 | 3300014326 | Unclassified | 1453 |
| 68 | Ga0157377_10007925 | 3300014745 | Bacteria | 5157 |
| 69 | Ga0157376_10000001 | 3300014969 | Bacteria | 842910 |
| 70 | Ga0207647_10423664 | 3300025904 | Unclassified | 748 |
| 71 | Ga0207705_10002683 | 3300025909 | Bacteria | 13630 |
| 72 | Ga0207705_10004076 | 3300025909 | Bacteria | 11089 |
| 73 | Ga0207654_10000002 | 3300025911 | Bacteria | 1460142 |
| 74 | Ga0207707_10023891 | 3300025912 | Bacteria | 5345 |
| 75 | Ga0207695_10000005 | 3300025913 | Bacteria | 1196715 |
| 76 | Ga0207671_10008360 | 3300025914 | Bacteria | 8787 |
| 77 | Ga0207671_10309742 | 3300025914 | Bacteria | 1248 |
| 78 | Ga0207660_10001720 | 3300025917 | Bacteria | 14673 |
| 79 | Ga0207660_10209761 | 3300025917 | Bacteria | 1525 |
| 80 | Ga0207657_10005411 | 3300025919 | Bacteria | 13348 |
| 81 | Ga0207652_10002857 | 3300025921 | Bacteria | 14455 |
| 82 | Ga0207652_10005234 | 3300025921 | Bacteria | 10544 |
| 83 | Ga0207652_10014032 | 3300025921 | Bacteria | 6486 |
| 84 | Ga0207652_10696049 | 3300025921 | Unclassified | 907 |
| 85 | Ga0207694_10225564 | 3300025924 | Bacteria | 1529 |
| 86 | Ga0207687_10000365 | 3300025927 | Bacteria | 30197 |
| 87 | Ga0207687_10006750 | 3300025927 | Bacteria | 7563 |
| 88 | Ga0207686_10000001 | 3300025934 | Bacteria | 1169580 |
| 89 | Ga0207686_10130331 | 3300025934 | Bacteria | 1724 |
| 90 | Ga0207709_10000002 | 3300025935 | Bacteria | 1171536 |
| 91 | Ga0207669_10003540 | 3300025937 | Bacteria | 6761 |
| 92 | Ga0207669_10160053 | 3300025937 | Bacteria | 1589 |
| 93 | Ga0207667_10000003 | 3300025949 | Bacteria | 822935 |
| 94 | Ga0207667_10077997 | 3300025949 | Bacteria | 3434 |
| 95 | Ga0207651_10000161 | 3300025960 | Bacteria | 28725 |
| 96 | Ga0207639_10057419 | 3300026041 | Bacteria | 2988 |
| 97 | Ga0207702_10000001 | 3300026078 | Bacteria | 895738 |
| 98 | Ga0207702_10212926 | 3300026078 | Bacteria | 1797 |
| 99 | Ga0207648_10107514 | 3300026089 | Bacteria | 2448 |
| 100 | Ga0207674_10010396 | 3300026116 | Bacteria | 10545 |
| 101 | Ga0207683_10002915 | 3300026121 | Bacteria | 14921 |
| 102 | Ga0209813_10001309 | 3300027866 | Bacteria | 5560 |
| 103 | Ga0207428_10039913 | 3300027907 | Bacteria | 3810 |
| 104 | Ga0268266_10000662 | 3300028379 | Bacteria | 46629 |
| 105 | Ga0268266_10067525 | 3300028379 | Bacteria | 3095 |
| 106 | Ga0265328_10054128 | 3300031239 | Bacteria | 1472 |
| 107 | Ga0395899_0004205 | 3300037312 | Bacteria | 11292 |
| 108 | Ga0395899_0004429 | 3300037312 | Bacteria | 10954 |
| 109 | Ga0395900_0000712 | 3300037418 | Bacteria | 44237 |
| 110 | Ga0395900_0020741 | 3300037418 | Bacteria | 6716 |
| 111 | Ga0395900_0076796 | 3300037418 | Bacteria | 3432 |
| 112 | Ga0395900_0160164 | 3300037418 | Bacteria | 2296 |
| 113 | Ga0395900_0354632 | 3300037418 | Bacteria | 1440 |
| 114 | Ga0395900_0371288 | 3300037418 | Bacteria | 1400 |
| 115 | Ga0395898_0003669 | 3300037466 | Bacteria | 17057 |
| 116 | Ga0395898_0039881 | 3300037466 | Bacteria | 4646 |
| 117 | Ga0395898_0463892 | 3300037466 | Bacteria | 1206 |
| 118 | Ga0395898_0705951 | 3300037466 | Bacteria | 950 |
| 119 | Ga0395905_0000943 | 3300037471 | Bacteria | 37400 |
| 120 | Ga0395905_0179759 | 3300037471 | Bacteria | 1986 |
| 121 | Ga0395905_0411271 | 3300037471 | Bacteria | 1248 |
| 122 | Ga0395901_0004150 | 3300038443 | Bacteria | 14616 |
| 123 | Ga0395901_0008932 | 3300038443 | Bacteria | 10149 |
| 124 | Ga0395901_0011341 | 3300038443 | Bacteria | 9031 |
| 125 | Ga0395901_0299671 | 3300038443 | Bacteria | 1667 |
| 126 | Ga0395901_0364513 | 3300038443 | Bacteria | 1489 |
| 127 | Ga0466963_0227484 | 3300044694 | Bacteria | 1307 |
| 128 | Ga0495649_0000100 | 3300046694 | Bacteria | 75606 |
| 129 | Ga0495686_0158553 | 3300047472 | Bacteria | 1324 |
| 130 | Ga0496109_0150534 | 3300048912 | Unclassified | 2178 |
| 131 | Ga0496112_0119686 | 3300048915 | Bacteria | 2603 |
| 132 | Ga0501031_0001813 | 3300049568 | Bacteria | 13426 |
| 133 | Ga0501032_0001512 | 3300049569 | Bacteria | 18574 |
| 134 | Ga0501034_0018818 | 3300049571 | Bacteria | 7079 |
| 135 | Ga0501036_0010730 | 3300049572 | Bacteria | 7574 |
| 136 | Ga0501037_0000138 | 3300049573 | Bacteria | 68040 |
| 137 | Ga0501038_0084468 | 3300049574 | Bacteria | 2671 |
| 138 | Ga0501043_0000062 | 3300049579 | Bacteria | 95664 |
| 139 | Ga0501046_0000059 | 3300049580 | Bacteria | 126801 |
| 140 | Ga0501047_0000032 | 3300049581 | Bacteria | 208294 |
| 141 | Ga0501048_0015216 | 3300049582 | Bacteria | 5683 |
| 142 | Ga0501069_0024818 | 3300049585 | Bacteria | 3273 |
| 143 | Ga0501070_0036147 | 3300049586 | Bacteria | 4125 |
| 144 | Ga0501083_0058577 | 3300049744 | Bacteria | 2577 |
| 145 | Ga0501035_0001735 | 3300049822 | Bacteria | 22038 |
| 146 | Ga0501044_0012395 | 3300049823 | Bacteria | 9230 |
| 147 | nmdc:mga00v17_17000_c2 | 3300050491 | Bacteria | 2061 |
| 148 | nmdc:mga00v17_4078_c1 | 3300050491 | Bacteria | 7554 |
| 149 | nmdc:mga0yw44_29557_c1 | 3300050492 | Bacteria | 3164 |
| 150 | nmdc:mga0yw44_77707_c1 | 3300050492 | Bacteria | 2074 |
| 151 | nmdc:mga0k408_1745_c1 | 3300050493 | Bacteria | 7483 |
| 152 | nmdc:mga0k408_29_c1 | 3300050493 | Bacteria | 89645 |
| 153 | nmdc:mga0k408_46151_c1 | 3300050493 | Bacteria | 2515 |
| 154 | nmdc:mga0k408_559_c1 | 3300050493 | Bacteria | 20485 |
| 155 | nmdc:mga06z11_161_c1 | 3300050494 | Bacteria | 26426 |
| 156 | nmdc:mga04h51_1410_c1 | 3300050495 | Bacteria | 5560 |
| 157 | Ga0500610_0151846 | 3300053079 | Bacteria | 1160 |
| 158 | Ga0500644_0002149 | 3300053088 | Bacteria | 4990 |
| 159 | Ga0500646_0000179 | 3300053090 | Bacteria | 18884 |
| 160 | Ga0500583_0050747 | 3300053092 | Bacteria | 1925 |
| 161 | Ga0500651_0000011 | 3300053093 | Bacteria | 246573 |
| 162 | Ga0500651_0009086 | 3300053093 | Bacteria | 5885 |
| 163 | Ga0500650_0000001 | 3300053098 | Bacteria | 818797 |
| 164 | Ga0500562_000002 | 3300053108 | Bacteria | 977234 |
| 165 | Ga0500562_061956 | 3300053108 | Bacteria | 1005 |
| 166 | Ga0500594_0000001 | 3300053118 | Bacteria | 1178472 |
| 167 | Ga0500614_009889 | 3300053123 | Bacteria | 2039 |
| 168 | Ga0500655_005652 | 3300053133 | Bacteria | 2249 |
| 169 | Ga0500561_0000002 | 3300053137 | Bacteria | 394147 |
| 170 | Ga0500577_0007692 | 3300053142 | Bacteria | 3033 |
| 171 | Ga0500579_024698 | 3300053143 | Bacteria | 3883 |
| 172 | Ga0500633_0006035 | 3300053160 | Bacteria | 2938 |
| 173 | Ga0501082_0056233 | 3300060353 | Bacteria | 3389 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300014326 | Ga0157380_10312336 | Ga0157380_103123362 | 171 |
| 2 | 3300013100 | Ga0157373_10013501 | Ga0157373_1001350110 | 182 |
| 3 | 3300025909 | Ga0207705_10004076 | Ga0207705_1000407615 | 184 |
| 4 | 3300025917 | Ga0207660_10001720 | Ga0207660_1000172013 | 184 |
| 5 | 3300037312 | Ga0395899_0004429 | Ga0395899_0004429_6797_7426 | 187 |
| 6 | 3300037418 | Ga0395900_0020741 | Ga0395900_0020741_4619_5248 | 187 |
| 7 | 3300037466 | Ga0395898_0039881 | Ga0395898_0039881_3385_4014 | 187 |
| 8 | 3300037471 | Ga0395905_0000943 | Ga0395905_0000943_5784_6413 | 187 |
| 9 | 3300038443 | Ga0395901_0011341 | Ga0395901_0011341_4277_4906 | 187 |
| 10 | 3300013105 | Ga0157369_10401184 | Ga0157369_104011841 | 189 |
| 11 | 3300013307 | Ga0157372_10009002 | Ga0157372_100090026 | 189 |
| 12 | 3300005327 | Ga0070658_10003611 | Ga0070658_1000361116 | 190 |
| 13 | 3300005336 | Ga0070680_100054292 | Ga0070680_1000542921 | 190 |
| 14 | 3300005339 | Ga0070660_100014556 | Ga0070660_1000145563 | 190 |
| 15 | 3300005530 | Ga0070679_100038240 | Ga0070679_1000382401 | 190 |
| 16 | 3300005937 | Ga0081455_10000008 | Ga0081455_10000008159 | 190 |
| 17 | 3300025919 | Ga0207657_10005411 | Ga0207657_1000541110 | 190 |
| 18 | 3300025921 | Ga0207652_10005234 | Ga0207652_100052346 | 190 |
| 19 | 3300038443 | Ga0395901_0364513 | Ga0395901_0364513_828_1469 | 195 |
| 20 | 3300014325 | Ga0163163_11307106 | Ga0163163_113071062 | 205 |
| 21 | 3300003323 | rootH1_10237707 | rootH1_102377071 | 208 |
| 22 | 3300005327 | Ga0070658_10000110 | Ga0070658_1000011018 | 208 |
| 23 | 3300005339 | Ga0070660_100662546 | Ga0070660_1006625461 | 208 |
| 24 | 3300005356 | Ga0070674_100000920 | Ga0070674_10000092017 | 208 |
| 25 | 3300005356 | Ga0070674_100038701 | Ga0070674_1000387015 | 208 |
| 26 | 3300005364 | Ga0070673_100000135 | Ga0070673_10000013518 | 208 |
| 27 | 3300005365 | Ga0070688_100406794 | Ga0070688_1004067941 | 208 |
| 28 | 3300005456 | Ga0070678_100023024 | Ga0070678_1000230244 | 208 |
| 29 | 3300005459 | Ga0068867_100008149 | Ga0068867_1000081495 | 208 |
| 30 | 3300005466 | Ga0070685_10000153 | Ga0070685_1000015315 | 208 |
| 31 | 3300005539 | Ga0068853_100010610 | Ga0068853_1000106104 | 208 |
| 32 | 3300005548 | Ga0070665_100089540 | Ga0070665_1000895403 | 208 |
| 33 | 3300005548 | Ga0070665_100126568 | Ga0070665_1001265683 | 208 |
| 34 | 3300006358 | Ga0068871_100104069 | Ga0068871_1001040692 | 208 |
| 35 | 3300006881 | Ga0068865_100021905 | Ga0068865_1000219054 | 208 |
| 36 | 3300006881 | Ga0068865_100252964 | Ga0068865_1002529642 | 208 |
| 37 | 3300009093 | Ga0105240_10000003 | Ga0105240_10000003332 | 208 |
| 38 | 3300009098 | Ga0105245_10000034 | Ga0105245_10000034133 | 208 |
| 39 | 3300009098 | Ga0105245_10003608 | Ga0105245_100036085 | 208 |
| 40 | 3300009148 | Ga0105243_10000001 | Ga0105243_10000001918 | 208 |
| 41 | 3300009176 | Ga0105242_10000001 | Ga0105242_10000001341 | 208 |
| 42 | 3300009545 | Ga0105237_10017776 | Ga0105237_1001777611 | 208 |
| 43 | 3300010375 | Ga0105239_10016426 | Ga0105239_100164268 | 208 |
| 44 | 3300010375 | Ga0105239_10061147 | Ga0105239_100611473 | 208 |
| 45 | 3300013296 | Ga0157374_10001007 | Ga0157374_1000100723 | 208 |
| 46 | 3300013296 | Ga0157374_10109096 | Ga0157374_101090961 | 208 |
| 47 | 3300013297 | Ga0157378_10092108 | Ga0157378_100921083 | 208 |
| 48 | 3300013308 | Ga0157375_10490715 | Ga0157375_104907153 | 208 |
| 49 | 3300014745 | Ga0157377_10007925 | Ga0157377_100079255 | 208 |
| 50 | 3300014969 | Ga0157376_10000001 | Ga0157376_10000001571 | 208 |
| 51 | 3300025909 | Ga0207705_10002683 | Ga0207705_100026836 | 208 |
| 52 | 3300025912 | Ga0207707_10023891 | Ga0207707_100238915 | 208 |
| 53 | 3300025913 | Ga0207695_10000005 | Ga0207695_10000005340 | 208 |
| 54 | 3300025914 | Ga0207671_10008360 | Ga0207671_1000836013 | 208 |
| 55 | 3300025921 | Ga0207652_10696049 | Ga0207652_106960491 | 208 |
| 56 | 3300025924 | Ga0207694_10225564 | Ga0207694_102255642 | 208 |
| 57 | 3300025927 | Ga0207687_10000365 | Ga0207687_1000036528 | 208 |
| 58 | 3300025927 | Ga0207687_10006750 | Ga0207687_1000675010 | 208 |
| 59 | 3300025934 | Ga0207686_10000001 | Ga0207686_10000001223 | 208 |
| 60 | 3300025934 | Ga0207686_10130331 | Ga0207686_101303312 | 208 |
| 61 | 3300025935 | Ga0207709_10000002 | Ga0207709_10000002340 | 208 |
| 62 | 3300025937 | Ga0207669_10003540 | Ga0207669_100035402 | 208 |
| 63 | 3300025937 | Ga0207669_10160053 | Ga0207669_101600531 | 208 |
| 64 | 3300025960 | Ga0207651_10000161 | Ga0207651_1000016120 | 208 |
| 65 | 3300026041 | Ga0207639_10057419 | Ga0207639_100574195 | 208 |
| 66 | 3300026089 | Ga0207648_10107514 | Ga0207648_101075144 | 208 |
| 67 | 3300026121 | Ga0207683_10002915 | Ga0207683_100029154 | 208 |
| 68 | 3300027907 | Ga0207428_10039913 | Ga0207428_100399132 | 208 |
| 69 | 3300028379 | Ga0268266_10000662 | Ga0268266_100006629 | 208 |
| 70 | 3300028379 | Ga0268266_10067525 | Ga0268266_100675252 | 208 |
| 71 | 3300037418 | Ga0395900_0354632 | Ga0395900_0354632_469_1095 | 208 |
| 72 | 3300037418 | Ga0395900_0371288 | Ga0395900_0371288_377_1003 | 208 |
| 73 | 3300038443 | Ga0395901_0299671 | Ga0395901_0299671_247_873 | 208 |
| 74 | 3300047472 | Ga0495686_0158553 | Ga0495686_0158553_68_694 | 208 |
| 75 | 3300048912 | Ga0496109_0150534 | Ga0496109_0150534_604_1230 | 208 |
| 76 | 3300048915 | Ga0496112_0119686 | Ga0496112_0119686_1845_2471 | 208 |
| 77 | 3300053093 | Ga0500651_0000011 | Ga0500651_0000011_28674_29300 | 208 |
| 78 | 3300053093 | Ga0500651_0009086 | Ga0500651_0009086_4433_5059 | 208 |
| 79 | 3300053123 | Ga0500614_009889 | Ga0500614_009889_352_978 | 208 |
| 80 | 3300005530 | Ga0070679_100009863 | Ga0070679_1000098636 | 209 |
| 81 | 3300005563 | Ga0068855_100001696 | Ga0068855_10000169631 | 209 |
| 82 | 3300005577 | Ga0068857_100019314 | Ga0068857_1000193147 | 209 |
| 83 | 3300005614 | Ga0068856_100029459 | Ga0068856_1000294592 | 209 |
| 84 | 3300009545 | Ga0105237_10647794 | Ga0105237_106477941 | 209 |
| 85 | 3300010375 | Ga0105239_11291569 | Ga0105239_112915692 | 209 |
| 86 | 3300025904 | Ga0207647_10423664 | Ga0207647_104236641 | 209 |
| 87 | 3300025921 | Ga0207652_10002857 | Ga0207652_1000285713 | 209 |
| 88 | 3300025921 | Ga0207652_10014032 | Ga0207652_100140326 | 209 |
| 89 | 3300026078 | Ga0207702_10212926 | Ga0207702_102129262 | 209 |
| 90 | 3300026116 | Ga0207674_10010396 | Ga0207674_100103966 | 209 |
| 91 | 3300031239 | Ga0265328_10054128 | Ga0265328_100541282 | 209 |
| 92 | 3300037312 | Ga0395899_0004205 | Ga0395899_0004205_8795_9424 | 209 |
| 93 | 3300037418 | Ga0395900_0000712 | Ga0395900_0000712_23051_23680 | 209 |
| 94 | 3300037418 | Ga0395900_0076796 | Ga0395900_0076796_1754_2383 | 209 |
| 95 | 3300037466 | Ga0395898_0003669 | Ga0395898_0003669_15264_15893 | 209 |
| 96 | 3300037466 | Ga0395898_0463892 | Ga0395898_0463892_10_639 | 209 |
| 97 | 3300037466 | Ga0395898_0705951 | Ga0395898_0705951_28_657 | 209 |
| 98 | 3300037471 | Ga0395905_0179759 | Ga0395905_0179759_818_1447 | 209 |
| 99 | 3300037471 | Ga0395905_0411271 | Ga0395905_0411271_457_1086 | 209 |
| 100 | 3300038443 | Ga0395901_0004150 | Ga0395901_0004150_7090_7719 | 209 |
| 101 | 3300038443 | Ga0395901_0008932 | Ga0395901_0008932_1214_1843 | 209 |
| 102 | 3300049568 | Ga0501031_0001813 | Ga0501031_0001813_10977_11606 | 209 |
| 103 | 3300049569 | Ga0501032_0001512 | Ga0501032_0001512_13545_14174 | 209 |
| 104 | 3300049571 | Ga0501034_0018818 | Ga0501034_0018818_2952_3581 | 209 |
| 105 | 3300049572 | Ga0501036_0010730 | Ga0501036_0010730_6592_7221 | 209 |
| 106 | 3300049573 | Ga0501037_0000138 | Ga0501037_0000138_23244_23873 | 209 |
| 107 | 3300049574 | Ga0501038_0084468 | Ga0501038_0084468_1527_2156 | 209 |
| 108 | 3300049579 | Ga0501043_0000062 | Ga0501043_0000062_84424_85053 | 209 |
| 109 | 3300049580 | Ga0501046_0000059 | Ga0501046_0000059_41077_41706 | 209 |
| 110 | 3300049581 | Ga0501047_0000032 | Ga0501047_0000032_173729_174358 | 209 |
| 111 | 3300049582 | Ga0501048_0015216 | Ga0501048_0015216_3028_3657 | 209 |
| 112 | 3300049585 | Ga0501069_0024818 | Ga0501069_0024818_2500_3129 | 209 |
| 113 | 3300049586 | Ga0501070_0036147 | Ga0501070_0036147_317_946 | 209 |
| 114 | 3300049744 | Ga0501083_0058577 | Ga0501083_0058577_1873_2502 | 209 |
| 115 | 3300049822 | Ga0501035_0001735 | Ga0501035_0001735_7002_7631 | 209 |
| 116 | 3300049823 | Ga0501044_0012395 | Ga0501044_0012395_6538_7167 | 209 |
| 117 | 3300060353 | Ga0501082_0056233 | Ga0501082_0056233_2525_3154 | 209 |
| 118 | 3300003320 | rootH2_10118052 | rootH2_101180522 | 210 |
| 119 | 3300006038 | Ga0075365_10023480 | Ga0075365_100234804 | 210 |
| 120 | 3300006038 | Ga0075365_10386897 | Ga0075365_103868972 | 210 |
| 121 | 3300006051 | Ga0075364_10014289 | Ga0075364_100142893 | 210 |
| 122 | 3300006195 | Ga0075366_10000007 | Ga0075366_1000000761 | 210 |
| 123 | 3300009993 | Ga0105028_100260 | Ga0105028_1002605 | 210 |
| 124 | 3300037418 | Ga0395900_0160164 | Ga0395900_0160164_1642_2274 | 210 |
| 125 | 3300044694 | Ga0466963_0227484 | Ga0466963_0227484_75_707 | 210 |
| 126 | 3300046694 | Ga0495649_0000100 | Ga0495649_0000100_48599_49231 | 210 |
| 127 | 3300050491 | nmdc:mga00v17_17000_c2 | nmdc:mga00v17_17000_c2_716_1348 | 210 |
| 128 | 3300050492 | nmdc:mga0yw44_29557_c1 | nmdc:mga0yw44_29557_c1_441_1073 | 210 |
| 129 | 3300050492 | nmdc:mga0yw44_77707_c1 | nmdc:mga0yw44_77707_c1_1085_1717 | 210 |
| 130 | 3300050493 | nmdc:mga0k408_1745_c1 | nmdc:mga0k408_1745_c1_1067_1699 | 210 |
| 131 | 3300050493 | nmdc:mga0k408_29_c1 | nmdc:mga0k408_29_c1_24894_25526 | 210 |
| 132 | 3300053108 | Ga0500562_000002 | Ga0500562_000002_542840_543472 | 210 |
| 133 | 3300053079 | Ga0500610_0151846 | Ga0500610_0151846_224_859 | 211 |
| 134 | 3300053088 | Ga0500644_0002149 | Ga0500644_0002149_2370_3005 | 211 |
| 135 | 3300053090 | Ga0500646_0000179 | Ga0500646_0000179_3583_4218 | 211 |
| 136 | 3300053092 | Ga0500583_0050747 | Ga0500583_0050747_1083_1718 | 211 |
| 137 | 3300053098 | Ga0500650_0000001 | Ga0500650_0000001_66474_67109 | 211 |
| 138 | 3300053108 | Ga0500562_061956 | Ga0500562_061956_151_786 | 211 |
| 139 | 3300053118 | Ga0500594_0000001 | Ga0500594_0000001_731274_731909 | 211 |
| 140 | 3300053133 | Ga0500655_005652 | Ga0500655_005652_780_1415 | 211 |
| 141 | 3300053142 | Ga0500577_0007692 | Ga0500577_0007692_781_1416 | 211 |
| 142 | 3300053143 | Ga0500579_024698 | Ga0500579_024698_2304_2939 | 211 |
| 143 | 3300053160 | Ga0500633_0006035 | Ga0500633_0006035_1604_2239 | 211 |
| 144 | 3300005614 | Ga0068856_100000002 | Ga0068856_10000000262 | 212 |
| 145 | 3300006042 | Ga0075368_10003024 | Ga0075368_100030243 | 212 |
| 146 | 3300006051 | Ga0075364_10014372 | Ga0075364_100143725 | 212 |
| 147 | 3300006178 | Ga0075367_10000064 | Ga0075367_1000006425 | 212 |
| 148 | 3300006195 | Ga0075366_10000390 | Ga0075366_1000039017 | 212 |
| 149 | 3300026078 | Ga0207702_10000001 | Ga0207702_10000001366 | 212 |
| 150 | 3300027866 | Ga0209813_10001309 | Ga0209813_100013096 | 212 |
| 151 | 3300050491 | nmdc:mga00v17_4078_c1 | nmdc:mga00v17_4078_c1_2559_3197 | 212 |
| 152 | 3300050493 | nmdc:mga0k408_559_c1 | nmdc:mga0k408_559_c1_14723_15361 | 212 |
| 153 | 3300050494 | nmdc:mga06z11_161_c1 | nmdc:mga06z11_161_c1_16331_16969 | 212 |
| 154 | 3300050495 | nmdc:mga04h51_1410_c1 | nmdc:mga04h51_1410_c1_2202_2840 | 212 |
| 155 | 3300005530 | Ga0070679_100623251 | Ga0070679_1006232511 | 213 |
| 156 | 3300005563 | Ga0068855_100025845 | Ga0068855_1000258455 | 213 |
| 157 | 3300025949 | Ga0207667_10077997 | Ga0207667_100779974 | 213 |
| 158 | 3300001915 | JGI24741J21665_1004084 | JGI24741J21665_10040843 | 214 |
| 159 | 3300001979 | JGI24740J21852_10003850 | JGI24740J21852_100038502 | 214 |
| 160 | 3300001990 | JGI24737J22298_10000010 | JGI24737J22298_1000001041 | 214 |
| 161 | 3300002067 | JGI24735J21928_10000052 | JGI24735J21928_1000005222 | 214 |
| 162 | 3300005563 | Ga0068855_100000001 | Ga0068855_100000001541 | 214 |
| 163 | 3300009174 | Ga0105241_10000003 | Ga0105241_10000003839 | 214 |
| 164 | 3300009545 | Ga0105237_10493770 | Ga0105237_104937702 | 214 |
| 165 | 3300009986 | Ga0105033_100115 | Ga0105033_1001156 | 214 |
| 166 | 3300013105 | Ga0157369_10000054 | Ga0157369_1000005467 | 214 |
| 167 | 3300013308 | Ga0157375_10601917 | Ga0157375_106019172 | 214 |
| 168 | 3300025911 | Ga0207654_10000002 | Ga0207654_10000002369 | 214 |
| 169 | 3300025914 | Ga0207671_10309742 | Ga0207671_103097422 | 214 |
| 170 | 3300025917 | Ga0207660_10209761 | Ga0207660_102097612 | 214 |
| 171 | 3300025949 | Ga0207667_10000003 | Ga0207667_10000003529 | 214 |
| 172 | 3300050493 | nmdc:mga0k408_46151_c1 | nmdc:mga0k408_46151_c1_850_1494 | 214 |
| 173 | 3300053137 | Ga0500561_0000002 | Ga0500561_0000002_86522_87166 | 214 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6djy-assembly1.cif.gz_C | fako virus | 0.4402 | 138 | 210 |
| 6djy-assembly1.cif.gz_B | fako virus | 0.407 | 142 | 208 |
| 6csm-assembly2.cif.gz_C | crystal structure of the natural light-gated anion channel gtacr1 | 0.3634 | 60 | 212 |
| 6edq-assembly1.cif.gz_A | crystal structure of the light-gated anion channelrhodopsin gtacr1 | 0.3577 | 60 | 212 |
| 4q2e-assembly1.cif.gz_A | crystal structure of an intramembrane cdp-dag synthetase central for phospholipid biosynthesis (s200c/s258c, active mutant) | 0.3473 | 10 | 213 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q17477_122_396_1.10.600.10 | Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase | 0.3867 | 15 | 212 | 1.10.600.10 |
| af_A8DY63_1_264_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.3841 | 30 | 213 | 1.20.1250.20 |
| af_Q2FVV0_1_118_1.10.1760.20 | Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; | 0.3765 | 57 | 168 | 1.10.1760.20 |
| af_Q330K2_57_309_1.10.600.10 | Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase | 0.3676 | 19 | 212 | 1.10.600.10 |
| af_E7FB98_52_212_1.10.357.140 | Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase | 0.3675 | 87 | 210 | 1.10.357.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2M7U0L6-F1-model_v4 | Phosphatidate cytidylyltransferase | 0.9689 | 8 | 212 |
GO:0004143
GO:0016020 |
| AF-A0A522TX13-F1-model_v4 | Phosphatidate cytidylyltransferase | 0.9546 | 6 | 212 |
GO:0004143
GO:0016020 |
| AF-A0A7T9KG14-F1-model_v4 | deleted | 0.9538 | 8 | 213 |
|
| AF-A0A7T9K734-F1-model_v4 | deleted | 0.9536 | 5 | 210 |
|
| AF-A0A2M7U0L6-F1-model_v4 | Phosphatidate cytidylyltransferase | 0.9508 | 8 | 212 |
GO:0004143
GO:0016020 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar