F262273

General Info

Members Datasets Scaffolds Average Seq Length
173 118 173 208

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100025845|Ga0068855_1000258455
Length 226
Sequence MYFFSATEKMAVGVQYIEMALILTALGVFIILLASELWWRYKNPQSELSRKFVHITVGTFVAFWPFFLNWNQIRLLALGFAVTVVVSKTFHIFRAIHSVQRPTWGEVYFALVVGLLTFVTHSKSIYAASLLQMSLADGLAAVVGVRFGKRHRYKVLGHPKSYLGTATFLVVSVLLLVGYIVTGHDLAVSHLIGLAILASLGENFGVAGLDNLFVPLLVALVLTKIG

Samples

Sample ID Description Type Environment
1 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
23 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
24 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
25 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
26 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
27 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
28 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
29 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
33 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
34 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
35 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
36 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
37 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
40 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
41 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
42 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
47 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
48 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
49 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
71 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
72 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
74 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
75 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
76 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
77 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
78 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
79 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
80 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
81 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
82 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
83 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
84 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
85 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
86 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
88 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
95 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
96 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
97 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
99 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
100 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
101 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
102 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
103 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
104 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
105 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
106 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
107 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
108 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
109 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
110 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
111 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
112 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
113 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
114 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
115 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
116 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
117 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
118 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.23
Nodule 0
Rhizoplane 1.16
Rhizosphere 77.46
Stem 0
Stem Tuber 0
Unclassified 1.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1004084 3300001915 Bacteria 3313
2 JGI24740J21852_10003850 3300001979 Bacteria 6513
3 JGI24737J22298_10000010 3300001990 Bacteria 55828
4 JGI24735J21928_10000052 3300002067 Bacteria 50482
5 rootH2_10118052 3300003320 Bacteria 1087
6 rootH1_10237707 3300003323 Bacteria 1302
7 Ga0070658_10000110 3300005327 Bacteria 73137
8 Ga0070658_10003611 3300005327 Bacteria 12676
9 Ga0070680_100054292 3300005336 Bacteria 3271
10 Ga0070660_100014556 3300005339 Bacteria 5672
11 Ga0070660_100662546 3300005339 Unclassified 874
12 Ga0070674_100000920 3300005356 Bacteria 15341
13 Ga0070674_100038701 3300005356 Bacteria 3216
14 Ga0070673_100000135 3300005364 Bacteria 35068
15 Ga0070688_100406794 3300005365 Bacteria 1008
16 Ga0070678_100023024 3300005456 Bacteria 4143
17 Ga0068867_100008149 3300005459 Bacteria 7403
18 Ga0070685_10000153 3300005466 Bacteria 45555
19 Ga0070679_100009863 3300005530 Bacteria 9035
20 Ga0070679_100038240 3300005530 Bacteria 4770
21 Ga0070679_100623251 3300005530 Bacteria 1022
22 Ga0068853_100010610 3300005539 Bacteria 7453
23 Ga0070665_100089540 3300005548 Bacteria 3083
24 Ga0070665_100126568 3300005548 Bacteria 2557
25 Ga0068855_100000001 3300005563 Bacteria 818777
26 Ga0068855_100001696 3300005563 Bacteria 27546
27 Ga0068855_100025845 3300005563 Bacteria 7022
28 Ga0068857_100019314 3300005577 Bacteria 5983
29 Ga0068856_100000002 3300005614 Bacteria 372816
30 Ga0068856_100029459 3300005614 Bacteria 5362
31 Ga0081455_10000008 3300005937 Bacteria 256558
32 Ga0075365_10023480 3300006038 Bacteria 3880
33 Ga0075365_10386897 3300006038 Unclassified 987
34 Ga0075368_10003024 3300006042 Bacteria 5560
35 Ga0075364_10014289 3300006051 Unclassified 4904
36 Ga0075364_10014372 3300006051 Bacteria 4891
37 Ga0075367_10000064 3300006178 Bacteria 26426
38 Ga0075366_10000007 3300006195 Bacteria 104412
39 Ga0075366_10000390 3300006195 Bacteria 20368
40 Ga0068871_100104069 3300006358 Bacteria 2381
41 Ga0068865_100021905 3300006881 Bacteria 4161
42 Ga0068865_100252964 3300006881 Unclassified 1391
43 Ga0105240_10000003 3300009093 Bacteria 1183681
44 Ga0105245_10000034 3300009098 Bacteria 147951
45 Ga0105245_10003608 3300009098 Bacteria 13810
46 Ga0105243_10000001 3300009148 Bacteria 1156578
47 Ga0105241_10000003 3300009174 Bacteria 839043
48 Ga0105242_10000001 3300009176 Bacteria 574039
49 Ga0105237_10017776 3300009545 Bacteria 7372
50 Ga0105237_10493770 3300009545 Bacteria 1231
51 Ga0105237_10647794 3300009545 Unclassified 1063
52 Ga0105033_100115 3300009986 Bacteria 6148
53 Ga0105028_100260 3300009993 Bacteria 5760
54 Ga0105239_10016426 3300010375 Bacteria 8184
55 Ga0105239_10061147 3300010375 Bacteria 4134
56 Ga0105239_11291569 3300010375 Unclassified 842
57 Ga0157373_10013501 3300013100 Bacteria 5989
58 Ga0157369_10000054 3300013105 Bacteria 162631
59 Ga0157369_10401184 3300013105 Bacteria 1422
60 Ga0157374_10001007 3300013296 Bacteria 24406
61 Ga0157374_10109096 3300013296 Bacteria 2661
62 Ga0157378_10092108 3300013297 Bacteria 2757
63 Ga0157372_10009002 3300013307 Bacteria 10613
64 Ga0157375_10490715 3300013308 Bacteria 1393
65 Ga0157375_10601917 3300013308 Bacteria 1258
66 Ga0163163_11307106 3300014325 Bacteria 787
67 Ga0157380_10312336 3300014326 Unclassified 1453
68 Ga0157377_10007925 3300014745 Bacteria 5157
69 Ga0157376_10000001 3300014969 Bacteria 842910
70 Ga0207647_10423664 3300025904 Unclassified 748
71 Ga0207705_10002683 3300025909 Bacteria 13630
72 Ga0207705_10004076 3300025909 Bacteria 11089
73 Ga0207654_10000002 3300025911 Bacteria 1460142
74 Ga0207707_10023891 3300025912 Bacteria 5345
75 Ga0207695_10000005 3300025913 Bacteria 1196715
76 Ga0207671_10008360 3300025914 Bacteria 8787
77 Ga0207671_10309742 3300025914 Bacteria 1248
78 Ga0207660_10001720 3300025917 Bacteria 14673
79 Ga0207660_10209761 3300025917 Bacteria 1525
80 Ga0207657_10005411 3300025919 Bacteria 13348
81 Ga0207652_10002857 3300025921 Bacteria 14455
82 Ga0207652_10005234 3300025921 Bacteria 10544
83 Ga0207652_10014032 3300025921 Bacteria 6486
84 Ga0207652_10696049 3300025921 Unclassified 907
85 Ga0207694_10225564 3300025924 Bacteria 1529
86 Ga0207687_10000365 3300025927 Bacteria 30197
87 Ga0207687_10006750 3300025927 Bacteria 7563
88 Ga0207686_10000001 3300025934 Bacteria 1169580
89 Ga0207686_10130331 3300025934 Bacteria 1724
90 Ga0207709_10000002 3300025935 Bacteria 1171536
91 Ga0207669_10003540 3300025937 Bacteria 6761
92 Ga0207669_10160053 3300025937 Bacteria 1589
93 Ga0207667_10000003 3300025949 Bacteria 822935
94 Ga0207667_10077997 3300025949 Bacteria 3434
95 Ga0207651_10000161 3300025960 Bacteria 28725
96 Ga0207639_10057419 3300026041 Bacteria 2988
97 Ga0207702_10000001 3300026078 Bacteria 895738
98 Ga0207702_10212926 3300026078 Bacteria 1797
99 Ga0207648_10107514 3300026089 Bacteria 2448
100 Ga0207674_10010396 3300026116 Bacteria 10545
101 Ga0207683_10002915 3300026121 Bacteria 14921
102 Ga0209813_10001309 3300027866 Bacteria 5560
103 Ga0207428_10039913 3300027907 Bacteria 3810
104 Ga0268266_10000662 3300028379 Bacteria 46629
105 Ga0268266_10067525 3300028379 Bacteria 3095
106 Ga0265328_10054128 3300031239 Bacteria 1472
107 Ga0395899_0004205 3300037312 Bacteria 11292
108 Ga0395899_0004429 3300037312 Bacteria 10954
109 Ga0395900_0000712 3300037418 Bacteria 44237
110 Ga0395900_0020741 3300037418 Bacteria 6716
111 Ga0395900_0076796 3300037418 Bacteria 3432
112 Ga0395900_0160164 3300037418 Bacteria 2296
113 Ga0395900_0354632 3300037418 Bacteria 1440
114 Ga0395900_0371288 3300037418 Bacteria 1400
115 Ga0395898_0003669 3300037466 Bacteria 17057
116 Ga0395898_0039881 3300037466 Bacteria 4646
117 Ga0395898_0463892 3300037466 Bacteria 1206
118 Ga0395898_0705951 3300037466 Bacteria 950
119 Ga0395905_0000943 3300037471 Bacteria 37400
120 Ga0395905_0179759 3300037471 Bacteria 1986
121 Ga0395905_0411271 3300037471 Bacteria 1248
122 Ga0395901_0004150 3300038443 Bacteria 14616
123 Ga0395901_0008932 3300038443 Bacteria 10149
124 Ga0395901_0011341 3300038443 Bacteria 9031
125 Ga0395901_0299671 3300038443 Bacteria 1667
126 Ga0395901_0364513 3300038443 Bacteria 1489
127 Ga0466963_0227484 3300044694 Bacteria 1307
128 Ga0495649_0000100 3300046694 Bacteria 75606
129 Ga0495686_0158553 3300047472 Bacteria 1324
130 Ga0496109_0150534 3300048912 Unclassified 2178
131 Ga0496112_0119686 3300048915 Bacteria 2603
132 Ga0501031_0001813 3300049568 Bacteria 13426
133 Ga0501032_0001512 3300049569 Bacteria 18574
134 Ga0501034_0018818 3300049571 Bacteria 7079
135 Ga0501036_0010730 3300049572 Bacteria 7574
136 Ga0501037_0000138 3300049573 Bacteria 68040
137 Ga0501038_0084468 3300049574 Bacteria 2671
138 Ga0501043_0000062 3300049579 Bacteria 95664
139 Ga0501046_0000059 3300049580 Bacteria 126801
140 Ga0501047_0000032 3300049581 Bacteria 208294
141 Ga0501048_0015216 3300049582 Bacteria 5683
142 Ga0501069_0024818 3300049585 Bacteria 3273
143 Ga0501070_0036147 3300049586 Bacteria 4125
144 Ga0501083_0058577 3300049744 Bacteria 2577
145 Ga0501035_0001735 3300049822 Bacteria 22038
146 Ga0501044_0012395 3300049823 Bacteria 9230
147 nmdc:mga00v17_17000_c2 3300050491 Bacteria 2061
148 nmdc:mga00v17_4078_c1 3300050491 Bacteria 7554
149 nmdc:mga0yw44_29557_c1 3300050492 Bacteria 3164
150 nmdc:mga0yw44_77707_c1 3300050492 Bacteria 2074
151 nmdc:mga0k408_1745_c1 3300050493 Bacteria 7483
152 nmdc:mga0k408_29_c1 3300050493 Bacteria 89645
153 nmdc:mga0k408_46151_c1 3300050493 Bacteria 2515
154 nmdc:mga0k408_559_c1 3300050493 Bacteria 20485
155 nmdc:mga06z11_161_c1 3300050494 Bacteria 26426
156 nmdc:mga04h51_1410_c1 3300050495 Bacteria 5560
157 Ga0500610_0151846 3300053079 Bacteria 1160
158 Ga0500644_0002149 3300053088 Bacteria 4990
159 Ga0500646_0000179 3300053090 Bacteria 18884
160 Ga0500583_0050747 3300053092 Bacteria 1925
161 Ga0500651_0000011 3300053093 Bacteria 246573
162 Ga0500651_0009086 3300053093 Bacteria 5885
163 Ga0500650_0000001 3300053098 Bacteria 818797
164 Ga0500562_000002 3300053108 Bacteria 977234
165 Ga0500562_061956 3300053108 Bacteria 1005
166 Ga0500594_0000001 3300053118 Bacteria 1178472
167 Ga0500614_009889 3300053123 Bacteria 2039
168 Ga0500655_005652 3300053133 Bacteria 2249
169 Ga0500561_0000002 3300053137 Bacteria 394147
170 Ga0500577_0007692 3300053142 Bacteria 3033
171 Ga0500579_024698 3300053143 Bacteria 3883
172 Ga0500633_0006035 3300053160 Bacteria 2938
173 Ga0501082_0056233 3300060353 Bacteria 3389

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300014326 Ga0157380_10312336 Ga0157380_103123362 171
2 3300013100 Ga0157373_10013501 Ga0157373_1001350110 182
3 3300025909 Ga0207705_10004076 Ga0207705_1000407615 184
4 3300025917 Ga0207660_10001720 Ga0207660_1000172013 184
5 3300037312 Ga0395899_0004429 Ga0395899_0004429_6797_7426 187
6 3300037418 Ga0395900_0020741 Ga0395900_0020741_4619_5248 187
7 3300037466 Ga0395898_0039881 Ga0395898_0039881_3385_4014 187
8 3300037471 Ga0395905_0000943 Ga0395905_0000943_5784_6413 187
9 3300038443 Ga0395901_0011341 Ga0395901_0011341_4277_4906 187
10 3300013105 Ga0157369_10401184 Ga0157369_104011841 189
11 3300013307 Ga0157372_10009002 Ga0157372_100090026 189
12 3300005327 Ga0070658_10003611 Ga0070658_1000361116 190
13 3300005336 Ga0070680_100054292 Ga0070680_1000542921 190
14 3300005339 Ga0070660_100014556 Ga0070660_1000145563 190
15 3300005530 Ga0070679_100038240 Ga0070679_1000382401 190
16 3300005937 Ga0081455_10000008 Ga0081455_10000008159 190
17 3300025919 Ga0207657_10005411 Ga0207657_1000541110 190
18 3300025921 Ga0207652_10005234 Ga0207652_100052346 190
19 3300038443 Ga0395901_0364513 Ga0395901_0364513_828_1469 195
20 3300014325 Ga0163163_11307106 Ga0163163_113071062 205
21 3300003323 rootH1_10237707 rootH1_102377071 208
22 3300005327 Ga0070658_10000110 Ga0070658_1000011018 208
23 3300005339 Ga0070660_100662546 Ga0070660_1006625461 208
24 3300005356 Ga0070674_100000920 Ga0070674_10000092017 208
25 3300005356 Ga0070674_100038701 Ga0070674_1000387015 208
26 3300005364 Ga0070673_100000135 Ga0070673_10000013518 208
27 3300005365 Ga0070688_100406794 Ga0070688_1004067941 208
28 3300005456 Ga0070678_100023024 Ga0070678_1000230244 208
29 3300005459 Ga0068867_100008149 Ga0068867_1000081495 208
30 3300005466 Ga0070685_10000153 Ga0070685_1000015315 208
31 3300005539 Ga0068853_100010610 Ga0068853_1000106104 208
32 3300005548 Ga0070665_100089540 Ga0070665_1000895403 208
33 3300005548 Ga0070665_100126568 Ga0070665_1001265683 208
34 3300006358 Ga0068871_100104069 Ga0068871_1001040692 208
35 3300006881 Ga0068865_100021905 Ga0068865_1000219054 208
36 3300006881 Ga0068865_100252964 Ga0068865_1002529642 208
37 3300009093 Ga0105240_10000003 Ga0105240_10000003332 208
38 3300009098 Ga0105245_10000034 Ga0105245_10000034133 208
39 3300009098 Ga0105245_10003608 Ga0105245_100036085 208
40 3300009148 Ga0105243_10000001 Ga0105243_10000001918 208
41 3300009176 Ga0105242_10000001 Ga0105242_10000001341 208
42 3300009545 Ga0105237_10017776 Ga0105237_1001777611 208
43 3300010375 Ga0105239_10016426 Ga0105239_100164268 208
44 3300010375 Ga0105239_10061147 Ga0105239_100611473 208
45 3300013296 Ga0157374_10001007 Ga0157374_1000100723 208
46 3300013296 Ga0157374_10109096 Ga0157374_101090961 208
47 3300013297 Ga0157378_10092108 Ga0157378_100921083 208
48 3300013308 Ga0157375_10490715 Ga0157375_104907153 208
49 3300014745 Ga0157377_10007925 Ga0157377_100079255 208
50 3300014969 Ga0157376_10000001 Ga0157376_10000001571 208
51 3300025909 Ga0207705_10002683 Ga0207705_100026836 208
52 3300025912 Ga0207707_10023891 Ga0207707_100238915 208
53 3300025913 Ga0207695_10000005 Ga0207695_10000005340 208
54 3300025914 Ga0207671_10008360 Ga0207671_1000836013 208
55 3300025921 Ga0207652_10696049 Ga0207652_106960491 208
56 3300025924 Ga0207694_10225564 Ga0207694_102255642 208
57 3300025927 Ga0207687_10000365 Ga0207687_1000036528 208
58 3300025927 Ga0207687_10006750 Ga0207687_1000675010 208
59 3300025934 Ga0207686_10000001 Ga0207686_10000001223 208
60 3300025934 Ga0207686_10130331 Ga0207686_101303312 208
61 3300025935 Ga0207709_10000002 Ga0207709_10000002340 208
62 3300025937 Ga0207669_10003540 Ga0207669_100035402 208
63 3300025937 Ga0207669_10160053 Ga0207669_101600531 208
64 3300025960 Ga0207651_10000161 Ga0207651_1000016120 208
65 3300026041 Ga0207639_10057419 Ga0207639_100574195 208
66 3300026089 Ga0207648_10107514 Ga0207648_101075144 208
67 3300026121 Ga0207683_10002915 Ga0207683_100029154 208
68 3300027907 Ga0207428_10039913 Ga0207428_100399132 208
69 3300028379 Ga0268266_10000662 Ga0268266_100006629 208
70 3300028379 Ga0268266_10067525 Ga0268266_100675252 208
71 3300037418 Ga0395900_0354632 Ga0395900_0354632_469_1095 208
72 3300037418 Ga0395900_0371288 Ga0395900_0371288_377_1003 208
73 3300038443 Ga0395901_0299671 Ga0395901_0299671_247_873 208
74 3300047472 Ga0495686_0158553 Ga0495686_0158553_68_694 208
75 3300048912 Ga0496109_0150534 Ga0496109_0150534_604_1230 208
76 3300048915 Ga0496112_0119686 Ga0496112_0119686_1845_2471 208
77 3300053093 Ga0500651_0000011 Ga0500651_0000011_28674_29300 208
78 3300053093 Ga0500651_0009086 Ga0500651_0009086_4433_5059 208
79 3300053123 Ga0500614_009889 Ga0500614_009889_352_978 208
80 3300005530 Ga0070679_100009863 Ga0070679_1000098636 209
81 3300005563 Ga0068855_100001696 Ga0068855_10000169631 209
82 3300005577 Ga0068857_100019314 Ga0068857_1000193147 209
83 3300005614 Ga0068856_100029459 Ga0068856_1000294592 209
84 3300009545 Ga0105237_10647794 Ga0105237_106477941 209
85 3300010375 Ga0105239_11291569 Ga0105239_112915692 209
86 3300025904 Ga0207647_10423664 Ga0207647_104236641 209
87 3300025921 Ga0207652_10002857 Ga0207652_1000285713 209
88 3300025921 Ga0207652_10014032 Ga0207652_100140326 209
89 3300026078 Ga0207702_10212926 Ga0207702_102129262 209
90 3300026116 Ga0207674_10010396 Ga0207674_100103966 209
91 3300031239 Ga0265328_10054128 Ga0265328_100541282 209
92 3300037312 Ga0395899_0004205 Ga0395899_0004205_8795_9424 209
93 3300037418 Ga0395900_0000712 Ga0395900_0000712_23051_23680 209
94 3300037418 Ga0395900_0076796 Ga0395900_0076796_1754_2383 209
95 3300037466 Ga0395898_0003669 Ga0395898_0003669_15264_15893 209
96 3300037466 Ga0395898_0463892 Ga0395898_0463892_10_639 209
97 3300037466 Ga0395898_0705951 Ga0395898_0705951_28_657 209
98 3300037471 Ga0395905_0179759 Ga0395905_0179759_818_1447 209
99 3300037471 Ga0395905_0411271 Ga0395905_0411271_457_1086 209
100 3300038443 Ga0395901_0004150 Ga0395901_0004150_7090_7719 209
101 3300038443 Ga0395901_0008932 Ga0395901_0008932_1214_1843 209
102 3300049568 Ga0501031_0001813 Ga0501031_0001813_10977_11606 209
103 3300049569 Ga0501032_0001512 Ga0501032_0001512_13545_14174 209
104 3300049571 Ga0501034_0018818 Ga0501034_0018818_2952_3581 209
105 3300049572 Ga0501036_0010730 Ga0501036_0010730_6592_7221 209
106 3300049573 Ga0501037_0000138 Ga0501037_0000138_23244_23873 209
107 3300049574 Ga0501038_0084468 Ga0501038_0084468_1527_2156 209
108 3300049579 Ga0501043_0000062 Ga0501043_0000062_84424_85053 209
109 3300049580 Ga0501046_0000059 Ga0501046_0000059_41077_41706 209
110 3300049581 Ga0501047_0000032 Ga0501047_0000032_173729_174358 209
111 3300049582 Ga0501048_0015216 Ga0501048_0015216_3028_3657 209
112 3300049585 Ga0501069_0024818 Ga0501069_0024818_2500_3129 209
113 3300049586 Ga0501070_0036147 Ga0501070_0036147_317_946 209
114 3300049744 Ga0501083_0058577 Ga0501083_0058577_1873_2502 209
115 3300049822 Ga0501035_0001735 Ga0501035_0001735_7002_7631 209
116 3300049823 Ga0501044_0012395 Ga0501044_0012395_6538_7167 209
117 3300060353 Ga0501082_0056233 Ga0501082_0056233_2525_3154 209
118 3300003320 rootH2_10118052 rootH2_101180522 210
119 3300006038 Ga0075365_10023480 Ga0075365_100234804 210
120 3300006038 Ga0075365_10386897 Ga0075365_103868972 210
121 3300006051 Ga0075364_10014289 Ga0075364_100142893 210
122 3300006195 Ga0075366_10000007 Ga0075366_1000000761 210
123 3300009993 Ga0105028_100260 Ga0105028_1002605 210
124 3300037418 Ga0395900_0160164 Ga0395900_0160164_1642_2274 210
125 3300044694 Ga0466963_0227484 Ga0466963_0227484_75_707 210
126 3300046694 Ga0495649_0000100 Ga0495649_0000100_48599_49231 210
127 3300050491 nmdc:mga00v17_17000_c2 nmdc:mga00v17_17000_c2_716_1348 210
128 3300050492 nmdc:mga0yw44_29557_c1 nmdc:mga0yw44_29557_c1_441_1073 210
129 3300050492 nmdc:mga0yw44_77707_c1 nmdc:mga0yw44_77707_c1_1085_1717 210
130 3300050493 nmdc:mga0k408_1745_c1 nmdc:mga0k408_1745_c1_1067_1699 210
131 3300050493 nmdc:mga0k408_29_c1 nmdc:mga0k408_29_c1_24894_25526 210
132 3300053108 Ga0500562_000002 Ga0500562_000002_542840_543472 210
133 3300053079 Ga0500610_0151846 Ga0500610_0151846_224_859 211
134 3300053088 Ga0500644_0002149 Ga0500644_0002149_2370_3005 211
135 3300053090 Ga0500646_0000179 Ga0500646_0000179_3583_4218 211
136 3300053092 Ga0500583_0050747 Ga0500583_0050747_1083_1718 211
137 3300053098 Ga0500650_0000001 Ga0500650_0000001_66474_67109 211
138 3300053108 Ga0500562_061956 Ga0500562_061956_151_786 211
139 3300053118 Ga0500594_0000001 Ga0500594_0000001_731274_731909 211
140 3300053133 Ga0500655_005652 Ga0500655_005652_780_1415 211
141 3300053142 Ga0500577_0007692 Ga0500577_0007692_781_1416 211
142 3300053143 Ga0500579_024698 Ga0500579_024698_2304_2939 211
143 3300053160 Ga0500633_0006035 Ga0500633_0006035_1604_2239 211
144 3300005614 Ga0068856_100000002 Ga0068856_10000000262 212
145 3300006042 Ga0075368_10003024 Ga0075368_100030243 212
146 3300006051 Ga0075364_10014372 Ga0075364_100143725 212
147 3300006178 Ga0075367_10000064 Ga0075367_1000006425 212
148 3300006195 Ga0075366_10000390 Ga0075366_1000039017 212
149 3300026078 Ga0207702_10000001 Ga0207702_10000001366 212
150 3300027866 Ga0209813_10001309 Ga0209813_100013096 212
151 3300050491 nmdc:mga00v17_4078_c1 nmdc:mga00v17_4078_c1_2559_3197 212
152 3300050493 nmdc:mga0k408_559_c1 nmdc:mga0k408_559_c1_14723_15361 212
153 3300050494 nmdc:mga06z11_161_c1 nmdc:mga06z11_161_c1_16331_16969 212
154 3300050495 nmdc:mga04h51_1410_c1 nmdc:mga04h51_1410_c1_2202_2840 212
155 3300005530 Ga0070679_100623251 Ga0070679_1006232511 213
156 3300005563 Ga0068855_100025845 Ga0068855_1000258455 213
157 3300025949 Ga0207667_10077997 Ga0207667_100779974 213
158 3300001915 JGI24741J21665_1004084 JGI24741J21665_10040843 214
159 3300001979 JGI24740J21852_10003850 JGI24740J21852_100038502 214
160 3300001990 JGI24737J22298_10000010 JGI24737J22298_1000001041 214
161 3300002067 JGI24735J21928_10000052 JGI24735J21928_1000005222 214
162 3300005563 Ga0068855_100000001 Ga0068855_100000001541 214
163 3300009174 Ga0105241_10000003 Ga0105241_10000003839 214
164 3300009545 Ga0105237_10493770 Ga0105237_104937702 214
165 3300009986 Ga0105033_100115 Ga0105033_1001156 214
166 3300013105 Ga0157369_10000054 Ga0157369_1000005467 214
167 3300013308 Ga0157375_10601917 Ga0157375_106019172 214
168 3300025911 Ga0207654_10000002 Ga0207654_10000002369 214
169 3300025914 Ga0207671_10309742 Ga0207671_103097422 214
170 3300025917 Ga0207660_10209761 Ga0207660_102097612 214
171 3300025949 Ga0207667_10000003 Ga0207667_10000003529 214
172 3300050493 nmdc:mga0k408_46151_c1 nmdc:mga0k408_46151_c1_850_1494 214
173 3300053137 Ga0500561_0000002 Ga0500561_0000002_86522_87166 214

Structural Annotation

Top 5 Hits

ID Description Score Start End
6djy-assembly1.cif.gz_C fako virus 0.4402 138 210
6djy-assembly1.cif.gz_B fako virus 0.407 142 208
6csm-assembly2.cif.gz_C crystal structure of the natural light-gated anion channel gtacr1 0.3634 60 212
6edq-assembly1.cif.gz_A crystal structure of the light-gated anion channelrhodopsin gtacr1 0.3577 60 212
4q2e-assembly1.cif.gz_A crystal structure of an intramembrane cdp-dag synthetase central for phospholipid biosynthesis (s200c/s258c, active mutant) 0.3473 10 213
ID Description Score Start End Superfamily
af_Q17477_122_396_1.10.600.10 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.3867 15 212 1.10.600.10
af_A8DY63_1_264_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3841 30 213 1.20.1250.20
af_Q2FVV0_1_118_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.3765 57 168 1.10.1760.20
af_Q330K2_57_309_1.10.600.10 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.3676 19 212 1.10.600.10
af_E7FB98_52_212_1.10.357.140 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase 0.3675 87 210 1.10.357.140
ID Description Score Start End GO Terms
AF-A0A2M7U0L6-F1-model_v4 Phosphatidate cytidylyltransferase 0.9689 8 212 GO:0004143
GO:0016020
AF-A0A522TX13-F1-model_v4 Phosphatidate cytidylyltransferase 0.9546 6 212 GO:0004143
GO:0016020
AF-A0A7T9KG14-F1-model_v4 deleted 0.9538 8 213
AF-A0A7T9K734-F1-model_v4 deleted 0.9536 5 210
AF-A0A2M7U0L6-F1-model_v4 Phosphatidate cytidylyltransferase 0.9508 8 212 GO:0004143
GO:0016020

Feature Viewer

pLDDT pTM Quality
89.01 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map