F262100

General Info

Members Datasets Scaffolds Average Seq Length
173 115 346 335

Family's Representative Sequence

Representative Sequence 3300005356|Ga0070674_100174115|Ga0070674_1001741152
Length 379
Sequence MRTDTAGQPIPAAFAAAAPAAAVSDRTGGAAAFQNAGVRNAVRWVALAIATALVTVAVGAVGLPSPALFAALLVGLVYALRSDVTLVPAPTVAAGAQAMVGVAMGASFDAESLTELGGRWLGVAVVVLGTLAVSLLAGLVLAAVTGVDRPTALLGLVAGGASGIVSMADELRADARLVAFMQYARVLVVVLVAPIVVALFLGGSHPGRAGAEAGDAGLAADLAYAGGACAGGLALARLLPIPAGTVLLPMIVAAVLSGTGLTGDAAVPALVQDVAFALVGLQVGLRFTPATVRLARRILPATGVTYADAYLATTPGGLYAVLATALDGGGTDPAFVLAVQALRLLIMVLAAPLLVRLLLRTRHGRAPESGPAETASYPP

Samples

Sample ID Description Type Environment
1 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
18 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
27 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
28 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
29 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
31 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
32 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
33 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
34 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
35 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
36 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
37 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
38 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
39 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
61 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
62 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
63 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
64 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
65 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
66 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
67 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
68 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
69 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
70 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
71 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
72 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
73 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
74 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
75 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
76 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
77 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
78 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
79 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
80 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
81 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
82 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
83 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
84 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
85 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
86 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
87 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
88 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
89 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
90 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
91 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
92 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
93 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
94 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
95 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
96 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
98 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
107 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
108 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
109 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
110 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
111 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
114 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
115 8002775197 Frankia nepalensis CN7 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.42
Metatranscriptomes 0
Isolates 0.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.73
Nodule 0.58
Rhizoplane 13.87
Rhizosphere 83.24
Stem 0
Stem Tuber 0
Unclassified 2.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070674_100174115 3300005356 Bacteria 1643
2 JGI25406J46586_10014873 3300003203 Bacteria 3297
3 JGI25406J46586_10020348 3300003203 Bacteria 2685
4 Ga0055532_1000038 3300003758 Bacteria 198387
5 Ga0070658_10186504 3300005327 Bacteria 1747
6 Ga0070676_10249419 3300005328 Bacteria 1184
7 Ga0070683_100116966 3300005329 Bacteria 2517
8 Ga0070683_100175509 3300005329 Bacteria 2034
9 Ga0070683_100230730 3300005329 Bacteria 1760
10 Ga0070670_100185594 3300005331 Bacteria 1806
11 Ga0070677_10070825 3300005333 Bacteria 1466
12 Ga0068868_100012049 3300005338 Bacteria 6313
13 Ga0068868_100296560 3300005338 Bacteria 1372
14 Ga0070668_100005437 3300005347 Bacteria 9456
15 Ga0070668_100225345 3300005347 Bacteria 1548
16 Ga0070667_100014359 3300005367 Bacteria 6544
17 Ga0070667_100184903 3300005367 Bacteria 1844
18 Ga0070713_100070625 3300005436 Bacteria 2948
19 Ga0070678_100065700 3300005456 Bacteria 2694
20 Ga0068867_100158415 3300005459 Bacteria 1784
21 Ga0068867_100312609 3300005459 Bacteria 1299
22 Ga0070685_10212902 3300005466 Unclassified 1262
23 Ga0070684_100039429 3300005535 Bacteria 4063
24 Ga0070684_100054006 3300005535 Bacteria 3500
25 Ga0070684_100199703 3300005535 Bacteria 1821
26 Ga0070672_100094820 3300005543 Bacteria 2413
27 Ga0070672_100122082 3300005543 Bacteria 2133
28 Ga0070693_100038633 3300005547 Bacteria 2669
29 Ga0070665_100070919 3300005548 Bacteria 3491
30 Ga0068857_100315508 3300005577 Bacteria 1443
31 Ga0068852_100234425 3300005616 Bacteria 1751
32 Ga0068858_100149874 3300005842 Bacteria 2192
33 Ga0068862_100015136 3300005844 Bacteria 6406
34 Ga0081455_10020524 3300005937 Bacteria 6217
35 Ga0081539_10005586 3300005985 Bacteria 12696
36 Ga0075365_10024984 3300006038 Bacteria 3777
37 Ga0070712_100222370 3300006175 Bacteria 1495
38 Ga0075428_100353521 3300006844 Bacteria 1577
39 Ga0111539_10178330 3300009094 Bacteria 2482
40 Ga0105245_10034328 3300009098 Bacteria 4499
41 Ga0105245_10058420 3300009098 Bacteria 3472
42 Ga0105249_10070306 3300009553 Bacteria 3231
43 Ga0157369_10291955 3300013105 Bacteria 1697
44 Ga0157374_10182313 3300013296 Bacteria 2051
45 Ga0157372_10078412 3300013307 Bacteria 3732
46 Ga0157372_10091118 3300013307 Bacteria 3467
47 Ga0157372_10266405 3300013307 Bacteria 1990
48 Ga0157375_10027645 3300013308 Bacteria 5306
49 Ga0163163_10065565 3300014325 Bacteria 3605
50 Ga0163163_10136191 3300014325 Bacteria 2497
51 Ga0157379_10052480 3300014968 Bacteria 3643
52 Ga0209147_100081 3300025229 Bacteria 195314
53 Ga0207662_10155569 3300025918 Bacteria 1457
54 Ga0207657_10072951 3300025919 Bacteria 2902
55 Ga0207650_10134995 3300025925 Bacteria 1935
56 Ga0207690_10011189 3300025932 Bacteria 5357
57 Ga0207706_10178977 3300025933 Bacteria 1862
58 Ga0207709_10187176 3300025935 Bacteria 1467
59 Ga0207669_10057216 3300025937 Bacteria 2373
60 Ga0207665_10078522 3300025939 Bacteria 2267
61 Ga0207691_10088240 3300025940 Bacteria 2782
62 Ga0207691_10226178 3300025940 Bacteria 1621
63 Ga0207661_10096884 3300025944 Bacteria 2469
64 Ga0207661_10204727 3300025944 Bacteria 1737
65 Ga0207661_10249044 3300025944 Bacteria 1579
66 Ga0207679_10231709 3300025945 Bacteria 1560
67 Ga0207712_10033701 3300025961 Bacteria 3464
68 Ga0207668_10011777 3300025972 Bacteria 5329
69 Ga0207668_10175361 3300025972 Bacteria 1686
70 Ga0207658_10233299 3300025986 Bacteria 1554
71 Ga0207677_10013084 3300026023 Bacteria 4796
72 Ga0207708_10112462 3300026075 Bacteria 2115
73 Ga0207648_10066701 3300026089 Bacteria 3138
74 Ga0207648_10224121 3300026089 Bacteria 1671
75 Ga0207676_10265206 3300026095 Bacteria 1553
76 Ga0207675_100558096 3300026118 Bacteria 1145
77 Ga0207698_10091288 3300026142 Bacteria 2493
78 Ga0268265_10014473 3300028380 Bacteria 5375
79 Ga0307513_10007274 3300031456 Bacteria 14374
80 Ga0307410_10005009 3300031852 Bacteria 6949
81 Ga0307410_10265357 3300031852 Bacteria 1341
82 Ga0307406_10005547 3300031901 Bacteria 6901
83 Ga0307407_10040070 3300031903 Bacteria 2609
84 Ga0307409_100016004 3300031995 Bacteria 4946
85 Ga0307409_100029130 3300031995 Bacteria 3947
86 Ga0307409_100313965 3300031995 Bacteria 1464
87 Ga0307416_100010471 3300032002 Bacteria 6126
88 Ga0307416_100209005 3300032002 Bacteria 1860
89 Ga0307411_10046167 3300032005 Bacteria 2806
90 Ga0307415_100011237 3300032126 Bacteria 5114
91 Ga0307415_100072572 3300032126 Bacteria 2425
92 Ga0307415_100085359 3300032126 Bacteria 2268
93 Ga0307415_100359336 3300032126 Unclassified 1229
94 Ga0395899_0191928 3300037312 Bacteria 1429
95 Ga0395900_0113617 3300037418 Unclassified 2779
96 Ga0395898_0024945 3300037466 Bacteria 6028
97 Ga0395898_0154675 3300037466 Bacteria 2194
98 Ga0395898_0174313 3300037466 Bacteria 2056
99 Ga0395898_0183323 3300037466 Bacteria 2001
100 Ga0395898_0340116 3300037466 Bacteria 1431
101 Ga0395905_0037396 3300037471 Bacteria 4558
102 Ga0395901_0007751 3300038443 Bacteria 10832
103 Ga0395901_0011490 3300038443 Bacteria 8973
104 Ga0395901_0188656 3300038443 Bacteria 2162
105 Ga0450900_007028 3300042136 Bacteria 1377
106 Ga0450908_007216 3300042184 Bacteria 2099
107 Ga0466963_0005803 3300044694 Bacteria 7263
108 Ga0466963_0016353 3300044694 Bacteria 4613
109 Ga0466963_0138337 3300044694 Bacteria 1686
110 Ga0466964_0013957 3300044706 Bacteria 3051
111 Ga0466971_0010877 3300044719 Bacteria 3980
112 Ga0466968_0088903 3300044735 Unclassified 1366
113 Ga0466957_0053796 3300044842 Bacteria 2455
114 Ga0466957_0205472 3300044842 Bacteria 1295
115 Ga0466960_0000587 3300044901 Bacteria 12595
116 Ga0466960_0005996 3300044901 Bacteria 4852
117 Ga0466958_0079849 3300045836 Bacteria 2012
118 Ga0466967_0003891 3300045976 Bacteria 9906
119 Ga0466967_0008476 3300045976 Bacteria 7541
120 Ga0466967_0074679 3300045976 Bacteria 3045
121 Ga0466967_0076151 3300045976 Bacteria 3017
122 Ga0466967_0087573 3300045976 Bacteria 2823
123 Ga0466967_0326347 3300045976 Bacteria 1481
124 Ga0466967_0359620 3300045976 Bacteria 1410
125 Ga0466967_0368039 3300045976 Bacteria 1394
126 Ga0466967_0379618 3300045976 Bacteria 1372
127 Ga0466967_0416572 3300045976 Bacteria 1309
128 Ga0495608_0083760 3300046511 Bacteria 2070
129 Ga0496101_0021551 3300048904 Bacteria 4428
130 Ga0496102_0039607 3300048905 Bacteria 4259
131 Ga0496102_0060402 3300048905 Bacteria 3466
132 Ga0496103_0027473 3300048906 Bacteria 3448
133 Ga0496104_0006413 3300048907 Bacteria 10348
134 Ga0496104_0283828 3300048907 Bacteria 1568
135 Ga0496105_0016145 3300048908 Bacteria 5956
136 Ga0496105_0212683 3300048908 Bacteria 1575
137 Ga0496107_0013681 3300048910 Bacteria 5674
138 Ga0496108_0003588 3300048911 Bacteria 12432
139 Ga0496108_0021622 3300048911 Bacteria 5286
140 Ga0496108_0163956 3300048911 Bacteria 1922
141 Ga0496109_0007913 3300048912 Bacteria 9007
142 Ga0496109_0044038 3300048912 Bacteria 4047
143 Ga0496109_0089585 3300048912 Bacteria 2844
144 Ga0496109_0111418 3300048912 Unclassified 2545
145 Ga0496109_0146940 3300048912 Bacteria 2206
146 Ga0496109_0201337 3300048912 Bacteria 1872
147 Ga0496110_0011621 3300048913 Bacteria 7218
148 Ga0496110_0070189 3300048913 Bacteria 3103
149 Ga0496111_0003951 3300048914 Bacteria 9303
150 Ga0496111_0129723 3300048914 Bacteria 1865
151 Ga0496112_0132457 3300048915 Bacteria 2464
152 Ga0496113_0130523 3300048916 Bacteria 1971
153 Ga0501031_0041686 3300049568 Bacteria 2997
154 Ga0501033_0023961 3300049570 Bacteria 4604
155 Ga0501034_0317414 3300049571 Bacteria 1491
156 Ga0501036_0036006 3300049572 Bacteria 4188
157 Ga0501037_0019360 3300049573 Bacteria 5020
158 Ga0501039_0049059 3300049575 Bacteria 3263
159 Ga0501042_0067744 3300049578 Bacteria 2552
160 Ga0501046_0096238 3300049580 Bacteria 2274
161 Ga0501047_0037156 3300049581 Bacteria 4709
162 Ga0501048_0051758 3300049582 Bacteria 2922
163 Ga0501067_0019197 3300049583 Bacteria 3784
164 Ga0501067_0085120 3300049583 Bacteria 1754
165 Ga0501068_0111079 3300049584 Bacteria 1704
166 Ga0501070_0029058 3300049586 Bacteria 4636
167 Ga0501072_0053585 3300049588 Bacteria 3177
168 Ga0501073_0015105 3300049589 Bacteria 5602
169 Ga0501035_0326624 3300049822 Bacteria 1288
170 Ga0501044_0105709 3300049823 Bacteria 2827
171 Ga0501045_0087790 3300049824 Bacteria 2297
172 Ga0530510_0308871 3300061734 Bacteria 1184
173 8002780554 8002775197 Bacteria 10728764
174 Ga0070674_100174115
175 JGI25406J46586_10014873
176 JGI25406J46586_10020348
177 Ga0055532_1000038
178 Ga0070658_10186504
179 Ga0070676_10249419
180 Ga0070683_100116966
181 Ga0070683_100175509
182 Ga0070683_100230730
183 Ga0070670_100185594
184 Ga0070677_10070825
185 Ga0068868_100012049
186 Ga0068868_100296560
187 Ga0070668_100005437
188 Ga0070668_100225345
189 Ga0070667_100014359
190 Ga0070667_100184903
191 Ga0070713_100070625
192 Ga0070678_100065700
193 Ga0068867_100158415
194 Ga0068867_100312609
195 Ga0070685_10212902
196 Ga0070684_100039429
197 Ga0070684_100054006
198 Ga0070684_100199703
199 Ga0070672_100094820
200 Ga0070672_100122082
201 Ga0070693_100038633
202 Ga0070665_100070919
203 Ga0068857_100315508
204 Ga0068852_100234425
205 Ga0068858_100149874
206 Ga0068862_100015136
207 Ga0081455_10020524
208 Ga0081539_10005586
209 Ga0075365_10024984
210 Ga0070712_100222370
211 Ga0075428_100353521
212 Ga0111539_10178330
213 Ga0105245_10034328
214 Ga0105245_10058420
215 Ga0105249_10070306
216 Ga0157369_10291955
217 Ga0157374_10182313
218 Ga0157372_10078412
219 Ga0157372_10091118
220 Ga0157372_10266405
221 Ga0157375_10027645
222 Ga0163163_10065565
223 Ga0163163_10136191
224 Ga0157379_10052480
225 Ga0209147_100081
226 Ga0207662_10155569
227 Ga0207657_10072951
228 Ga0207650_10134995
229 Ga0207690_10011189
230 Ga0207706_10178977
231 Ga0207709_10187176
232 Ga0207669_10057216
233 Ga0207665_10078522
234 Ga0207691_10088240
235 Ga0207691_10226178
236 Ga0207661_10096884
237 Ga0207661_10204727
238 Ga0207661_10249044
239 Ga0207679_10231709
240 Ga0207712_10033701
241 Ga0207668_10011777
242 Ga0207668_10175361
243 Ga0207658_10233299
244 Ga0207677_10013084
245 Ga0207708_10112462
246 Ga0207648_10066701
247 Ga0207648_10224121
248 Ga0207676_10265206
249 Ga0207675_100558096
250 Ga0207698_10091288
251 Ga0268265_10014473
252 Ga0307513_10007274
253 Ga0307410_10005009
254 Ga0307410_10265357
255 Ga0307406_10005547
256 Ga0307407_10040070
257 Ga0307409_100016004
258 Ga0307409_100029130
259 Ga0307409_100313965
260 Ga0307416_100010471
261 Ga0307416_100209005
262 Ga0307411_10046167
263 Ga0307415_100011237
264 Ga0307415_100072572
265 Ga0307415_100085359
266 Ga0307415_100359336
267 Ga0395899_0191928
268 Ga0395900_0113617
269 Ga0395898_0024945
270 Ga0395898_0154675
271 Ga0395898_0174313
272 Ga0395898_0183323
273 Ga0395898_0340116
274 Ga0395905_0037396
275 Ga0395901_0007751
276 Ga0395901_0011490
277 Ga0395901_0188656
278 Ga0450900_007028
279 Ga0450908_007216
280 Ga0466963_0005803
281 Ga0466963_0016353
282 Ga0466963_0138337
283 Ga0466964_0013957
284 Ga0466971_0010877
285 Ga0466968_0088903
286 Ga0466957_0053796
287 Ga0466957_0205472
288 Ga0466960_0000587
289 Ga0466960_0005996
290 Ga0466958_0079849
291 Ga0466967_0003891
292 Ga0466967_0008476
293 Ga0466967_0074679
294 Ga0466967_0076151
295 Ga0466967_0087573
296 Ga0466967_0326347
297 Ga0466967_0359620
298 Ga0466967_0368039
299 Ga0466967_0379618
300 Ga0466967_0416572
301 Ga0495608_0083760
302 Ga0496101_0021551
303 Ga0496102_0039607
304 Ga0496102_0060402
305 Ga0496103_0027473
306 Ga0496104_0006413
307 Ga0496104_0283828
308 Ga0496105_0016145
309 Ga0496105_0212683
310 Ga0496107_0013681
311 Ga0496108_0003588
312 Ga0496108_0021622
313 Ga0496108_0163956
314 Ga0496109_0007913
315 Ga0496109_0044038
316 Ga0496109_0089585
317 Ga0496109_0111418
318 Ga0496109_0146940
319 Ga0496109_0201337
320 Ga0496110_0011621
321 Ga0496110_0070189
322 Ga0496111_0003951
323 Ga0496111_0129723
324 Ga0496112_0132457
325 Ga0496113_0130523
326 Ga0501031_0041686
327 Ga0501033_0023961
328 Ga0501034_0317414
329 Ga0501036_0036006
330 Ga0501037_0019360
331 Ga0501039_0049059
332 Ga0501042_0067744
333 Ga0501046_0096238
334 Ga0501047_0037156
335 Ga0501048_0051758
336 Ga0501067_0019197
337 Ga0501067_0085120
338 Ga0501068_0111079
339 Ga0501070_0029058
340 Ga0501072_0053585
341 Ga0501073_0015105
342 Ga0501035_0326624
343 Ga0501044_0105709
344 Ga0501045_0087790
345 Ga0530510_0308871
346 8002780554

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05145

AbrB

Transition state regulatory protein AbrB

68

305

0.97

PF05145

AbrB

Transition state regulatory protein AbrB

300

359

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5a1s-assembly2.cif.gz_B crystal structure of the sodium-dependent citrate symporter secits form salmonella enterica. 0.5476 7 335
7b4m-assembly1.cif.gz_A cryoem structure of the human sodium proton exchanger nha2 in nanodisc 0.5451 7 336
5xar-assembly2.cif.gz_C structural insights into the elevator-like mechanism of the sodium/citrate symporter cits 0.5426 7 334
5bz2-assembly1.cif.gz_A-2 crystal structure of the sodium proton antiporter napa in inward-facing conformation 0.5384 7 340
5xat-assembly1.cif.gz_D structural insights into the elevator-like mechanism of the sodium/citrate symporter cits 0.5372 7 338
ID Description Score Start End Superfamily
af_Q9FLW1_79_442_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.7056 10 336 1.20.1530.20
af_Q9FLW1_79_442_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.6789 10 336 1.20.1530.20
af_Q2FXR6_31_348_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.6693 28 337 1.20.1530.20
af_Q2FXR6_31_348_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.6543 28 337 1.20.1530.20
af_P0AER8_2_366_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.6163 5 320 1.20.1530.20
ID Description Score Start End GO Terms
AF-A0A6N7H774-F1-model_v4 AbrB family transcriptional regulator 0.9396 2 341 GO:0010468
GO:0016020
AF-A0A437M9G5-F1-model_v4 AbrB family transcriptional regulator 0.9379 2 337 GO:0010468
GO:0016020
AF-A0A838GJ02-F1-model_v4 AbrB family transcriptional regulator 0.9334 5 340 GO:0010468
GO:0016020
AF-A0A6N7H774-F1-model_v4 AbrB family transcriptional regulator 0.9316 2 341 GO:0010468
GO:0016020
AF-A0A1N6QMP3-F1-model_v4 Ammonia monooxygenase 0.9298 2 338 GO:0010468
GO:0016020

Map