F261734

General Info

Members Datasets Scaffolds Average Seq Length
172 144 151 270

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2958458903|2958461561
Length 290
Sequence RRNDRHNIQYQLKLVSLNRTGIMEYQVNYITSEIKLSNYTGRLFKTEAAFDDHLLVWLISGETKIIQADESFIFGAGSTFLIPRNQLATIINTPKDGLPHQAVAMHLSAQRLKDFYSHVNPAPKISKSSIFSFGQHPLLSSCMASLIPYFEMQESFPENIASLKITEAITILRTINKDIDSILSDFAAPGKIDLAAFMEKNFMFNMSLEKFGYLTGRSLTTFKRDFYKAFNLTPQRWLTKKRLETAYYQLTEKNRKPSDIYYEIGFENLSHFSFAFKKQFGCSPTDLTKI

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
3 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
4 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
5 2738541278 Niastella sp. CF465 Isolate Unclassified
6 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
7 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
8 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
9 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
10 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
11 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
12 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
13 2919509842 Flavobacterium arsenatis 3773 Isolate Unclassified
14 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
15 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
16 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
17 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
18 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
19 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
20 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
21 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
22 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
23 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
24 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
25 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
26 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
27 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
28 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
29 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
30 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
31 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
69 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
70 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
95 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
96 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
97 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
98 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
99 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
100 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
101 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
102 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
103 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
104 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
105 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
106 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
107 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
108 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
109 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
110 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
111 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
112 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
113 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
114 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
115 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
116 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
117 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
118 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
119 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
120 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
121 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
122 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
123 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
124 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
125 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
126 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
127 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
128 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
129 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
130 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
131 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
132 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
133 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
134 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
135 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
136 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
137 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
138 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
139 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
140 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
141 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
142 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
143 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
144 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 87.79
Metatranscriptomes 0
Isolates 12.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.72
Nodule 0
Rhizoplane 0
Rhizosphere 71.51
Stem 0
Stem Tuber 0
Unclassified 19.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1184230 2162886007 Bacteria 3087
2 JGI24740J21852_10008633 3300001979 Bacteria 4048
3 JGI25162J39368_1000008 3300002737 Bacteria 397212
4 rootH1_10006268 3300003316 Bacteria 2471
5 rootH1_10173315 3300003316 Unclassified 1732
6 rootH2_10013860 3300003320 Bacteria 41509
7 rootL2_10061309 3300003322 Bacteria 13838
8 rootH1_10003055 3300003323 Bacteria 18939
9 rootH1_10011868 3300003323 Bacteria 18970
10 rootH1_10134168 3300003323 Unclassified 1699
11 rootH1_10146389 3300003323 Bacteria 2323
12 Ga0065704_10086082 3300005289 Bacteria 3156
13 Ga0068869_100081128 3300005334 Bacteria 2422
14 Ga0070666_10045724 3300005335 Bacteria 2935
15 Ga0070666_10151311 3300005335 Bacteria 1619
16 Ga0070682_100018042 3300005337 Bacteria 4119
17 Ga0068868_100034348 3300005338 Bacteria 3914
18 Ga0070668_100356302 3300005347 Bacteria 1239
19 Ga0070669_100168147 3300005353 Bacteria 1708
20 Ga0070674_100035836 3300005356 Bacteria 3326
21 Ga0070673_100079994 3300005364 Bacteria 2647
22 Ga0070688_100223578 3300005365 Bacteria 1328
23 Ga0070667_100524384 3300005367 Bacteria 1087
24 Ga0070678_100114274 3300005456 Bacteria 2117
25 Ga0070662_100497426 3300005457 Unclassified 1017
26 Ga0068867_100237791 3300005459 Bacteria 1475
27 Ga0070672_100212753 3300005543 Bacteria 1619
28 Ga0070665_100357893 3300005548 Bacteria 1465
29 Ga0068854_100221984 3300005578 Bacteria 1495
30 Ga0068856_100066210 3300005614 Bacteria 3570
31 Ga0068866_10016394 3300005718 Bacteria 3312
32 Ga0068870_10016256 3300005840 Bacteria 3551
33 Ga0068860_100216778 3300005843 Bacteria 1858
34 Ga0075366_10017385 3300006195 Bacteria 4139
35 Ga0097621_100050888 3300006237 Bacteria 3370
36 Ga0068871_100357557 3300006358 Bacteria 1293
37 Ga0068865_100043467 3300006881 Bacteria 3070
38 Ga0105240_10049392 3300009093 Bacteria 5310
39 Ga0111539_10515703 3300009094 Bacteria 1393
40 Ga0105241_10225586 3300009174 Bacteria 1577
41 Ga0105237_10003233 3300009545 Bacteria 19486
42 Ga0105237_10020594 3300009545 Bacteria 6796
43 Ga0105238_10022176 3300009551 Bacteria 6476
44 Ga0105239_10000038 3300010375 Bacteria 205230
45 Ga0105239_10000146 3300010375 Bacteria 101177
46 Ga0105239_10153824 3300010375 Bacteria 2568
47 Ga0105246_10186872 3300011119 Bacteria 1600
48 Ga0157373_10000078 3300013100 Bacteria 84103
49 Ga0157371_10000201 3300013102 Bacteria 87780
50 Ga0157371_10003606 3300013102 Bacteria 13952
51 Ga0157371_10045119 3300013102 Unclassified 3137
52 Ga0157370_10002214 3300013104 Bacteria 23719
53 Ga0157370_10009319 3300013104 Bacteria 10510
54 Ga0157369_10001121 3300013105 Bacteria 33501
55 Ga0157374_10037640 3300013296 Bacteria 4442
56 Ga0163162_10001752 3300013306 Bacteria 20345
57 Ga0157375_10110144 3300013308 Bacteria 2850
58 Ga0157380_10568272 3300014326 Bacteria 1116
59 Ga0157376_10018383 3300014969 Bacteria 5358
60 Ga0157376_10604988 3300014969 Bacteria 1091
61 Ga0182006_1002094 3300015261 Bacteria 11144
62 Ga0182006_1005968 3300015261 Bacteria 5720
63 Ga0207426_1001549 3300025302 Bacteria 18689
64 Ga0207642_10130469 3300025899 Bacteria 1311
65 Ga0207680_10065263 3300025903 Bacteria 2234
66 Ga0207680_10096876 3300025903 Bacteria 1888
67 Ga0207647_10107912 3300025904 Bacteria 1647
68 Ga0207645_10003209 3300025907 Bacteria 12509
69 Ga0207671_10010960 3300025914 Bacteria 7427
70 Ga0207694_10390258 3300025924 Unclassified 1156
71 Ga0207650_10442048 3300025925 Bacteria 1081
72 Ga0207659_10285924 3300025926 Bacteria 1350
73 Ga0207706_10496088 3300025933 Bacteria 1054
74 Ga0207704_10175566 3300025938 Bacteria 1542
75 Ga0207691_10127337 3300025940 Bacteria 2252
76 Ga0207689_10004369 3300025942 Bacteria 12864
77 Ga0207689_10107393 3300025942 Unclassified 2294
78 Ga0207651_10033178 3300025960 Bacteria 3327
79 Ga0207668_10076026 3300025972 Bacteria 2416
80 Ga0207640_10058289 3300025981 Bacteria 2543
81 Ga0207658_10082520 3300025986 Bacteria 2469
82 Ga0207677_10202381 3300026023 Bacteria 1579
83 Ga0207702_10048798 3300026078 Bacteria 3571
84 Ga0207648_10002363 3300026089 Bacteria 20364
85 Ga0207674_10159823 3300026116 Bacteria 2208
86 Ga0207675_100142950 3300026118 Bacteria 2274
87 Ga0207683_10073018 3300026121 Unclassified 3035
88 Ga0268266_10160325 3300028379 Bacteria 2034
89 Ga0268265_10668613 3300028380 Bacteria 1000
90 Ga0307515_10000003 3300028794 Bacteria 891317
91 Ga0307515_10001268 3300028794 Bacteria 57400
92 Ga0307515_10072720 3300028794 Bacteria 4633
93 Ga0307513_10047768 3300031456 Unclassified 4653
94 Ga0307513_10205479 3300031456 Bacteria 1806
95 Ga0307408_100150697 3300031548 Bacteria 1835
96 Ga0307514_10161570 3300031649 Unclassified 1481
97 Ga0307405_10064489 3300031731 Bacteria 2329
98 Ga0307410_10006791 3300031852 Bacteria 6208
99 Ga0307406_10000481 3300031901 Bacteria 23034
100 Ga0307414_10000008 3300032004 Bacteria 375832
101 Ga0307411_10011005 3300032005 Bacteria 4857
102 Ga0307510_10000406 3300033180 Bacteria 41007
103 Ga0439457_004818 3300042014 Unclassified 3473
104 Ga0495627_008361 3300046453 Bacteria 3887
105 Ga0495590_0005361 3300046457 Bacteria 5089
106 Ga0495638_0000026 3300046460 Bacteria 347061
107 Ga0495650_0000280 3300046471 Bacteria 97560
108 Ga0495650_0086081 3300046471 Bacteria 1203
109 Ga0495585_0000879 3300046492 Bacteria 25590
110 Ga0495583_0020054 3300046506 Bacteria 3474
111 Ga0495606_0016168 3300046507 Bacteria 5705
112 Ga0495606_0076026 3300046507 Bacteria 2100
113 Ga0495648_0029863 3300046524 Bacteria 3612
114 Ga0495609_0002632 3300046538 Bacteria 10901
115 Ga0495622_0025037 3300046557 Bacteria 2787
116 Ga0495668_0000044 3300046616 Bacteria 227585
117 Ga0495668_0017912 3300046616 Bacteria 4102
118 Ga0495611_0000179 3300046648 Bacteria 45869
119 Ga0495625_0002496 3300046660 Bacteria 19821
120 Ga0495625_0017230 3300046660 Bacteria 5656
121 Ga0495661_0013087 3300046665 Bacteria 5582
122 Ga0495658_0050173 3300046683 Bacteria 2359
123 Ga0495669_0141500 3300046684 Bacteria 1136
124 Ga0495600_0087823 3300046809 Bacteria 2028
125 Ga0495683_0018294 3300047323 Bacteria 3625
126 Ga0495687_000006 3300047443 Bacteria 571936
127 Ga0495686_0000402 3300047472 Bacteria 68501
128 Ga0495686_0011967 3300047472 Bacteria 6098
129 Ga0495686_0065138 3300047472 Bacteria 2254
130 Ga0496116_0000079 3300048919 Bacteria 226744
131 Ga0496116_0000390 3300048919 Bacteria 64244
132 Ga0496121_0103390 3300048924 Bacteria 2191
133 Ga0496124_0012556 3300048927 Bacteria 8347
134 Ga0496125_0000567 3300048928 Bacteria 63543
135 Ga0496126_0003504 3300048929 Bacteria 19774
136 Ga0496126_0148421 3300048929 Bacteria 2012
137 Ga0495678_008361 3300049459 Bacteria 5229
138 Ga0501238_000421 3300049671 Bacteria 5067
139 Ga0501280_000384 3300049776 Bacteria 10780
140 nmdc:mga0k408_177_c3 3300050493 Bacteria 27094
141 Ga0500641_0000446 3300053096 Bacteria 14977
142 Ga0500650_0114406 3300053098 Bacteria 1259
143 Ga0500562_002882 3300053108 Unclassified 4287
144 Ga0500592_007282 3300053116 Bacteria 1760
145 Ga0500655_023658 3300053133 Bacteria 1161
146 Ga0500559_0043551 3300053136 Bacteria 1961
147 Ga0500568_0018952 3300053139 Bacteria 3002
148 Ga0500604_0039981 3300053151 Bacteria 1412
149 Ga0500622_0000009 3300053156 Bacteria 419980
150 Ga0500622_0000016 3300053156 Bacteria 337983
151 Ga0500627_0118436 3300053158 Bacteria 1194

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005337 Ga0070682_100018042 Ga0070682_1000180422 236
2 3300049776 Ga0501280_000384 Ga0501280_000384_10037_10756 236
3 3300025942 Ga0207689_10107393 Ga0207689_101073931 237
4 3300048929 Ga0496126_0148421 Ga0496126_0148421_1087_1812 240
5 3300053116 Ga0500592_007282 Ga0500592_007282_299_1024 240
6 3300009094 Ga0111539_10515703 Ga0111539_105157031 242
7 3300014326 Ga0157380_10568272 Ga0157380_105682722 242
8 3300046684 Ga0495669_0141500 Ga0495669_0141500_186_917 242
9 3300047323 Ga0495683_0018294 Ga0495683_0018294_1963_2694 242
10 iso_pu_bacteria 2902048731 2902052497 263
11 3300010375 Ga0105239_10000038 Ga0105239_1000003886 264
12 iso_pu_bacteria 2738541278 2738729653 264
13 iso_pu_bacteria 2519899754 2520878719 265
14 iso_pu_bacteria 2643221600 2644010137 265
15 iso_pu_bacteria 2643221716 2644644407 265
16 iso_pu_bacteria 2739367857 2740001193 265
17 iso_pu_bacteria 2739367858 2740006009 265
18 iso_pu_bacteria 2857613821 2857618123 265
19 iso_pu_bacteria 2896109856 2896111896 265
20 iso_pu_bacteria 2904419702 2904423814 265
21 iso_pu_bacteria 2919191525 2919191736 265
22 iso_pu_bacteria 2919509842 2919510761 265
23 iso_pu_bacteria 2929177148 2929180202 265
24 iso_pu_bacteria 2945977869 2945982606 265
25 iso_pu_bacteria 2946013367 2946017998 265
26 iso_pu_bacteria 2977232053 2977233503 265
27 iso_pu_bacteria 2977268062 2977270499 265
28 iso_pu_bacteria 8003151029 8003156559 265
29 iso_pu_bacteria 8003151029 8003156567 265
30 3300003316 rootH1_10006268 rootH1_100062683 266
31 3300003320 rootH2_10013860 rootH2_100138607 266
32 3300013306 Ga0163162_10001752 Ga0163162_100017528 266
33 3300046471 Ga0495650_0000280 Ga0495650_0000280_30161_30964 266
34 3300046506 Ga0495583_0020054 Ga0495583_0020054_116_919 266
35 3300046648 Ga0495611_0000179 Ga0495611_0000179_28072_28875 266
36 3300046665 Ga0495661_0013087 Ga0495661_0013087_2909_3712 266
37 iso_pu_bacteria 2919692658 2919694797 266
38 3300003322 rootL2_10061309 rootL2_1006130910 267
39 3300003323 rootH1_10003055 rootH1_1000305516 267
40 3300003323 rootH1_10134168 rootH1_101341682 267
41 3300003323 rootH1_10146389 rootH1_101463892 267
42 3300005614 Ga0068856_100066210 Ga0068856_1000662102 267
43 3300009093 Ga0105240_10049392 Ga0105240_100493922 267
44 3300009545 Ga0105237_10003233 Ga0105237_100032333 267
45 3300009551 Ga0105238_10022176 Ga0105238_100221766 267
46 3300010375 Ga0105239_10000146 Ga0105239_1000014642 267
47 3300025914 Ga0207671_10010960 Ga0207671_100109606 267
48 3300025924 Ga0207694_10390258 Ga0207694_103902581 267
49 3300026078 Ga0207702_10048798 Ga0207702_100487984 267
50 3300033180 Ga0307510_10000406 Ga0307510_100004069 267
51 3300053096 Ga0500641_0000446 Ga0500641_0000446_13666_14472 267
52 3300053108 Ga0500562_002882 Ga0500562_002882_863_1669 267
53 3300002737 JGI25162J39368_1000008 JGI25162J39368_100000886 268
54 3300005334 Ga0068869_100081128 Ga0068869_1000811284 268
55 3300005335 Ga0070666_10045724 Ga0070666_100457242 268
56 3300005335 Ga0070666_10151311 Ga0070666_101513112 268
57 3300005338 Ga0068868_100034348 Ga0068868_1000343482 268
58 3300005347 Ga0070668_100356302 Ga0070668_1003563021 268
59 3300005353 Ga0070669_100168147 Ga0070669_1001681472 268
60 3300005356 Ga0070674_100035836 Ga0070674_1000358362 268
61 3300005364 Ga0070673_100079994 Ga0070673_1000799942 268
62 3300005365 Ga0070688_100223578 Ga0070688_1002235781 268
63 3300005456 Ga0070678_100114274 Ga0070678_1001142742 268
64 3300005457 Ga0070662_100497426 Ga0070662_1004974262 268
65 3300005459 Ga0068867_100237791 Ga0068867_1002377912 268
66 3300005543 Ga0070672_100212753 Ga0070672_1002127531 268
67 3300005548 Ga0070665_100357893 Ga0070665_1003578932 268
68 3300005578 Ga0068854_100221984 Ga0068854_1002219842 268
69 3300005718 Ga0068866_10016394 Ga0068866_100163942 268
70 3300005840 Ga0068870_10016256 Ga0068870_100162562 268
71 3300005843 Ga0068860_100216778 Ga0068860_1002167781 268
72 3300006237 Ga0097621_100050888 Ga0097621_1000508884 268
73 3300006358 Ga0068871_100357557 Ga0068871_1003575571 268
74 3300006881 Ga0068865_100043467 Ga0068865_1000434671 268
75 3300009174 Ga0105241_10225586 Ga0105241_102255861 268
76 3300010375 Ga0105239_10153824 Ga0105239_101538242 268
77 3300011119 Ga0105246_10186872 Ga0105246_101868721 268
78 3300013102 Ga0157371_10000201 Ga0157371_1000020187 268
79 3300013296 Ga0157374_10037640 Ga0157374_100376403 268
80 3300013308 Ga0157375_10110144 Ga0157375_101101441 268
81 3300014969 Ga0157376_10018383 Ga0157376_100183833 268
82 3300025899 Ga0207642_10130469 Ga0207642_101304692 268
83 3300025903 Ga0207680_10065263 Ga0207680_100652633 268
84 3300025903 Ga0207680_10096876 Ga0207680_100968762 268
85 3300025907 Ga0207645_10003209 Ga0207645_100032099 268
86 3300025925 Ga0207650_10442048 Ga0207650_104420482 268
87 3300025926 Ga0207659_10285924 Ga0207659_102859242 268
88 3300025933 Ga0207706_10496088 Ga0207706_104960881 268
89 3300025938 Ga0207704_10175566 Ga0207704_101755662 268
90 3300025940 Ga0207691_10127337 Ga0207691_101273371 268
91 3300025942 Ga0207689_10004369 Ga0207689_100043693 268
92 3300025960 Ga0207651_10033178 Ga0207651_100331781 268
93 3300025972 Ga0207668_10076026 Ga0207668_100760261 268
94 3300025981 Ga0207640_10058289 Ga0207640_100582892 268
95 3300025986 Ga0207658_10082520 Ga0207658_100825201 268
96 3300026023 Ga0207677_10202381 Ga0207677_102023811 268
97 3300026089 Ga0207648_10002363 Ga0207648_1000236321 268
98 3300026116 Ga0207674_10159823 Ga0207674_101598234 268
99 3300026118 Ga0207675_100142950 Ga0207675_1001429502 268
100 3300026121 Ga0207683_10073018 Ga0207683_100730182 268
101 3300028379 Ga0268266_10160325 Ga0268266_101603252 268
102 3300028380 Ga0268265_10668613 Ga0268265_106686131 268
103 3300028794 Ga0307515_10001268 Ga0307515_1000126836 268
104 3300042014 Ga0439457_004818 Ga0439457_004818_617_1426 268
105 3300046457 Ga0495590_0005361 Ga0495590_0005361_1905_2711 268
106 3300046460 Ga0495638_0000026 Ga0495638_0000026_96845_97702 268
107 3300046471 Ga0495650_0086081 Ga0495650_0086081_370_1179 268
108 3300046507 Ga0495606_0016168 Ga0495606_0016168_2233_3042 268
109 3300046616 Ga0495668_0017912 Ga0495668_0017912_1210_2019 268
110 3300047443 Ga0495687_000006 Ga0495687_000006_534597_535406 268
111 3300047472 Ga0495686_0000402 Ga0495686_0000402_59319_60128 268
112 3300047472 Ga0495686_0011967 Ga0495686_0011967_2131_2940 268
113 3300047472 Ga0495686_0065138 Ga0495686_0065138_83_892 268
114 3300053151 Ga0500604_0039981 Ga0500604_0039981_168_977 268
115 3300053158 Ga0500627_0118436 Ga0500627_0118436_15_824 268
116 iso_pu_bacteria 2958458903 2958461561 268
117 2162886007 SwRhRL2b_contig_1184230 SwRhRL2b_0598.00005610 269
118 3300001979 JGI24740J21852_10008633 JGI24740J21852_100086332 269
119 3300003316 rootH1_10173315 rootH1_101733151 269
120 3300003323 rootH1_10011868 rootH1_100118686 269
121 3300005289 Ga0065704_10086082 Ga0065704_100860823 269
122 3300005367 Ga0070667_100524384 Ga0070667_1005243841 269
123 3300006195 Ga0075366_10017385 Ga0075366_100173854 269
124 3300009545 Ga0105237_10020594 Ga0105237_100205944 269
125 3300013100 Ga0157373_10000078 Ga0157373_1000007817 269
126 3300013102 Ga0157371_10003606 Ga0157371_100036062 269
127 3300013102 Ga0157371_10045119 Ga0157371_100451192 269
128 3300013104 Ga0157370_10002214 Ga0157370_1000221416 269
129 3300013104 Ga0157370_10009319 Ga0157370_1000931910 269
130 3300013105 Ga0157369_10001121 Ga0157369_1000112114 269
131 3300014969 Ga0157376_10604988 Ga0157376_106049881 269
132 3300015261 Ga0182006_1002094 Ga0182006_10020942 269
133 3300015261 Ga0182006_1005968 Ga0182006_10059688 269
134 3300025302 Ga0207426_1001549 Ga0207426_10015495 269
135 3300025904 Ga0207647_10107912 Ga0207647_101079122 269
136 3300028794 Ga0307515_10000003 Ga0307515_10000003437 269
137 3300028794 Ga0307515_10072720 Ga0307515_100727204 269
138 3300031456 Ga0307513_10047768 Ga0307513_100477685 269
139 3300031456 Ga0307513_10205479 Ga0307513_102054792 269
140 3300031548 Ga0307408_100150697 Ga0307408_1001506972 269
141 3300031649 Ga0307514_10161570 Ga0307514_101615702 269
142 3300031731 Ga0307405_10064489 Ga0307405_100644892 269
143 3300031852 Ga0307410_10006791 Ga0307410_100067912 269
144 3300031901 Ga0307406_10000481 Ga0307406_1000048112 269
145 3300032004 Ga0307414_10000008 Ga0307414_100000089 269
146 3300032005 Ga0307411_10011005 Ga0307411_100110055 269
147 3300046453 Ga0495627_008361 Ga0495627_008361_949_1770 269
148 3300046492 Ga0495585_0000879 Ga0495585_0000879_12795_13625 269
149 3300046507 Ga0495606_0076026 Ga0495606_0076026_383_1204 269
150 3300046524 Ga0495648_0029863 Ga0495648_0029863_2243_3073 269
151 3300046538 Ga0495609_0002632 Ga0495609_0002632_3236_4066 269
152 3300046557 Ga0495622_0025037 Ga0495622_0025037_1339_2169 269
153 3300046616 Ga0495668_0000044 Ga0495668_0000044_92593_93423 269
154 3300046660 Ga0495625_0002496 Ga0495625_0002496_12079_12909 269
155 3300046660 Ga0495625_0017230 Ga0495625_0017230_1885_2718 269
156 3300046683 Ga0495658_0050173 Ga0495658_0050173_506_1336 269
157 3300046809 Ga0495600_0087823 Ga0495600_0087823_463_1293 269
158 3300048919 Ga0496116_0000079 Ga0496116_0000079_146119_146937 269
159 3300048919 Ga0496116_0000390 Ga0496116_0000390_17475_18293 269
160 3300048924 Ga0496121_0103390 Ga0496121_0103390_216_1034 269
161 3300048927 Ga0496124_0012556 Ga0496124_0012556_1385_2203 269
162 3300048928 Ga0496125_0000567 Ga0496125_0000567_14754_15572 269
163 3300048929 Ga0496126_0003504 Ga0496126_0003504_15370_16188 269
164 3300049459 Ga0495678_008361 Ga0495678_008361_2698_3531 269
165 3300049671 Ga0501238_000421 Ga0501238_000421_1001_1819 269
166 3300050493 nmdc:mga0k408_177_c3 nmdc:mga0k408_177_c3_2557_3387 269
167 3300053098 Ga0500650_0114406 Ga0500650_0114406_80_949 269
168 3300053133 Ga0500655_023658 Ga0500655_023658_155_982 269
169 3300053136 Ga0500559_0043551 Ga0500559_0043551_292_1110 269
170 3300053139 Ga0500568_0018952 Ga0500568_0018952_123_944 269
171 3300053156 Ga0500622_0000009 Ga0500622_0000009_64203_65030 269
172 3300053156 Ga0500622_0000016 Ga0500622_0000016_71386_72213 269

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12833

HTH_18

Helix-turn-helix domain

214

290

0.96

PF22200

ExsA_N

ExsA N-terminal regulatory domain

53

180

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3w6v-assembly1.cif.gz_A crystal structure of the dna-binding domain of adpa, the global transcriptional factor, in complex with a target dna 0.9104 172 264
3lsg-assembly2.cif.gz_D the crystal structure of the c-terminal domain of the two-component response regulator yesn from fusobacterium nucleatum subsp. nucleatum atcc 25586 0.9091 172 258
6swi-assembly1.cif.gz_A the c-terminal domain of arat, a response regulator from geobacillus stearothermophilus 0.8954 172 265
3lsg-assembly1.cif.gz_A the crystal structure of the c-terminal domain of the two-component response regulator yesn from fusobacterium nucleatum subsp. nucleatum atcc 25586 0.8911 172 265
3lsg-assembly3.cif.gz_E the crystal structure of the c-terminal domain of the two-component response regulator yesn from fusobacterium nucleatum subsp. nucleatum atcc 25586 0.8875 172 261
ID Description Score Start End Superfamily
1d5yD02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9269 220 265 1.10.10.60
af_P32677_219_275_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9233 219 265 1.10.10.60
5suwA03 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9229 217 264 1.10.10.60
3w6vA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9104 172 264 1.10.10.60
af_O69703_224_336_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9004 185 265 1.10.10.60
ID Description Score Start End GO Terms
AF-C6W671-F1-model_v4 Transcriptional regulator, AraC family 0.9447 172 265 GO:0003700
GO:0043565
AF-A0A2T7BD47-F1-model_v4 AraC family transcriptional regulator 0.909 26 265 GO:0003700
GO:0043565
AF-A0A5B8W524-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9083 4 264 GO:0003700
GO:0043565
AF-A0A0N8K724-F1-model_v4 AraC family transcriptional regulator 0.9062 172 264 GO:0003700
GO:0043565
AF-A0A1H4A265-F1-model_v4 AraC-type DNA-binding protein 0.9014 12 265 GO:0003700
GO:0043565

Feature Viewer

pLDDT pTM Quality
90.14 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map