F261731

General Info

Members Datasets Scaffolds Average Seq Length
172 144 344 298

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2946072368|2946077174
Length 350
Sequence PRAESRRLTGAQPRAGIRSRQATRSAGTRSAGTRSAGILSAGIGSVGTRAGGFRGLVAVLALAAVASGCAGGGDGRTTRPAPGQQPKKAPPPVAAPARALYGYAARLRAAHQARVAAAGHWGLRKVPLTPPAPPARKPEITTRKGFEVDDHEELGLPPVFTRVPTEDRVVFLTIDDGAEKDPAFLRMMSELKIPYTAFLSDYLIKDDYGYFKEMQDRGAALNNHTLHHPYLPALSYARQKHEICGMQEVIRKRYGTRPALFRPPFGNYDQDTLRAAKSCGVRYAPLWDEEVFVDHWEYREGDRDLHPGDIVLSHFRGRGEWKGTMPDLVRRFLDKVTAKGYAVARLEDYL

Samples

Sample ID Description Type Environment
1 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
6 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
7 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
8 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
9 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
10 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
11 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
12 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
13 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
14 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
15 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
16 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
17 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
18 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
19 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
20 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
21 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
22 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
23 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
24 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
25 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
26 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
27 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
28 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
29 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
30 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
31 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
32 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
33 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
34 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
35 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
36 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
37 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
38 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
39 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
40 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
41 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
42 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
43 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
44 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
45 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
46 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
47 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
48 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
49 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
50 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
51 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
52 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
53 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
54 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
55 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
56 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
57 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
58 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
59 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
60 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
61 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
62 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
63 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
64 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
65 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
66 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
67 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
68 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
69 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
70 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
71 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
72 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
73 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
74 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
75 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
76 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
77 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
78 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
79 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
80 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
81 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
82 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
83 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
84 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
85 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
86 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
87 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
89 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
91 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
92 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
94 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
95 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
96 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
97 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
98 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
99 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
100 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
101 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
102 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
103 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
104 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
105 2643221548 Streptomyces sp. Root55 Isolate Unclassified
106 2643221647 Streptomyces sp. Root369 Isolate Unclassified
107 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
108 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
109 2643221714 Streptomyces sp. Root264 Isolate Unclassified
110 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
111 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
112 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
113 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
114 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
115 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
116 2808606448 Streptomyces sp. 193411 Isolate Unclassified
117 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
118 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
119 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
120 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
121 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
122 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
123 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
124 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
125 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
126 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
127 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
128 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
129 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
130 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
131 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
132 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
133 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
134 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
135 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
136 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
137 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
138 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
139 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
140 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
141 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
142 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
143 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
144 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 73.26
Metatranscriptomes 0
Isolates 26.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.91
Nodule 0
Rhizoplane 0
Rhizosphere 80.23
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10058605 3300001990 Bacteria 1161
2 rootH1_10066130 3300003316 Bacteria 2444
3 rootL2_10031027 3300003322 Bacteria 2746
4 rootH1_10049900 3300003323 Bacteria 4514
5 Ga0070665_100198656 3300005548 Bacteria 2006
6 Ga0075363_100014110 3300006048 Bacteria 3894
7 Ga0075367_10120322 3300006178 Bacteria 1618
8 Ga0105246_10030419 3300011119 Bacteria 3566
9 Ga0157372_10036175 3300013307 Bacteria 5442
10 Ga0182007_10000136 3300015262 Bacteria 51316
11 Ga0183367_1002 3300015688 Bacteria 1101531
12 Ga0207647_10020477 3300025904 Bacteria 4434
13 Ga0209371_1019738 3300027312 Bacteria 1675
14 Ga0268256_1015352 3300030500 Bacteria 2240
15 Ga0307511_10028497 3300030521 Bacteria 5067
16 Ga0307513_10013779 3300031456 Bacteria 9915
17 Ga0307508_10032766 3300031616 Bacteria 4692
18 Ga0307508_10037467 3300031616 Bacteria 4360
19 Ga0307514_10006020 3300031649 Bacteria 10665
20 Ga0307514_10072246 3300031649 Bacteria 2584
21 Ga0307516_10006929 3300031730 Bacteria 13156
22 Ga0307518_10063161 3300031838 Bacteria 2688
23 Ga0307507_10037101 3300033179 Bacteria 4964
24 Ga0307510_10006248 3300033180 Bacteria 14214
25 Ga0307510_10075404 3300033180 Bacteria 3325
26 Ga0439458_0020203 3300042157 Bacteria 1538
27 Ga0466972_0001902 3300044658 Bacteria 10255
28 Ga0466972_0020741 3300044658 Bacteria 3283
29 Ga0466970_0027580 3300044765 Bacteria 2980
30 Ga0466970_0078122 3300044765 Bacteria 1785
31 Ga0466960_0008754 3300044901 Bacteria 4154
32 Ga0466967_0024226 3300045976 Bacteria 4987
33 Ga0495617_002938 3300046452 Bacteria 6541
34 Ga0495627_024001 3300046453 Bacteria 1992
35 Ga0495592_0105249 3300046454 Bacteria 2004
36 Ga0495603_0021278 3300046455 Bacteria 3927
37 Ga0495603_0025090 3300046455 Bacteria 3605
38 Ga0495629_0008602 3300046459 Bacteria 7515
39 Ga0495629_0040591 3300046459 Bacteria 3274
40 Ga0495638_0052204 3300046460 Bacteria 2547
41 Ga0495651_0003732 3300046462 Bacteria 11662
42 Ga0495662_0011477 3300046476 Bacteria 4329
43 Ga0495664_0000351 3300046477 Bacteria 22346
44 Ga0495594_0007272 3300046499 Bacteria 5692
45 Ga0495594_0098871 3300046499 Bacteria 1640
46 Ga0495594_0192375 3300046499 Bacteria 1162
47 Ga0495596_0031365 3300046500 Bacteria 2123
48 Ga0495608_0019382 3300046511 Bacteria 4682
49 Ga0495610_0036256 3300046512 Bacteria 2522
50 Ga0495616_0001216 3300046513 Bacteria 18134
51 Ga0495620_0020757 3300046515 Bacteria 3201
52 Ga0495628_0055938 3300046516 Bacteria 3107
53 Ga0495630_0312082 3300046517 Bacteria 1202
54 Ga0495631_0003226 3300046518 Bacteria 8972
55 Ga0495637_0042792 3300046520 Bacteria 1936
56 Ga0495643_0003864 3300046522 Bacteria 10783
57 Ga0495648_0077181 3300046524 Bacteria 1910
58 Ga0495666_0050714 3300046526 Bacteria 1994
59 Ga0495652_0054977 3300046529 Bacteria 3387
60 Ga0495654_0017694 3300046530 Bacteria 3741
61 Ga0495597_0045071 3300046542 Bacteria 1958
62 Ga0495645_0044539 3300046543 Bacteria 3236
63 Ga0495622_0012428 3300046557 Bacteria 3941
64 Ga0495633_0011840 3300046558 Bacteria 4675
65 Ga0495668_0011576 3300046616 Bacteria 5274
66 Ga0495634_0002454 3300046642 Bacteria 15402
67 Ga0495634_0122131 3300046642 Bacteria 1667
68 Ga0495611_0039211 3300046648 Bacteria 2108
69 Ga0495625_0144206 3300046660 Bacteria 1604
70 Ga0495635_0022994 3300046663 Bacteria 4345
71 Ga0495661_0063550 3300046665 Bacteria 2181
72 Ga0495657_0002165 3300046675 Bacteria 16684
73 Ga0495657_0078918 3300046675 Bacteria 2132
74 Ga0495599_0191341 3300046678 Bacteria 1259
75 Ga0495623_0055508 3300046679 Bacteria 2497
76 Ga0495646_0001885 3300046680 Bacteria 12597
77 Ga0495658_0022738 3300046683 Bacteria 3319
78 Ga0495613_0000581 3300046689 Bacteria 29559
79 Ga0495613_0093500 3300046689 Bacteria 2176
80 Ga0495589_0001971 3300046794 Bacteria 11620
81 Ga0495600_0055130 3300046809 Bacteria 2596
82 Ga0495600_0069359 3300046809 Bacteria 2304
83 Ga0495581_0016661 3300047315 Bacteria 4272
84 Ga0495581_0240943 3300047315 Bacteria 1057
85 Ga0495604_0001563 3300047317 Bacteria 18835
86 Ga0495604_0056152 3300047317 Bacteria 3032
87 Ga0495636_0013462 3300047318 Bacteria 3247
88 Ga0495636_0078231 3300047318 Bacteria 1420
89 Ga0495674_0088044 3300047319 Bacteria 2656
90 Ga0495674_0124876 3300047319 Bacteria 2172
91 Ga0495676_0020543 3300047321 Bacteria 5790
92 Ga0495676_0024803 3300047321 Bacteria 5182
93 Ga0495676_0032177 3300047321 Bacteria 4430
94 Ga0495676_0094717 3300047321 Bacteria 2223
95 Ga0495687_011096 3300047443 Bacteria 4873
96 Ga0495687_034106 3300047443 Bacteria 2303
97 Ga0495687_041985 3300047443 Bacteria 2002
98 Ga0495687_089856 3300047443 Bacteria 1179
99 Ga0495677_0055608 3300047445 Bacteria 1461
100 Ga0495685_023908 3300047447 Bacteria 2103
101 Ga0495684_0076735 3300047471 Bacteria 2538
102 Ga0495686_0032327 3300047472 Bacteria 3387
103 Ga0495593_0008056 3300047673 Bacteria 6128
104 Ga0495593_0011885 3300047673 Bacteria 4991
105 Ga0495593_0028171 3300047673 Bacteria 3086
106 Ga0495602_0030980 3300048088 Bacteria 5064
107 Ga0495614_0008603 3300048089 Bacteria 4537
108 Ga0495614_0041182 3300048089 Bacteria 1981
109 Ga0495626_0005677 3300048091 Bacteria 7223
110 Ga0495678_014393 3300049459 Bacteria 3680
111 Ga0501032_0284704 3300049569 Bacteria 1070
112 Ga0501033_0005830 3300049570 Bacteria 9686
113 Ga0501033_0039060 3300049570 Bacteria 3546
114 Ga0501034_0240257 3300049571 Bacteria 1757
115 Ga0501036_0027760 3300049572 Bacteria 4784
116 Ga0501036_0212679 3300049572 Bacteria 1624
117 Ga0501037_0138915 3300049573 Bacteria 1739
118 Ga0501038_0056587 3300049574 Bacteria 3368
119 Ga0501039_0310140 3300049575 Bacteria 1240
120 Ga0501046_0019825 3300049580 Bacteria 5569
121 Ga0501035_0080424 3300049822 Bacteria 2877
122 Ga0501044_0098205 3300049823 Bacteria 2948
123 nmdc:mga06z11_92225_c1 3300050494 Bacteria 1647
124 nmdc:mga04h51_32016_c1 3300050495 Bacteria 1665
125 Ga0500640_020233 3300053095 Bacteria 2858
126 Ga0466962_0129456 3300061719 Bacteria 1219
127 2946077174 2946072368 Bacteria 8999607
128 2554256730 2554235005 Bacteria 6457341
129 2585295978 2582581312 Bacteria 7308206
130 2585306300 2582581313 Bacteria 10042643
131 2585320260 2582581314 Bacteria 11452267
132 2616696713 2616644814 Bacteria 11555299
133 2643764705 2643221548 Bacteria 8053412
134 2644261522 2643221647 Bacteria 10741251
135 2644439398 2643221678 Bacteria 9540101
136 2644462090 2643221682 Bacteria 6743283
137 2644633225 2643221714 Bacteria 9015452
138 2784589802 2784132148 Bacteria 8627943
139 2785370843 2784746768 Bacteria 10036182
140 2786672023 2786546132 Bacteria 10419719
141 2804845470 2802429296 Bacteria 7227771
142 2808843401 2808606359 Bacteria 9866990
143 2808912986 2808606375 Bacteria 9466072
144 2809233472 2808606448 Bacteria 8656184
145 2812356641 2811994879 Bacteria 9313447
146 2819695169 2818991463 Bacteria 7948711
147 2852642789 2852635781 Bacteria 8251373
148 2862185265 2862178590 Bacteria 8583590
149 2862287068 2862281513 Bacteria 9621493
150 2862292066 2862290372 Bacteria 7471434
151 2862511954 2862507626 Bacteria 9425308
152 2877679732 2877676314 Bacteria 9512378
153 2912718371 2912715099 Bacteria 9460473
154 2919470299 2919468124 Bacteria 9133025
155 2935395261 2935390628 Bacteria 7043367
156 2954384646 2954380949 Bacteria 10050426
157 2954678295 2954673503 Bacteria 9685905
158 2954685862 2954682443 Bacteria 9862841
159 2954695501 2954691527 Bacteria 10720516
160 2954710695 2954701450 Bacteria 10834262
161 2954714932 2954711539 Bacteria 10867210
162 2954724875 2954721474 Bacteria 10456478
163 2954736943 2954731030 Bacteria 10243860
164 2954743801 2954740390 Bacteria 10229294
165 2954755793 2954749733 Bacteria 10366972
166 2954762753 2954759201 Bacteria 9358192
167 3006493398 3006486233 Bacteria 8157040
168 3006498886 3006493962 Bacteria 8825450
169 8023626995 8023623736 Bacteria 8593882
170 8025417175 8025413630 Bacteria 7014048
171 8025479522 8025478263 Bacteria 8209203
172 8056837554 8056829672 Bacteria 9045328
173 JGI24737J22298_10058605
174 rootH1_10066130
175 rootL2_10031027
176 rootH1_10049900
177 Ga0070665_100198656
178 Ga0075363_100014110
179 Ga0075367_10120322
180 Ga0105246_10030419
181 Ga0157372_10036175
182 Ga0182007_10000136
183 Ga0183367_1002
184 Ga0207647_10020477
185 Ga0209371_1019738
186 Ga0268256_1015352
187 Ga0307511_10028497
188 Ga0307513_10013779
189 Ga0307508_10032766
190 Ga0307508_10037467
191 Ga0307514_10006020
192 Ga0307514_10072246
193 Ga0307516_10006929
194 Ga0307518_10063161
195 Ga0307507_10037101
196 Ga0307510_10006248
197 Ga0307510_10075404
198 Ga0439458_0020203
199 Ga0466972_0001902
200 Ga0466972_0020741
201 Ga0466970_0027580
202 Ga0466970_0078122
203 Ga0466960_0008754
204 Ga0466967_0024226
205 Ga0495617_002938
206 Ga0495627_024001
207 Ga0495592_0105249
208 Ga0495603_0021278
209 Ga0495603_0025090
210 Ga0495629_0008602
211 Ga0495629_0040591
212 Ga0495638_0052204
213 Ga0495651_0003732
214 Ga0495662_0011477
215 Ga0495664_0000351
216 Ga0495594_0007272
217 Ga0495594_0098871
218 Ga0495594_0192375
219 Ga0495596_0031365
220 Ga0495608_0019382
221 Ga0495610_0036256
222 Ga0495616_0001216
223 Ga0495620_0020757
224 Ga0495628_0055938
225 Ga0495630_0312082
226 Ga0495631_0003226
227 Ga0495637_0042792
228 Ga0495643_0003864
229 Ga0495648_0077181
230 Ga0495666_0050714
231 Ga0495652_0054977
232 Ga0495654_0017694
233 Ga0495597_0045071
234 Ga0495645_0044539
235 Ga0495622_0012428
236 Ga0495633_0011840
237 Ga0495668_0011576
238 Ga0495634_0002454
239 Ga0495634_0122131
240 Ga0495611_0039211
241 Ga0495625_0144206
242 Ga0495635_0022994
243 Ga0495661_0063550
244 Ga0495657_0002165
245 Ga0495657_0078918
246 Ga0495599_0191341
247 Ga0495623_0055508
248 Ga0495646_0001885
249 Ga0495658_0022738
250 Ga0495613_0000581
251 Ga0495613_0093500
252 Ga0495589_0001971
253 Ga0495600_0055130
254 Ga0495600_0069359
255 Ga0495581_0016661
256 Ga0495581_0240943
257 Ga0495604_0001563
258 Ga0495604_0056152
259 Ga0495636_0013462
260 Ga0495636_0078231
261 Ga0495674_0088044
262 Ga0495674_0124876
263 Ga0495676_0020543
264 Ga0495676_0024803
265 Ga0495676_0032177
266 Ga0495676_0094717
267 Ga0495687_011096
268 Ga0495687_034106
269 Ga0495687_041985
270 Ga0495687_089856
271 Ga0495677_0055608
272 Ga0495685_023908
273 Ga0495684_0076735
274 Ga0495686_0032327
275 Ga0495593_0008056
276 Ga0495593_0011885
277 Ga0495593_0028171
278 Ga0495602_0030980
279 Ga0495614_0008603
280 Ga0495614_0041182
281 Ga0495626_0005677
282 Ga0495678_014393
283 Ga0501032_0284704
284 Ga0501033_0005830
285 Ga0501033_0039060
286 Ga0501034_0240257
287 Ga0501036_0027760
288 Ga0501036_0212679
289 Ga0501037_0138915
290 Ga0501038_0056587
291 Ga0501039_0310140
292 Ga0501046_0019825
293 Ga0501035_0080424
294 Ga0501044_0098205
295 nmdc:mga06z11_92225_c1
296 nmdc:mga04h51_32016_c1
297 Ga0500640_020233
298 Ga0466962_0129456
299 2946077174
300 2554256730
301 2585295978
302 2585306300
303 2585320260
304 2616696713
305 2643764705
306 2644261522
307 2644439398
308 2644462090
309 2644633225
310 2784589802
311 2785370843
312 2786672023
313 2804845470
314 2808843401
315 2808912986
316 2809233472
317 2812356641
318 2819695169
319 2852642789
320 2862185265
321 2862287068
322 2862292066
323 2862511954
324 2877679732
325 2912718371
326 2919470299
327 2935395261
328 2954384646
329 2954678295
330 2954685862
331 2954695501
332 2954710695
333 2954714932
334 2954724875
335 2954736943
336 2954743801
337 2954755793
338 2954762753
339 3006493398
340 3006498886
341 8023626995
342 8025417175
343 8025479522
344 8056837554

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01522

Polysacc_deac_1

Polysaccharide deacetylase

162

284

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6dq3-assembly2.cif.gz_B streptococcus pyogenes deacetylase ppld in complex with acetate 0.8749 100 219
2c1g-assembly1.cif.gz_A structure of streptococcus pneumoniae peptidoglycan deacetylase (sppgda) 0.8317 103 285
6hm9-assembly1.cif.gz_A crystal structure of a ba3943 mutant,a ce4 family pseudoenzyme with restored enzymatic activity. 0.8303 94 286
6hpa-assembly1.cif.gz_A crystal structure of a ba3943 mutant,a ce4 family pseudoenzyme 0.8303 94 286
7bkf-assembly1.cif.gz_A crystal structure of wt ba3943, a ce4 family pseudoenzyme from bacillus anthracis 0.8201 94 286
ID Description Score Start End Superfamily
af_O53444_35_232_3.20.20.370 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.8199 104 287 3.20.20.370
4m1bB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.8193 96 286 3.20.20.370
2cc0B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.8167 105 285 3.20.20.370
2iw0A01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.8139 93 287 3.20.20.370
2c1iA03 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.8104 106 285 3.20.20.370
ID Description Score Start End GO Terms
AF-A0A7K3HFZ2-F1-model_v4 Polysaccharide deacetylase family protein 0.9808 60 287 GO:0005975
GO:0016810
AF-A0A7K3HFZ2-F1-model_v4 Polysaccharide deacetylase family protein 0.952 60 287 GO:0005975
GO:0016810
AF-A0A6G2Z873-F1-model_v4 deleted 0.9484 23 287
AF-A0A6G2Z873-F1-model_v4 deleted 0.9379 23 287
AF-A0A5J6I0N2-F1-model_v4 Polysaccharide deacetylase family protein 0.9311 1 287 GO:0005975
GO:0016810

Map