F261455

General Info

Members Datasets Scaffolds Average Seq Length
172 144 344 253

Family's Representative Sequence

Representative Sequence 3300048928|Ga0496125_0010303|Ga0496125_0010303_549_1355
Length 268
Sequence LFDAPFYHFSEGGTAMYRVDLNCDLGESFGAYTLGTDELILPFLTSANIACGFHAGDPRVMFSTVRLAIQNDVAIGAHPGLPDLIGFGRRNMDISPQEAYEMVVYQIGALYGFVKAAGGNMRHVKPHGALYNMAAKRQDLAQAIAEAVYKVDPALILFGLSGSELVTAGEKIGLKTAHEVFADRTYQLDGTLTPRKEAGAMITDHQQAVSQVVRMVKEGVVRSQQGKDISIKADTVCIHGDGAHALEFARQIRSFLEESNIAVRAVGK

Samples

Sample ID Description Type Environment
1 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
41 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
55 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
82 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
83 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
84 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
85 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
86 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
87 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
88 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
89 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
90 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
91 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
92 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
93 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
94 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
95 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
96 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
97 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
98 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
99 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
100 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
101 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
102 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
103 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
104 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
105 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
106 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
107 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
108 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
109 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
110 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
111 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
112 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
113 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
121 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
122 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
123 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
124 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
125 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
126 2582580736 Prauserella sp. Am3 Isolate Unclassified
127 2643221546 Microbacterium sp. Root53 Isolate Unclassified
128 2671180694 Paenibacillus sp. A3 Isolate Unclassified
129 2744054657 Brevibacillus sp. SKDU10 Isolate Unclassified
130 2775507192 Bacillus sp. AFS041924 Isolate Unclassified
131 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
132 2816332336 Brevibacillus laterosporus ZQ2 Isolate Unclassified
133 2852673933 Sporosarcina sp. JAI121 Isolate Rhizosphere
134 2857460504 Brevibacillus sp. R-74223 Isolate Unclassified
135 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
136 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
137 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
138 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
139 2898907183 Brevibacillus sp. SYP-B805 Isolate Rhizosphere
140 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
141 2964375228 Anaerobacillus alkaliphilus B16-10 Isolate Rhizosphere
142 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
143 2995726249 Leucobacter zeae CC-MF41 Isolate Rhizosphere
144 8055037949 Leucobacter rhizosphaerae H25R-14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.37
Metatranscriptomes 0
Isolates 11.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.58
Nodule 0
Rhizoplane 5.81
Rhizosphere 81.4
Stem 0
Stem Tuber 0.58
Unclassified 2.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496125_0010303 3300048928 Bacteria 9465
2 Ga0070683_100102473 3300005329 Bacteria 2696
3 Ga0070690_100017570 3300005330 Bacteria 4305
4 Ga0070690_100039253 3300005330 Bacteria 2991
5 Ga0070670_100558483 3300005331 Bacteria 1022
6 Ga0068869_100309140 3300005334 Bacteria 1279
7 Ga0070680_100000057 3300005336 Bacteria 57308
8 Ga0070682_100531215 3300005337 Unclassified 917
9 Ga0070668_100040208 3300005347 Bacteria 3579
10 Ga0070668_100498431 3300005347 Bacteria 1054
11 Ga0070675_100035988 3300005354 Bacteria 4026
12 Ga0070675_100322613 3300005354 Bacteria 1365
13 Ga0070674_100133545 3300005356 Bacteria 1854
14 Ga0070659_100404043 3300005366 Bacteria 1153
15 Ga0070667_100041995 3300005367 Bacteria 3835
16 Ga0070709_10178712 3300005434 Bacteria 1488
17 Ga0070714_100243086 3300005435 Bacteria 1662
18 Ga0070714_100261681 3300005435 Bacteria 1602
19 Ga0070701_10031957 3300005438 Bacteria 2617
20 Ga0070708_100063211 3300005445 Bacteria 3313
21 Ga0070678_100000958 3300005456 Bacteria 14860
22 Ga0070681_10029111 3300005458 Bacteria 5545
23 Ga0068867_100049905 3300005459 Bacteria 3082
24 Ga0068867_100183018 3300005459 Bacteria 1667
25 Ga0070685_10076706 3300005466 Bacteria 1994
26 Ga0070707_100291707 3300005468 Bacteria 1585
27 Ga0070698_100349298 3300005471 Bacteria 1410
28 Ga0070699_100088606 3300005518 Bacteria 2703
29 Ga0070679_100014127 3300005530 Bacteria 7658
30 Ga0070679_100586503 3300005530 Bacteria 1058
31 Ga0070697_100160335 3300005536 Bacteria 1900
32 Ga0070672_100193687 3300005543 Bacteria 1698
33 Ga0070686_100003985 3300005544 Bacteria 8123
34 Ga0070695_100134412 3300005545 Bacteria 1708
35 Ga0070665_100500602 3300005548 Bacteria 1226
36 Ga0070704_100590982 3300005549 Bacteria 975
37 Ga0070664_100212364 3300005564 Bacteria 1730
38 Ga0068857_100554532 3300005577 Bacteria 1083
39 Ga0070702_100006834 3300005615 Bacteria 5427
40 Ga0068852_100071529 3300005616 Bacteria 3046
41 Ga0068852_100358405 3300005616 Bacteria 1426
42 Ga0068859_100006024 3300005617 Bacteria 12314
43 Ga0068859_100193655 3300005617 Bacteria 2117
44 Ga0068859_100222066 3300005617 Unclassified 1977
45 Ga0068861_100200339 3300005719 Bacteria 1675
46 Ga0068863_101010029 3300005841 Bacteria 835
47 Ga0068858_100071514 3300005842 Bacteria 3218
48 Ga0068862_100135305 3300005844 Bacteria 2183
49 Ga0070715_10051148 3300006163 Bacteria 1777
50 Ga0070712_100773845 3300006175 Unclassified 822
51 Ga0068871_100024612 3300006358 Bacteria 4670
52 Ga0068865_100052535 3300006881 Bacteria 2825
53 Ga0097620_100006024 3300006931 Bacteria 12314
54 Ga0097620_100193642 3300006931 Bacteria 2117
55 Ga0097620_100222074 3300006931 Unclassified 1977
56 Ga0105245_10054811 3300009098 Bacteria 3580
57 Ga0105245_11000785 3300009098 Bacteria 880
58 Ga0105247_10034865 3300009101 Bacteria 3066
59 Ga0105243_10014570 3300009148 Bacteria 5948
60 Ga0105243_10293680 3300009148 Bacteria 1470
61 Ga0105242_10366262 3300009176 Bacteria 1335
62 Ga0105248_10053273 3300009177 Bacteria 4540
63 Ga0105239_11205443 3300010375 Bacteria 872
64 Ga0105246_10000132 3300011119 Bacteria 34860
65 Ga0157374_10599331 3300013296 Bacteria 1112
66 Ga0157375_10057604 3300013308 Bacteria 3841
67 Ga0157380_10216861 3300014326 Bacteria 1709
68 Ga0157377_10073942 3300014745 Bacteria 1976
69 Ga0157377_10226372 3300014745 Bacteria 1200
70 Ga0157379_10017495 3300014968 Bacteria 6311
71 Ga0157376_10002442 3300014969 Bacteria 12569
72 Ga0207710_10007799 3300025900 Bacteria 4532
73 Ga0207699_10273776 3300025906 Bacteria 1171
74 Ga0207643_10112811 3300025908 Bacteria 1603
75 Ga0207660_10003373 3300025917 Bacteria 10410
76 Ga0207660_10275646 3300025917 Bacteria 1333
77 Ga0207657_10155569 3300025919 Bacteria 1859
78 Ga0207652_10330825 3300025921 Bacteria 1376
79 Ga0207646_10545512 3300025922 Bacteria 1043
80 Ga0207659_10264282 3300025926 Bacteria 1401
81 Ga0207664_10229046 3300025929 Bacteria 1615
82 Ga0207686_10208189 3300025934 Bacteria 1405
83 Ga0207686_10286945 3300025934 Bacteria 1217
84 Ga0207686_10288178 3300025934 Bacteria 1215
85 Ga0207709_10052705 3300025935 Bacteria 2500
86 Ga0207709_10126350 3300025935 Bacteria 1735
87 Ga0207669_10029126 3300025937 Bacteria 3049
88 Ga0207704_10014512 3300025938 Bacteria 3980
89 Ga0207704_10537335 3300025938 Bacteria 948
90 Ga0207691_10117364 3300025940 Bacteria 2361
91 Ga0207691_10204013 3300025940 Bacteria 1720
92 Ga0207689_10267716 3300025942 Bacteria 1414
93 Ga0207661_10505475 3300025944 Bacteria 1104
94 Ga0207703_10063570 3300026035 Bacteria 3027
95 Ga0207678_10377338 3300026067 Bacteria 1225
96 Ga0207648_10130712 3300026089 Bacteria 2210
97 Ga0207675_100251489 3300026118 Bacteria 1711
98 Ga0207683_10000257 3300026121 Bacteria 47314
99 Ga0207683_10140754 3300026121 Bacteria 2174
100 Ga0207698_10134329 3300026142 Bacteria 2120
101 Ga0268264_10148727 3300028381 Bacteria 2097
102 Ga0265319_1043974 3300028563 Bacteria 1498
103 Ga0265338_10285168 3300028800 Bacteria 1205
104 Ga0265324_10012776 3300029957 Bacteria 3155
105 Ga0265316_10139751 3300031344 Bacteria 1820
106 Ga0307513_10125335 3300031456 Bacteria 2525
107 Ga0307413_10282917 3300031824 Bacteria 1248
108 Ga0307407_10059317 3300031903 Bacteria 2228
109 Ga0307409_100001930 3300031995 Bacteria 10592
110 Ga0307416_100166951 3300032002 Bacteria 2043
111 Ga0373944_0073133 3300035089 Bacteria 1120
112 Ga0395899_0042432 3300037312 Bacteria 3395
113 Ga0395900_0015319 3300037418 Bacteria 7815
114 Ga0395900_0188958 3300037418 Bacteria 2090
115 Ga0395898_0085712 3300037466 Bacteria 3036
116 Ga0395901_0103658 3300038443 Bacteria 2984
117 Ga0466963_0104382 3300044694 Bacteria 1942
118 Ga0466963_0312122 3300044694 Bacteria 1106
119 Ga0466957_0261196 3300044842 Bacteria 1154
120 Ga0466967_0004182 3300045976 Bacteria 9663
121 Ga0466967_0285033 3300045976 Bacteria 1586
122 Ga0495603_0019902 3300046455 Bacteria 4065
123 Ga0495594_0039211 3300046499 Bacteria 2589
124 Ga0495658_0208172 3300046683 Bacteria 1221
125 Ga0496101_0008645 3300048904 Bacteria 6656
126 Ga0496102_0002248 3300048905 Bacteria 16550
127 Ga0496104_0013843 3300048907 Bacteria 7277
128 Ga0496105_0008612 3300048908 Bacteria 7930
129 Ga0496106_0113361 3300048909 Bacteria 2113
130 Ga0496107_0011536 3300048910 Bacteria 6156
131 Ga0496110_0002374 3300048913 Bacteria 14100
132 Ga0496110_0650321 3300048913 Bacteria 954
133 Ga0496114_0029553 3300048917 Bacteria 4506
134 Ga0496114_0246723 3300048917 Bacteria 1571
135 Ga0496116_0001592 3300048919 Bacteria 24959
136 Ga0496117_0024236 3300048920 Bacteria 4806
137 Ga0496118_0000848 3300048921 Bacteria 48534
138 Ga0496125_0001778 3300048928 Bacteria 29785
139 Ga0496126_0404285 3300048929 Bacteria 1107
140 Ga0501034_0006016 3300049571 Bacteria 13121
141 Ga0501037_0021925 3300049573 Bacteria 4728
142 Ga0501038_0002133 3300049574 Bacteria 18362
143 Ga0501039_0027564 3300049575 Bacteria 4368
144 Ga0501042_0004139 3300049578 Bacteria 9222
145 Ga0501043_0007472 3300049579 Bacteria 8678
146 Ga0501047_0000834 3300049581 Bacteria 31798
147 Ga0501073_0008030 3300049589 Bacteria 7836
148 Ga0501074_0003664 3300049590 Bacteria 10901
149 Ga0501074_0422237 3300049590 Bacteria 946
150 Ga0501044_0005430 3300049823 Bacteria 14160
151 Ga0500638_175559 3300053162 Bacteria 929
152 Ga0501084_0502112 3300054114 Bacteria 1025
153 2558914509 2558860112 Bacteria 9931328
154 2583151424 2582580736 Bacteria 5325865
155 2643752179 2643221546 Bacteria 2910897
156 2673817412 2671180694 Bacteria 7506943
157 2745168360 2744054657 Bacteria 5016802
158 2777837944 2775507192 Bacteria 4622234
159 2808630557 2808606306 Bacteria 3608896
160 2817616606 2816332336 Bacteria 5207640
161 2852677152 2852673933 Bacteria 3347676
162 2857463767 2857460504 Bacteria 5194327
163 2857467168 2857465823 Bacteria 6772595
164 2857591951 2857591370 Bacteria 6569758
165 2865002589 2864997549 Bacteria 5139696
166 2866554427 2866552031 Bacteria 5824618
167 2898907308 2898907183 Bacteria 4067722
168 2899372366 2899370129 Bacteria 6781179
169 2964376827 2964375228 Bacteria 4909004
170 2980180205 2980176882 Bacteria 5397533
171 2995729264 2995726249 Bacteria 3470435
172 8055040217 8055037949 Bacteria 3337834
173 Ga0496125_0010303
174 Ga0070683_100102473
175 Ga0070690_100017570
176 Ga0070690_100039253
177 Ga0070670_100558483
178 Ga0068869_100309140
179 Ga0070680_100000057
180 Ga0070682_100531215
181 Ga0070668_100040208
182 Ga0070668_100498431
183 Ga0070675_100035988
184 Ga0070675_100322613
185 Ga0070674_100133545
186 Ga0070659_100404043
187 Ga0070667_100041995
188 Ga0070709_10178712
189 Ga0070714_100243086
190 Ga0070714_100261681
191 Ga0070701_10031957
192 Ga0070708_100063211
193 Ga0070678_100000958
194 Ga0070681_10029111
195 Ga0068867_100049905
196 Ga0068867_100183018
197 Ga0070685_10076706
198 Ga0070707_100291707
199 Ga0070698_100349298
200 Ga0070699_100088606
201 Ga0070679_100014127
202 Ga0070679_100586503
203 Ga0070697_100160335
204 Ga0070672_100193687
205 Ga0070686_100003985
206 Ga0070695_100134412
207 Ga0070665_100500602
208 Ga0070704_100590982
209 Ga0070664_100212364
210 Ga0068857_100554532
211 Ga0070702_100006834
212 Ga0068852_100071529
213 Ga0068852_100358405
214 Ga0068859_100006024
215 Ga0068859_100193655
216 Ga0068859_100222066
217 Ga0068861_100200339
218 Ga0068863_101010029
219 Ga0068858_100071514
220 Ga0068862_100135305
221 Ga0070715_10051148
222 Ga0070712_100773845
223 Ga0068871_100024612
224 Ga0068865_100052535
225 Ga0097620_100006024
226 Ga0097620_100193642
227 Ga0097620_100222074
228 Ga0105245_10054811
229 Ga0105245_11000785
230 Ga0105247_10034865
231 Ga0105243_10014570
232 Ga0105243_10293680
233 Ga0105242_10366262
234 Ga0105248_10053273
235 Ga0105239_11205443
236 Ga0105246_10000132
237 Ga0157374_10599331
238 Ga0157375_10057604
239 Ga0157380_10216861
240 Ga0157377_10073942
241 Ga0157377_10226372
242 Ga0157379_10017495
243 Ga0157376_10002442
244 Ga0207710_10007799
245 Ga0207699_10273776
246 Ga0207643_10112811
247 Ga0207660_10003373
248 Ga0207660_10275646
249 Ga0207657_10155569
250 Ga0207652_10330825
251 Ga0207646_10545512
252 Ga0207659_10264282
253 Ga0207664_10229046
254 Ga0207686_10208189
255 Ga0207686_10286945
256 Ga0207686_10288178
257 Ga0207709_10052705
258 Ga0207709_10126350
259 Ga0207669_10029126
260 Ga0207704_10014512
261 Ga0207704_10537335
262 Ga0207691_10117364
263 Ga0207691_10204013
264 Ga0207689_10267716
265 Ga0207661_10505475
266 Ga0207703_10063570
267 Ga0207678_10377338
268 Ga0207648_10130712
269 Ga0207675_100251489
270 Ga0207683_10000257
271 Ga0207683_10140754
272 Ga0207698_10134329
273 Ga0268264_10148727
274 Ga0265319_1043974
275 Ga0265338_10285168
276 Ga0265324_10012776
277 Ga0265316_10139751
278 Ga0307513_10125335
279 Ga0307413_10282917
280 Ga0307407_10059317
281 Ga0307409_100001930
282 Ga0307416_100166951
283 Ga0373944_0073133
284 Ga0395899_0042432
285 Ga0395900_0015319
286 Ga0395900_0188958
287 Ga0395898_0085712
288 Ga0395901_0103658
289 Ga0466963_0104382
290 Ga0466963_0312122
291 Ga0466957_0261196
292 Ga0466967_0004182
293 Ga0466967_0285033
294 Ga0495603_0019902
295 Ga0495594_0039211
296 Ga0495658_0208172
297 Ga0496101_0008645
298 Ga0496102_0002248
299 Ga0496104_0013843
300 Ga0496105_0008612
301 Ga0496106_0113361
302 Ga0496107_0011536
303 Ga0496110_0002374
304 Ga0496110_0650321
305 Ga0496114_0029553
306 Ga0496114_0246723
307 Ga0496116_0001592
308 Ga0496117_0024236
309 Ga0496118_0000848
310 Ga0496125_0001778
311 Ga0496126_0404285
312 Ga0501034_0006016
313 Ga0501037_0021925
314 Ga0501038_0002133
315 Ga0501039_0027564
316 Ga0501042_0004139
317 Ga0501043_0007472
318 Ga0501047_0000834
319 Ga0501073_0008030
320 Ga0501074_0003664
321 Ga0501074_0422237
322 Ga0501044_0005430
323 Ga0500638_175559
324 Ga0501084_0502112
325 2558914509
326 2583151424
327 2643752179
328 2673817412
329 2745168360
330 2777837944
331 2808630557
332 2817616606
333 2852677152
334 2857463767
335 2857467168
336 2857591951
337 2865002589
338 2866554427
339 2898907308
340 2899372366
341 2964376827
342 2980180205
343 2995729264
344 8055040217

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03746

LamB_YcsF

LamB/YcsF family

19

257

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1v6t-assembly1.cif.gz_A crystal structure of lactam utilization protein from pyrococcus horikoshii ot3 0.9767 4 251
2dfa-assembly1.cif.gz_A crystal structure of lactam utilization protein from thermus thermophilus hb8 0.9725 4 251
2dfa-assembly1.cif.gz_A crystal structure of lactam utilization protein from thermus thermophilus hb8 0.961 4 251
1v6t-assembly1.cif.gz_A crystal structure of lactam utilization protein from pyrococcus horikoshii ot3 0.9498 4 251
1xw8-assembly1.cif.gz_A-2 x-ray structure of putative lactam utilization protein ybgl. northeast structural genomics consortium target et90. 0.9482 4 251
ID Description Score Start End Superfamily
af_Q2FXX2_1_250_3.20.20.370 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.985 4 251 3.20.20.370
1v6tA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.9767 4 251 3.20.20.370
af_Q2FXX2_1_250_3.20.20.370 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.9734 4 251 3.20.20.370
2dfaA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.9725 4 251 3.20.20.370
2dfaA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.961 4 251 3.20.20.370
ID Description Score Start End GO Terms
AF-A0A7U9H294-F1-model_v4 5-oxoprolinase subunit A (5-OPase subunit A) (EC 3.5.2.9) (5-oxoprolinase (ATP-hydrolyzing) subunit A) 0.9933 3 251 GO:0005524
GO:0005975
GO:0017168
AF-A0A5M6DBL6-F1-model_v4 5-oxoprolinase subunit A (5-OPase subunit A) (EC 3.5.2.9) (5-oxoprolinase (ATP-hydrolyzing) subunit A) 0.9932 1 251 GO:0005524
GO:0005975
GO:0017168
AF-A0A4Q5LUV2-F1-model_v4 5-oxoprolinase subunit A (5-OPase subunit A) (EC 3.5.2.9) (5-oxoprolinase (ATP-hydrolyzing) subunit A) 0.993 3 251 GO:0005524
GO:0005975
GO:0017168
AF-A0A2N6R9T3-F1-model_v4 deleted 0.9924 4 250
AF-W4QYA3-F1-model_v4 5-oxoprolinase subunit A (5-OPase subunit A) (EC 3.5.2.9) (5-oxoprolinase (ATP-hydrolyzing) subunit A) 0.9924 3 251 GO:0005524
GO:0005975
GO:0017168

Map