F261455
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 172 | 144 | 344 | 253 |
Family's Representative Sequence
| Representative Sequence | 3300048928|Ga0496125_0010303|Ga0496125_0010303_549_1355 |
| Length | 268 |
| Sequence | LFDAPFYHFSEGGTAMYRVDLNCDLGESFGAYTLGTDELILPFLTSANIACGFHAGDPRVMFSTVRLAIQNDVAIGAHPGLPDLIGFGRRNMDISPQEAYEMVVYQIGALYGFVKAAGGNMRHVKPHGALYNMAAKRQDLAQAIAEAVYKVDPALILFGLSGSELVTAGEKIGLKTAHEVFADRTYQLDGTLTPRKEAGAMITDHQQAVSQVVRMVKEGVVRSQQGKDISIKADTVCIHGDGAHALEFARQIRSFLEESNIAVRAVGK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 4 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 20 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 33 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 35 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 36 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 37 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 38 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 39 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 40 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 43 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 44 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 82 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 83 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 84 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 85 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 86 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 87 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 88 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 89 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 90 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 91 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 92 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 93 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 94 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 95 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 96 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 97 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 98 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 102 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 103 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 104 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 105 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 106 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 107 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 108 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 109 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 110 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 111 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 112 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 113 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 114 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 115 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 116 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 117 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 118 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 119 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 120 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 121 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 122 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 123 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 124 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 125 | 2558860112 | Pseudonocardia acaciae DSM 45401 | Isolate | Unclassified |
| 126 | 2582580736 | Prauserella sp. Am3 | Isolate | Unclassified |
| 127 | 2643221546 | Microbacterium sp. Root53 | Isolate | Unclassified |
| 128 | 2671180694 | Paenibacillus sp. A3 | Isolate | Unclassified |
| 129 | 2744054657 | Brevibacillus sp. SKDU10 | Isolate | Unclassified |
| 130 | 2775507192 | Bacillus sp. AFS041924 | Isolate | Unclassified |
| 131 | 2808606306 | Microbacterium sp. SLBN-146 | Isolate | Unclassified |
| 132 | 2816332336 | Brevibacillus laterosporus ZQ2 | Isolate | Unclassified |
| 133 | 2852673933 | Sporosarcina sp. JAI121 | Isolate | Rhizosphere |
| 134 | 2857460504 | Brevibacillus sp. R-74223 | Isolate | Unclassified |
| 135 | 2857465823 | Brevibacillus sp. R-74266 | Isolate | Unclassified |
| 136 | 2857591370 | Brevibacillus sp. R-71934 | Isolate | Unclassified |
| 137 | 2864997549 | Paenibacillus sp. R-72005 | Isolate | Unclassified |
| 138 | 2866552031 | Saccharopolyspora rhizosphaerae H219 | Isolate | Unclassified |
| 139 | 2898907183 | Brevibacillus sp. SYP-B805 | Isolate | Rhizosphere |
| 140 | 2899370129 | Amycolatopsis alkalitolerans SYSUP0005 | Isolate | Stem Tuber |
| 141 | 2964375228 | Anaerobacillus alkaliphilus B16-10 | Isolate | Rhizosphere |
| 142 | 2980176882 | Paenibacillus apii 7028 | Isolate | Rhizosphere |
| 143 | 2995726249 | Leucobacter zeae CC-MF41 | Isolate | Rhizosphere |
| 144 | 8055037949 | Leucobacter rhizosphaerae H25R-14 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.37 |
| Metatranscriptomes | 0 |
| Isolates | 11.63 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.58 |
| Nodule | 0 |
| Rhizoplane | 5.81 |
| Rhizosphere | 81.4 |
| Stem | 0 |
| Stem Tuber | 0.58 |
| Unclassified | 2.33 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0496125_0010303 | 3300048928 | Bacteria | 9465 |
| 2 | Ga0070683_100102473 | 3300005329 | Bacteria | 2696 |
| 3 | Ga0070690_100017570 | 3300005330 | Bacteria | 4305 |
| 4 | Ga0070690_100039253 | 3300005330 | Bacteria | 2991 |
| 5 | Ga0070670_100558483 | 3300005331 | Bacteria | 1022 |
| 6 | Ga0068869_100309140 | 3300005334 | Bacteria | 1279 |
| 7 | Ga0070680_100000057 | 3300005336 | Bacteria | 57308 |
| 8 | Ga0070682_100531215 | 3300005337 | Unclassified | 917 |
| 9 | Ga0070668_100040208 | 3300005347 | Bacteria | 3579 |
| 10 | Ga0070668_100498431 | 3300005347 | Bacteria | 1054 |
| 11 | Ga0070675_100035988 | 3300005354 | Bacteria | 4026 |
| 12 | Ga0070675_100322613 | 3300005354 | Bacteria | 1365 |
| 13 | Ga0070674_100133545 | 3300005356 | Bacteria | 1854 |
| 14 | Ga0070659_100404043 | 3300005366 | Bacteria | 1153 |
| 15 | Ga0070667_100041995 | 3300005367 | Bacteria | 3835 |
| 16 | Ga0070709_10178712 | 3300005434 | Bacteria | 1488 |
| 17 | Ga0070714_100243086 | 3300005435 | Bacteria | 1662 |
| 18 | Ga0070714_100261681 | 3300005435 | Bacteria | 1602 |
| 19 | Ga0070701_10031957 | 3300005438 | Bacteria | 2617 |
| 20 | Ga0070708_100063211 | 3300005445 | Bacteria | 3313 |
| 21 | Ga0070678_100000958 | 3300005456 | Bacteria | 14860 |
| 22 | Ga0070681_10029111 | 3300005458 | Bacteria | 5545 |
| 23 | Ga0068867_100049905 | 3300005459 | Bacteria | 3082 |
| 24 | Ga0068867_100183018 | 3300005459 | Bacteria | 1667 |
| 25 | Ga0070685_10076706 | 3300005466 | Bacteria | 1994 |
| 26 | Ga0070707_100291707 | 3300005468 | Bacteria | 1585 |
| 27 | Ga0070698_100349298 | 3300005471 | Bacteria | 1410 |
| 28 | Ga0070699_100088606 | 3300005518 | Bacteria | 2703 |
| 29 | Ga0070679_100014127 | 3300005530 | Bacteria | 7658 |
| 30 | Ga0070679_100586503 | 3300005530 | Bacteria | 1058 |
| 31 | Ga0070697_100160335 | 3300005536 | Bacteria | 1900 |
| 32 | Ga0070672_100193687 | 3300005543 | Bacteria | 1698 |
| 33 | Ga0070686_100003985 | 3300005544 | Bacteria | 8123 |
| 34 | Ga0070695_100134412 | 3300005545 | Bacteria | 1708 |
| 35 | Ga0070665_100500602 | 3300005548 | Bacteria | 1226 |
| 36 | Ga0070704_100590982 | 3300005549 | Bacteria | 975 |
| 37 | Ga0070664_100212364 | 3300005564 | Bacteria | 1730 |
| 38 | Ga0068857_100554532 | 3300005577 | Bacteria | 1083 |
| 39 | Ga0070702_100006834 | 3300005615 | Bacteria | 5427 |
| 40 | Ga0068852_100071529 | 3300005616 | Bacteria | 3046 |
| 41 | Ga0068852_100358405 | 3300005616 | Bacteria | 1426 |
| 42 | Ga0068859_100006024 | 3300005617 | Bacteria | 12314 |
| 43 | Ga0068859_100193655 | 3300005617 | Bacteria | 2117 |
| 44 | Ga0068859_100222066 | 3300005617 | Unclassified | 1977 |
| 45 | Ga0068861_100200339 | 3300005719 | Bacteria | 1675 |
| 46 | Ga0068863_101010029 | 3300005841 | Bacteria | 835 |
| 47 | Ga0068858_100071514 | 3300005842 | Bacteria | 3218 |
| 48 | Ga0068862_100135305 | 3300005844 | Bacteria | 2183 |
| 49 | Ga0070715_10051148 | 3300006163 | Bacteria | 1777 |
| 50 | Ga0070712_100773845 | 3300006175 | Unclassified | 822 |
| 51 | Ga0068871_100024612 | 3300006358 | Bacteria | 4670 |
| 52 | Ga0068865_100052535 | 3300006881 | Bacteria | 2825 |
| 53 | Ga0097620_100006024 | 3300006931 | Bacteria | 12314 |
| 54 | Ga0097620_100193642 | 3300006931 | Bacteria | 2117 |
| 55 | Ga0097620_100222074 | 3300006931 | Unclassified | 1977 |
| 56 | Ga0105245_10054811 | 3300009098 | Bacteria | 3580 |
| 57 | Ga0105245_11000785 | 3300009098 | Bacteria | 880 |
| 58 | Ga0105247_10034865 | 3300009101 | Bacteria | 3066 |
| 59 | Ga0105243_10014570 | 3300009148 | Bacteria | 5948 |
| 60 | Ga0105243_10293680 | 3300009148 | Bacteria | 1470 |
| 61 | Ga0105242_10366262 | 3300009176 | Bacteria | 1335 |
| 62 | Ga0105248_10053273 | 3300009177 | Bacteria | 4540 |
| 63 | Ga0105239_11205443 | 3300010375 | Bacteria | 872 |
| 64 | Ga0105246_10000132 | 3300011119 | Bacteria | 34860 |
| 65 | Ga0157374_10599331 | 3300013296 | Bacteria | 1112 |
| 66 | Ga0157375_10057604 | 3300013308 | Bacteria | 3841 |
| 67 | Ga0157380_10216861 | 3300014326 | Bacteria | 1709 |
| 68 | Ga0157377_10073942 | 3300014745 | Bacteria | 1976 |
| 69 | Ga0157377_10226372 | 3300014745 | Bacteria | 1200 |
| 70 | Ga0157379_10017495 | 3300014968 | Bacteria | 6311 |
| 71 | Ga0157376_10002442 | 3300014969 | Bacteria | 12569 |
| 72 | Ga0207710_10007799 | 3300025900 | Bacteria | 4532 |
| 73 | Ga0207699_10273776 | 3300025906 | Bacteria | 1171 |
| 74 | Ga0207643_10112811 | 3300025908 | Bacteria | 1603 |
| 75 | Ga0207660_10003373 | 3300025917 | Bacteria | 10410 |
| 76 | Ga0207660_10275646 | 3300025917 | Bacteria | 1333 |
| 77 | Ga0207657_10155569 | 3300025919 | Bacteria | 1859 |
| 78 | Ga0207652_10330825 | 3300025921 | Bacteria | 1376 |
| 79 | Ga0207646_10545512 | 3300025922 | Bacteria | 1043 |
| 80 | Ga0207659_10264282 | 3300025926 | Bacteria | 1401 |
| 81 | Ga0207664_10229046 | 3300025929 | Bacteria | 1615 |
| 82 | Ga0207686_10208189 | 3300025934 | Bacteria | 1405 |
| 83 | Ga0207686_10286945 | 3300025934 | Bacteria | 1217 |
| 84 | Ga0207686_10288178 | 3300025934 | Bacteria | 1215 |
| 85 | Ga0207709_10052705 | 3300025935 | Bacteria | 2500 |
| 86 | Ga0207709_10126350 | 3300025935 | Bacteria | 1735 |
| 87 | Ga0207669_10029126 | 3300025937 | Bacteria | 3049 |
| 88 | Ga0207704_10014512 | 3300025938 | Bacteria | 3980 |
| 89 | Ga0207704_10537335 | 3300025938 | Bacteria | 948 |
| 90 | Ga0207691_10117364 | 3300025940 | Bacteria | 2361 |
| 91 | Ga0207691_10204013 | 3300025940 | Bacteria | 1720 |
| 92 | Ga0207689_10267716 | 3300025942 | Bacteria | 1414 |
| 93 | Ga0207661_10505475 | 3300025944 | Bacteria | 1104 |
| 94 | Ga0207703_10063570 | 3300026035 | Bacteria | 3027 |
| 95 | Ga0207678_10377338 | 3300026067 | Bacteria | 1225 |
| 96 | Ga0207648_10130712 | 3300026089 | Bacteria | 2210 |
| 97 | Ga0207675_100251489 | 3300026118 | Bacteria | 1711 |
| 98 | Ga0207683_10000257 | 3300026121 | Bacteria | 47314 |
| 99 | Ga0207683_10140754 | 3300026121 | Bacteria | 2174 |
| 100 | Ga0207698_10134329 | 3300026142 | Bacteria | 2120 |
| 101 | Ga0268264_10148727 | 3300028381 | Bacteria | 2097 |
| 102 | Ga0265319_1043974 | 3300028563 | Bacteria | 1498 |
| 103 | Ga0265338_10285168 | 3300028800 | Bacteria | 1205 |
| 104 | Ga0265324_10012776 | 3300029957 | Bacteria | 3155 |
| 105 | Ga0265316_10139751 | 3300031344 | Bacteria | 1820 |
| 106 | Ga0307513_10125335 | 3300031456 | Bacteria | 2525 |
| 107 | Ga0307413_10282917 | 3300031824 | Bacteria | 1248 |
| 108 | Ga0307407_10059317 | 3300031903 | Bacteria | 2228 |
| 109 | Ga0307409_100001930 | 3300031995 | Bacteria | 10592 |
| 110 | Ga0307416_100166951 | 3300032002 | Bacteria | 2043 |
| 111 | Ga0373944_0073133 | 3300035089 | Bacteria | 1120 |
| 112 | Ga0395899_0042432 | 3300037312 | Bacteria | 3395 |
| 113 | Ga0395900_0015319 | 3300037418 | Bacteria | 7815 |
| 114 | Ga0395900_0188958 | 3300037418 | Bacteria | 2090 |
| 115 | Ga0395898_0085712 | 3300037466 | Bacteria | 3036 |
| 116 | Ga0395901_0103658 | 3300038443 | Bacteria | 2984 |
| 117 | Ga0466963_0104382 | 3300044694 | Bacteria | 1942 |
| 118 | Ga0466963_0312122 | 3300044694 | Bacteria | 1106 |
| 119 | Ga0466957_0261196 | 3300044842 | Bacteria | 1154 |
| 120 | Ga0466967_0004182 | 3300045976 | Bacteria | 9663 |
| 121 | Ga0466967_0285033 | 3300045976 | Bacteria | 1586 |
| 122 | Ga0495603_0019902 | 3300046455 | Bacteria | 4065 |
| 123 | Ga0495594_0039211 | 3300046499 | Bacteria | 2589 |
| 124 | Ga0495658_0208172 | 3300046683 | Bacteria | 1221 |
| 125 | Ga0496101_0008645 | 3300048904 | Bacteria | 6656 |
| 126 | Ga0496102_0002248 | 3300048905 | Bacteria | 16550 |
| 127 | Ga0496104_0013843 | 3300048907 | Bacteria | 7277 |
| 128 | Ga0496105_0008612 | 3300048908 | Bacteria | 7930 |
| 129 | Ga0496106_0113361 | 3300048909 | Bacteria | 2113 |
| 130 | Ga0496107_0011536 | 3300048910 | Bacteria | 6156 |
| 131 | Ga0496110_0002374 | 3300048913 | Bacteria | 14100 |
| 132 | Ga0496110_0650321 | 3300048913 | Bacteria | 954 |
| 133 | Ga0496114_0029553 | 3300048917 | Bacteria | 4506 |
| 134 | Ga0496114_0246723 | 3300048917 | Bacteria | 1571 |
| 135 | Ga0496116_0001592 | 3300048919 | Bacteria | 24959 |
| 136 | Ga0496117_0024236 | 3300048920 | Bacteria | 4806 |
| 137 | Ga0496118_0000848 | 3300048921 | Bacteria | 48534 |
| 138 | Ga0496125_0001778 | 3300048928 | Bacteria | 29785 |
| 139 | Ga0496126_0404285 | 3300048929 | Bacteria | 1107 |
| 140 | Ga0501034_0006016 | 3300049571 | Bacteria | 13121 |
| 141 | Ga0501037_0021925 | 3300049573 | Bacteria | 4728 |
| 142 | Ga0501038_0002133 | 3300049574 | Bacteria | 18362 |
| 143 | Ga0501039_0027564 | 3300049575 | Bacteria | 4368 |
| 144 | Ga0501042_0004139 | 3300049578 | Bacteria | 9222 |
| 145 | Ga0501043_0007472 | 3300049579 | Bacteria | 8678 |
| 146 | Ga0501047_0000834 | 3300049581 | Bacteria | 31798 |
| 147 | Ga0501073_0008030 | 3300049589 | Bacteria | 7836 |
| 148 | Ga0501074_0003664 | 3300049590 | Bacteria | 10901 |
| 149 | Ga0501074_0422237 | 3300049590 | Bacteria | 946 |
| 150 | Ga0501044_0005430 | 3300049823 | Bacteria | 14160 |
| 151 | Ga0500638_175559 | 3300053162 | Bacteria | 929 |
| 152 | Ga0501084_0502112 | 3300054114 | Bacteria | 1025 |
| 153 | 2558914509 | 2558860112 | Bacteria | 9931328 |
| 154 | 2583151424 | 2582580736 | Bacteria | 5325865 |
| 155 | 2643752179 | 2643221546 | Bacteria | 2910897 |
| 156 | 2673817412 | 2671180694 | Bacteria | 7506943 |
| 157 | 2745168360 | 2744054657 | Bacteria | 5016802 |
| 158 | 2777837944 | 2775507192 | Bacteria | 4622234 |
| 159 | 2808630557 | 2808606306 | Bacteria | 3608896 |
| 160 | 2817616606 | 2816332336 | Bacteria | 5207640 |
| 161 | 2852677152 | 2852673933 | Bacteria | 3347676 |
| 162 | 2857463767 | 2857460504 | Bacteria | 5194327 |
| 163 | 2857467168 | 2857465823 | Bacteria | 6772595 |
| 164 | 2857591951 | 2857591370 | Bacteria | 6569758 |
| 165 | 2865002589 | 2864997549 | Bacteria | 5139696 |
| 166 | 2866554427 | 2866552031 | Bacteria | 5824618 |
| 167 | 2898907308 | 2898907183 | Bacteria | 4067722 |
| 168 | 2899372366 | 2899370129 | Bacteria | 6781179 |
| 169 | 2964376827 | 2964375228 | Bacteria | 4909004 |
| 170 | 2980180205 | 2980176882 | Bacteria | 5397533 |
| 171 | 2995729264 | 2995726249 | Bacteria | 3470435 |
| 172 | 8055040217 | 8055037949 | Bacteria | 3337834 |
| 173 | Ga0496125_0010303 | |||
| 174 | Ga0070683_100102473 | |||
| 175 | Ga0070690_100017570 | |||
| 176 | Ga0070690_100039253 | |||
| 177 | Ga0070670_100558483 | |||
| 178 | Ga0068869_100309140 | |||
| 179 | Ga0070680_100000057 | |||
| 180 | Ga0070682_100531215 | |||
| 181 | Ga0070668_100040208 | |||
| 182 | Ga0070668_100498431 | |||
| 183 | Ga0070675_100035988 | |||
| 184 | Ga0070675_100322613 | |||
| 185 | Ga0070674_100133545 | |||
| 186 | Ga0070659_100404043 | |||
| 187 | Ga0070667_100041995 | |||
| 188 | Ga0070709_10178712 | |||
| 189 | Ga0070714_100243086 | |||
| 190 | Ga0070714_100261681 | |||
| 191 | Ga0070701_10031957 | |||
| 192 | Ga0070708_100063211 | |||
| 193 | Ga0070678_100000958 | |||
| 194 | Ga0070681_10029111 | |||
| 195 | Ga0068867_100049905 | |||
| 196 | Ga0068867_100183018 | |||
| 197 | Ga0070685_10076706 | |||
| 198 | Ga0070707_100291707 | |||
| 199 | Ga0070698_100349298 | |||
| 200 | Ga0070699_100088606 | |||
| 201 | Ga0070679_100014127 | |||
| 202 | Ga0070679_100586503 | |||
| 203 | Ga0070697_100160335 | |||
| 204 | Ga0070672_100193687 | |||
| 205 | Ga0070686_100003985 | |||
| 206 | Ga0070695_100134412 | |||
| 207 | Ga0070665_100500602 | |||
| 208 | Ga0070704_100590982 | |||
| 209 | Ga0070664_100212364 | |||
| 210 | Ga0068857_100554532 | |||
| 211 | Ga0070702_100006834 | |||
| 212 | Ga0068852_100071529 | |||
| 213 | Ga0068852_100358405 | |||
| 214 | Ga0068859_100006024 | |||
| 215 | Ga0068859_100193655 | |||
| 216 | Ga0068859_100222066 | |||
| 217 | Ga0068861_100200339 | |||
| 218 | Ga0068863_101010029 | |||
| 219 | Ga0068858_100071514 | |||
| 220 | Ga0068862_100135305 | |||
| 221 | Ga0070715_10051148 | |||
| 222 | Ga0070712_100773845 | |||
| 223 | Ga0068871_100024612 | |||
| 224 | Ga0068865_100052535 | |||
| 225 | Ga0097620_100006024 | |||
| 226 | Ga0097620_100193642 | |||
| 227 | Ga0097620_100222074 | |||
| 228 | Ga0105245_10054811 | |||
| 229 | Ga0105245_11000785 | |||
| 230 | Ga0105247_10034865 | |||
| 231 | Ga0105243_10014570 | |||
| 232 | Ga0105243_10293680 | |||
| 233 | Ga0105242_10366262 | |||
| 234 | Ga0105248_10053273 | |||
| 235 | Ga0105239_11205443 | |||
| 236 | Ga0105246_10000132 | |||
| 237 | Ga0157374_10599331 | |||
| 238 | Ga0157375_10057604 | |||
| 239 | Ga0157380_10216861 | |||
| 240 | Ga0157377_10073942 | |||
| 241 | Ga0157377_10226372 | |||
| 242 | Ga0157379_10017495 | |||
| 243 | Ga0157376_10002442 | |||
| 244 | Ga0207710_10007799 | |||
| 245 | Ga0207699_10273776 | |||
| 246 | Ga0207643_10112811 | |||
| 247 | Ga0207660_10003373 | |||
| 248 | Ga0207660_10275646 | |||
| 249 | Ga0207657_10155569 | |||
| 250 | Ga0207652_10330825 | |||
| 251 | Ga0207646_10545512 | |||
| 252 | Ga0207659_10264282 | |||
| 253 | Ga0207664_10229046 | |||
| 254 | Ga0207686_10208189 | |||
| 255 | Ga0207686_10286945 | |||
| 256 | Ga0207686_10288178 | |||
| 257 | Ga0207709_10052705 | |||
| 258 | Ga0207709_10126350 | |||
| 259 | Ga0207669_10029126 | |||
| 260 | Ga0207704_10014512 | |||
| 261 | Ga0207704_10537335 | |||
| 262 | Ga0207691_10117364 | |||
| 263 | Ga0207691_10204013 | |||
| 264 | Ga0207689_10267716 | |||
| 265 | Ga0207661_10505475 | |||
| 266 | Ga0207703_10063570 | |||
| 267 | Ga0207678_10377338 | |||
| 268 | Ga0207648_10130712 | |||
| 269 | Ga0207675_100251489 | |||
| 270 | Ga0207683_10000257 | |||
| 271 | Ga0207683_10140754 | |||
| 272 | Ga0207698_10134329 | |||
| 273 | Ga0268264_10148727 | |||
| 274 | Ga0265319_1043974 | |||
| 275 | Ga0265338_10285168 | |||
| 276 | Ga0265324_10012776 | |||
| 277 | Ga0265316_10139751 | |||
| 278 | Ga0307513_10125335 | |||
| 279 | Ga0307413_10282917 | |||
| 280 | Ga0307407_10059317 | |||
| 281 | Ga0307409_100001930 | |||
| 282 | Ga0307416_100166951 | |||
| 283 | Ga0373944_0073133 | |||
| 284 | Ga0395899_0042432 | |||
| 285 | Ga0395900_0015319 | |||
| 286 | Ga0395900_0188958 | |||
| 287 | Ga0395898_0085712 | |||
| 288 | Ga0395901_0103658 | |||
| 289 | Ga0466963_0104382 | |||
| 290 | Ga0466963_0312122 | |||
| 291 | Ga0466957_0261196 | |||
| 292 | Ga0466967_0004182 | |||
| 293 | Ga0466967_0285033 | |||
| 294 | Ga0495603_0019902 | |||
| 295 | Ga0495594_0039211 | |||
| 296 | Ga0495658_0208172 | |||
| 297 | Ga0496101_0008645 | |||
| 298 | Ga0496102_0002248 | |||
| 299 | Ga0496104_0013843 | |||
| 300 | Ga0496105_0008612 | |||
| 301 | Ga0496106_0113361 | |||
| 302 | Ga0496107_0011536 | |||
| 303 | Ga0496110_0002374 | |||
| 304 | Ga0496110_0650321 | |||
| 305 | Ga0496114_0029553 | |||
| 306 | Ga0496114_0246723 | |||
| 307 | Ga0496116_0001592 | |||
| 308 | Ga0496117_0024236 | |||
| 309 | Ga0496118_0000848 | |||
| 310 | Ga0496125_0001778 | |||
| 311 | Ga0496126_0404285 | |||
| 312 | Ga0501034_0006016 | |||
| 313 | Ga0501037_0021925 | |||
| 314 | Ga0501038_0002133 | |||
| 315 | Ga0501039_0027564 | |||
| 316 | Ga0501042_0004139 | |||
| 317 | Ga0501043_0007472 | |||
| 318 | Ga0501047_0000834 | |||
| 319 | Ga0501073_0008030 | |||
| 320 | Ga0501074_0003664 | |||
| 321 | Ga0501074_0422237 | |||
| 322 | Ga0501044_0005430 | |||
| 323 | Ga0500638_175559 | |||
| 324 | Ga0501084_0502112 | |||
| 325 | 2558914509 | |||
| 326 | 2583151424 | |||
| 327 | 2643752179 | |||
| 328 | 2673817412 | |||
| 329 | 2745168360 | |||
| 330 | 2777837944 | |||
| 331 | 2808630557 | |||
| 332 | 2817616606 | |||
| 333 | 2852677152 | |||
| 334 | 2857463767 | |||
| 335 | 2857467168 | |||
| 336 | 2857591951 | |||
| 337 | 2865002589 | |||
| 338 | 2866554427 | |||
| 339 | 2898907308 | |||
| 340 | 2899372366 | |||
| 341 | 2964376827 | |||
| 342 | 2980180205 | |||
| 343 | 2995729264 | |||
| 344 | 8055040217 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1v6t-assembly1.cif.gz_A | crystal structure of lactam utilization protein from pyrococcus horikoshii ot3 | 0.9767 | 4 | 251 |
| 2dfa-assembly1.cif.gz_A | crystal structure of lactam utilization protein from thermus thermophilus hb8 | 0.9725 | 4 | 251 |
| 2dfa-assembly1.cif.gz_A | crystal structure of lactam utilization protein from thermus thermophilus hb8 | 0.961 | 4 | 251 |
| 1v6t-assembly1.cif.gz_A | crystal structure of lactam utilization protein from pyrococcus horikoshii ot3 | 0.9498 | 4 | 251 |
| 1xw8-assembly1.cif.gz_A-2 | x-ray structure of putative lactam utilization protein ybgl. northeast structural genomics consortium target et90. | 0.9482 | 4 | 251 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FXX2_1_250_3.20.20.370 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase | 0.985 | 4 | 251 | 3.20.20.370 |
| 1v6tA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase | 0.9767 | 4 | 251 | 3.20.20.370 |
| af_Q2FXX2_1_250_3.20.20.370 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase | 0.9734 | 4 | 251 | 3.20.20.370 |
| 2dfaA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase | 0.9725 | 4 | 251 | 3.20.20.370 |
| 2dfaA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase | 0.961 | 4 | 251 | 3.20.20.370 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7U9H294-F1-model_v4 | 5-oxoprolinase subunit A (5-OPase subunit A) (EC 3.5.2.9) (5-oxoprolinase (ATP-hydrolyzing) subunit A) | 0.9933 | 3 | 251 |
GO:0005524
GO:0005975 GO:0017168 |
| AF-A0A5M6DBL6-F1-model_v4 | 5-oxoprolinase subunit A (5-OPase subunit A) (EC 3.5.2.9) (5-oxoprolinase (ATP-hydrolyzing) subunit A) | 0.9932 | 1 | 251 |
GO:0005524
GO:0005975 GO:0017168 |
| AF-A0A4Q5LUV2-F1-model_v4 | 5-oxoprolinase subunit A (5-OPase subunit A) (EC 3.5.2.9) (5-oxoprolinase (ATP-hydrolyzing) subunit A) | 0.993 | 3 | 251 |
GO:0005524
GO:0005975 GO:0017168 |
| AF-A0A2N6R9T3-F1-model_v4 | deleted | 0.9924 | 4 | 250 |
|
| AF-W4QYA3-F1-model_v4 | 5-oxoprolinase subunit A (5-OPase subunit A) (EC 3.5.2.9) (5-oxoprolinase (ATP-hydrolyzing) subunit A) | 0.9924 | 3 | 251 |
GO:0005524
GO:0005975 GO:0017168 |