F261425

General Info

Members Datasets Scaffolds Average Seq Length
172 134 344 207

Family's Representative Sequence

Representative Sequence 3300048914|Ga0496111_0182536|Ga0496111_0182536_596_1387
Length 243
Sequence VCKLLGWRLAAGVPRVANQLGVRTRVPRVVGMTVTQSTWTEITDVEALVDLVGVPIARVRDKVRPVLHDLDRQWLAASPFCLVATSDAEGRCDVSPKGDPAGQLAYVLDDVTIAIAERPGNRRVDGYHNILANPHVGLLFMIPGRGDTLRINGRARLVTEAPFFDDMIVKGHRPILALVVDIEEIFHHCAKAFLRSQLWRPETWNDPVPPRPVIAHELDAKDQSVEQLTEYYGERYAAKLYSS

Samples

Sample ID Description Type Environment
1 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
13 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
14 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
15 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
16 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
17 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
18 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
19 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
20 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
21 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
22 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
23 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
24 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
25 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
26 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
27 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
28 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
29 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
44 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
45 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
46 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
47 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
48 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
49 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
50 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
51 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
52 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
53 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
54 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
55 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
56 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
57 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
58 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
59 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
60 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
61 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
62 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
63 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
64 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
65 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
66 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
67 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
68 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
69 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
70 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
71 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
72 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
73 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
74 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
75 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
76 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
77 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
78 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
79 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
80 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
81 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
82 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
83 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
84 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
85 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
86 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
87 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
88 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
89 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
90 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
91 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
92 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
93 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
94 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
95 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
96 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
97 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
98 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
99 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
100 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
110 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
111 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
112 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
113 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
114 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
115 2558860280 Kutzneria sp. 744 Isolate Unclassified
116 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
117 2643221549 Agromyces sp. Root1464 Isolate Unclassified
118 2643221604 Nocardioides sp. Root190 Isolate Unclassified
119 2643221617 Nocardioides sp. Root79 Isolate Unclassified
120 2643221620 Nocardioides sp. Root240 Isolate Unclassified
121 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
122 2738541305 Nocardioides sp. CF167 Isolate Unclassified
123 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
124 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
125 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
126 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
127 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere
128 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
129 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
130 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
131 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
132 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
133 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
134 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.79
Metatranscriptomes 0.58
Isolates 11.63

Biome Distribution

Category Percentage (%)
Aerial Root 0.58
Bulb 0
Endosphere 0.58
Nodule 0
Rhizoplane 11.63
Rhizosphere 73.84
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496111_0182536 3300048914 Bacteria 1560
2 rootH2_10078507 3300003320 Bacteria 1997
3 Ga0006562J51391_1070530 3300003578 Bacteria 2980
4 Ga0070683_100352467 3300005329 Bacteria 1402
5 Ga0070689_101023830 3300005340 Bacteria 735
6 Ga0070668_100991142 3300005347 Bacteria 755
7 Ga0070675_100545622 3300005354 Bacteria 1048
8 Ga0070671_100353956 3300005355 Bacteria 1253
9 Ga0070709_10128588 3300005434 Bacteria 1726
10 Ga0070714_100422178 3300005435 Bacteria 1263
11 Ga0070711_100179939 3300005439 Bacteria 1618
12 Ga0068853_100033918 3300005539 Bacteria 4331
13 Ga0068856_100866573 3300005614 Bacteria 922
14 Ga0070702_100586444 3300005615 Bacteria 833
15 Ga0068852_100912658 3300005616 Bacteria 895
16 Ga0068864_100604282 3300005618 Bacteria 1065
17 Ga0068862_100071865 3300005844 Bacteria 2988
18 Ga0081455_10009308 3300005937 Bacteria 10110
19 Ga0081455_10134438 3300005937 Bacteria 1929
20 Ga0070717_10276074 3300006028 Bacteria 1489
21 Ga0070716_100042711 3300006173 Bacteria 2532
22 Ga0111539_11023855 3300009094 Bacteria 960
23 Ga0105243_10150451 3300009148 Bacteria 1996
24 Ga0105238_10035786 3300009551 Bacteria 5047
25 Ga0105249_10301405 3300009553 Bacteria 1607
26 Ga0157375_11616897 3300013308 Bacteria 766
27 Ga0157380_10013581 3300014326 Bacteria 5944
28 Ga0163161_10130259 3300017792 Bacteria 1897
29 Ga0213875_10002071 3300021388 Bacteria 12300
30 Ga0213875_10074801 3300021388 Bacteria 1580
31 Ga0207692_10014379 3300025898 Bacteria 3457
32 Ga0207688_10523882 3300025901 Bacteria 744
33 Ga0207680_10466051 3300025903 Bacteria 898
34 Ga0207699_10033634 3300025906 Bacteria 2899
35 Ga0207694_10081091 3300025924 Bacteria 2548
36 Ga0207664_10062788 3300025929 Bacteria 2967
37 Ga0207690_10524342 3300025932 Bacteria 960
38 Ga0207709_10349224 3300025935 Bacteria 1116
39 Ga0207665_10015509 3300025939 Bacteria 5000
40 Ga0207639_10037397 3300026041 Bacteria 3605
41 Ga0207708_10310881 3300026075 Bacteria 1284
42 Ga0207675_100056547 3300026118 Bacteria 3659
43 Ga0207683_10295192 3300026121 Bacteria 1482
44 Ga0268265_10139591 3300028380 Bacteria 2027
45 Ga0307511_10003680 3300030521 Bacteria 15678
46 Ga0307408_100020693 3300031548 Bacteria 4445
47 Ga0307514_10192549 3300031649 Bacteria 1296
48 Ga0307405_10050183 3300031731 Bacteria 2582
49 Ga0307413_10051382 3300031824 Bacteria 2483
50 Ga0307518_10000810 3300031838 Bacteria 23425
51 Ga0307410_10023602 3300031852 Bacteria 3827
52 Ga0307410_10059080 3300031852 Bacteria 2616
53 Ga0307406_10040525 3300031901 Bacteria 2896
54 Ga0307406_10055632 3300031901 Bacteria 2530
55 Ga0307407_10325201 3300031903 Bacteria 1080
56 Ga0307412_10181357 3300031911 Bacteria 1584
57 Ga0307409_100010461 3300031995 Bacteria 5772
58 Ga0307409_101099770 3300031995 Bacteria 816
59 Ga0307416_100092696 3300032002 Bacteria 2599
60 Ga0307416_100166628 3300032002 Bacteria 2044
61 Ga0307414_10011842 3300032004 Bacteria 5135
62 Ga0307414_10311967 3300032004 Bacteria 1335
63 Ga0307414_10313903 3300032004 Bacteria 1332
64 Ga0307414_11027821 3300032004 Bacteria 759
65 Ga0307411_10322054 3300032005 Bacteria 1249
66 Ga0307415_100066072 3300032126 Bacteria 2522
67 Ga0307415_100142735 3300032126 Bacteria 1831
68 Ga0373927_0001315 3300035695 Bacteria 18767
69 Ga0373947_0023362 3300035725 Bacteria 3595
70 Ga0373925_0001060 3300037068 Bacteria 24809
71 Ga0395900_0495055 3300037418 Bacteria 1173
72 Ga0436364_0090304 3300037853 Bacteria 41526
73 Ga0436364_0750664 3300037853 Bacteria 7261
74 Ga0436364_0853896 3300037853 Bacteria 2575
75 Ga0436365_1467761 3300039437 Bacteria 2800
76 Ga0436362_0095467 3300039453 Bacteria 1200
77 Ga0451798_0307195 3300041458 Bacteria 655
78 Ga0451833_0336108 3300041491 Bacteria 1802
79 Ga0451839_0565306 3300041496 Bacteria 1148
80 Ga0439463_024257 3300042016 Bacteria 1520
81 Ga0466969_0003176 3300044656 Bacteria 8755
82 Ga0466969_0122271 3300044656 Bacteria 1211
83 Ga0466969_0131437 3300044656 Bacteria 1160
84 Ga0466972_0021119 3300044658 Bacteria 3249
85 Ga0466972_0049922 3300044658 Bacteria 2020
86 Ga0466965_0006686 3300044683 Bacteria 5256
87 Ga0466965_0056668 3300044683 Bacteria 1952
88 Ga0466965_0210811 3300044683 Bacteria 1033
89 Ga0466966_0039098 3300044684 Bacteria 3055
90 Ga0466966_0212064 3300044684 Bacteria 1170
91 Ga0466961_0023496 3300044693 Bacteria 3966
92 Ga0466963_0021811 3300044694 Bacteria 4046
93 Ga0466963_0040863 3300044694 Bacteria 3040
94 Ga0466963_0525664 3300044694 Bacteria 835
95 Ga0466963_0600343 3300044694 Bacteria 777
96 Ga0466971_0009140 3300044719 Bacteria 4333
97 Ga0466971_0057349 3300044719 Bacteria 1757
98 Ga0466968_0002053 3300044735 Bacteria 7328
99 Ga0466970_0002429 3300044765 Bacteria 9004
100 Ga0466970_0003476 3300044765 Bacteria 7676
101 Ga0466970_0315426 3300044765 Bacteria 883
102 Ga0466957_0013338 3300044842 Bacteria 4768
103 Ga0466957_0026165 3300044842 Bacteria 3461
104 Ga0466960_0000682 3300044901 Bacteria 11810
105 Ga0466959_0004194 3300045049 Bacteria 9608
106 Ga0466959_0020114 3300045049 Bacteria 4915
107 Ga0466959_0153318 3300045049 Bacteria 1623
108 Ga0466958_0012273 3300045836 Bacteria 4850
109 Ga0466958_0123230 3300045836 Bacteria 1624
110 Ga0466958_0382309 3300045836 Bacteria 908
111 Ga0466967_0271008 3300045976 Bacteria 1627
112 Ga0495651_0055068 3300046462 Bacteria 3057
113 Ga0495594_0055140 3300046499 Bacteria 2191
114 Ga0495620_0048025 3300046515 Bacteria 1834
115 Ga0495637_0161549 3300046520 Bacteria 840
116 Ga0495652_0276694 3300046529 Bacteria 1231
117 Ga0495645_0279177 3300046543 Bacteria 1099
118 Ga0495635_0221448 3300046663 Bacteria 1280
119 Ga0496102_0254207 3300048905 Bacteria 1657
120 Ga0496102_0362952 3300048905 Bacteria 1364
121 Ga0496104_0006175 3300048907 Bacteria 10521
122 Ga0496106_0028508 3300048909 Bacteria 4159
123 Ga0496108_0023371 3300048911 Bacteria 5086
124 Ga0496108_0149309 3300048911 Bacteria 2016
125 Ga0496108_0158401 3300048911 Bacteria 1956
126 Ga0496109_0129952 3300048912 Bacteria 2350
127 Ga0496109_0427997 3300048912 Bacteria 1250
128 Ga0496110_0447383 3300048913 Bacteria 1177
129 Ga0496110_0741145 3300048913 Bacteria 885
130 Ga0496112_0000586 3300048915 Bacteria 24986
131 Ga0496113_0047142 3300048916 Bacteria 3202
132 Ga0496113_0376123 3300048916 Bacteria 1140
133 Ga0496114_0076451 3300048917 Bacteria 2821
134 Ga0496114_0220153 3300048917 Bacteria 1666
135 Ga0496114_0365852 3300048917 Bacteria 1276
136 Ga0496115_0704798 3300048918 Bacteria 793
137 Ga0501036_0007535 3300049572 Bacteria 8879
138 Ga0501037_0153874 3300049573 Bacteria 1642
139 Ga0501038_0022894 3300049574 Bacteria 5593
140 Ga0501042_0015858 3300049578 Bacteria 5165
141 Ga0501043_0152648 3300049579 Bacteria 1807
142 Ga0501047_0329863 3300049581 Bacteria 1364
143 Ga0501048_0058503 3300049582 Bacteria 2732
144 Ga0501035_0010882 3300049822 Bacteria 8423
145 Ga0501044_0012012 3300049823 Bacteria 9381
146 Ga0501212_018669 3300049851 Bacteria 1058
147 nmdc:mga08y16_1028380_c1 3300050511 Bacteria 802
148 Ga0495601_0059521 3300053077 Bacteria 2423
149 Ga0495612_0033933 3300053078 Bacteria 2065
150 Ga0500588_0197690 3300053146 Bacteria 744
151 Ga0466962_0006384 3300061719 Bacteria 5659
152 Ga0466962_0099146 3300061719 Bacteria 1399
153 2559426417 2558860280 Bacteria 11429938
154 2586058486 2585427649 Bacteria 9053857
155 2643769758 2643221549 Bacteria 4042819
156 2644033369 2643221604 Bacteria 5014917
157 2644098313 2643221617 Bacteria 5139111
158 2644118960 2643221620 Bacteria 5134593
159 2676479281 2675903058 Bacteria 6822861
160 2738869253 2738541305 Bacteria 4910150
161 2819744425 2818991472 Bacteria 10089953
162 2827629477 2827628540 Bacteria 6858585
163 2861523505 2861520306 Bacteria 8348283
164 2862708451 2862705112 Bacteria 6563286
165 2883823612 2883821847 Bacteria 5121194
166 2904770121 2904765812 Bacteria 5369154
167 2908815074 2908811453 Bacteria 5478616
168 2935410902 2935409751 Bacteria 4179611
169 2974319904 2974315732 Bacteria 4602776
170 2984523775 2984523437 Bacteria 4508481
171 8056447367 8056447290 Bacteria 7680491
172 8057347514 8057345674 Bacteria 4160394
173 Ga0496111_0182536
174 rootH2_10078507
175 Ga0006562J51391_1070530
176 Ga0070683_100352467
177 Ga0070689_101023830
178 Ga0070668_100991142
179 Ga0070675_100545622
180 Ga0070671_100353956
181 Ga0070709_10128588
182 Ga0070714_100422178
183 Ga0070711_100179939
184 Ga0068853_100033918
185 Ga0068856_100866573
186 Ga0070702_100586444
187 Ga0068852_100912658
188 Ga0068864_100604282
189 Ga0068862_100071865
190 Ga0081455_10009308
191 Ga0081455_10134438
192 Ga0070717_10276074
193 Ga0070716_100042711
194 Ga0111539_11023855
195 Ga0105243_10150451
196 Ga0105238_10035786
197 Ga0105249_10301405
198 Ga0157375_11616897
199 Ga0157380_10013581
200 Ga0163161_10130259
201 Ga0213875_10002071
202 Ga0213875_10074801
203 Ga0207692_10014379
204 Ga0207688_10523882
205 Ga0207680_10466051
206 Ga0207699_10033634
207 Ga0207694_10081091
208 Ga0207664_10062788
209 Ga0207690_10524342
210 Ga0207709_10349224
211 Ga0207665_10015509
212 Ga0207639_10037397
213 Ga0207708_10310881
214 Ga0207675_100056547
215 Ga0207683_10295192
216 Ga0268265_10139591
217 Ga0307511_10003680
218 Ga0307408_100020693
219 Ga0307514_10192549
220 Ga0307405_10050183
221 Ga0307413_10051382
222 Ga0307518_10000810
223 Ga0307410_10023602
224 Ga0307410_10059080
225 Ga0307406_10040525
226 Ga0307406_10055632
227 Ga0307407_10325201
228 Ga0307412_10181357
229 Ga0307409_100010461
230 Ga0307409_101099770
231 Ga0307416_100092696
232 Ga0307416_100166628
233 Ga0307414_10011842
234 Ga0307414_10311967
235 Ga0307414_10313903
236 Ga0307414_11027821
237 Ga0307411_10322054
238 Ga0307415_100066072
239 Ga0307415_100142735
240 Ga0373927_0001315
241 Ga0373947_0023362
242 Ga0373925_0001060
243 Ga0395900_0495055
244 Ga0436364_0090304
245 Ga0436364_0750664
246 Ga0436364_0853896
247 Ga0436365_1467761
248 Ga0436362_0095467
249 Ga0451798_0307195
250 Ga0451833_0336108
251 Ga0451839_0565306
252 Ga0439463_024257
253 Ga0466969_0003176
254 Ga0466969_0122271
255 Ga0466969_0131437
256 Ga0466972_0021119
257 Ga0466972_0049922
258 Ga0466965_0006686
259 Ga0466965_0056668
260 Ga0466965_0210811
261 Ga0466966_0039098
262 Ga0466966_0212064
263 Ga0466961_0023496
264 Ga0466963_0021811
265 Ga0466963_0040863
266 Ga0466963_0525664
267 Ga0466963_0600343
268 Ga0466971_0009140
269 Ga0466971_0057349
270 Ga0466968_0002053
271 Ga0466970_0002429
272 Ga0466970_0003476
273 Ga0466970_0315426
274 Ga0466957_0013338
275 Ga0466957_0026165
276 Ga0466960_0000682
277 Ga0466959_0004194
278 Ga0466959_0020114
279 Ga0466959_0153318
280 Ga0466958_0012273
281 Ga0466958_0123230
282 Ga0466958_0382309
283 Ga0466967_0271008
284 Ga0495651_0055068
285 Ga0495594_0055140
286 Ga0495620_0048025
287 Ga0495637_0161549
288 Ga0495652_0276694
289 Ga0495645_0279177
290 Ga0495635_0221448
291 Ga0496102_0254207
292 Ga0496102_0362952
293 Ga0496104_0006175
294 Ga0496106_0028508
295 Ga0496108_0023371
296 Ga0496108_0149309
297 Ga0496108_0158401
298 Ga0496109_0129952
299 Ga0496109_0427997
300 Ga0496110_0447383
301 Ga0496110_0741145
302 Ga0496112_0000586
303 Ga0496113_0047142
304 Ga0496113_0376123
305 Ga0496114_0076451
306 Ga0496114_0220153
307 Ga0496114_0365852
308 Ga0496115_0704798
309 Ga0501036_0007535
310 Ga0501037_0153874
311 Ga0501038_0022894
312 Ga0501042_0015858
313 Ga0501043_0152648
314 Ga0501047_0329863
315 Ga0501048_0058503
316 Ga0501035_0010882
317 Ga0501044_0012012
318 Ga0501212_018669
319 nmdc:mga08y16_1028380_c1
320 Ga0495601_0059521
321 Ga0495612_0033933
322 Ga0500588_0197690
323 Ga0466962_0006384
324 Ga0466962_0099146
325 2559426417
326 2586058486
327 2643769758
328 2644033369
329 2644098313
330 2644118960
331 2676479281
332 2738869253
333 2819744425
334 2827629477
335 2861523505
336 2862708451
337 2883823612
338 2904770121
339 2908815074
340 2935410902
341 2974319904
342 2984523775
343 8056447367
344 8057347514

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01243

Putative_PNPOx

Pyridoxamine 5'-phosphate oxidase

67

162

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7kpz-assembly1.cif.gz_A 1.70 a resolution crystal structure of group a streptococcus hupz-v5-his6 0.7863 37 156
7kq2-assembly1.cif.gz_A 1.98 a resolution crystal structure of group a streptococcus h111a hupz-v5-his6 0.7843 38 157
3hy8-assembly1.cif.gz_A-2 crystal structure of human pyridoxine 5'-phosphate oxidase r229w mutant 0.7825 47 127
7kq2-assembly1.cif.gz_A 1.98 a resolution crystal structure of group a streptococcus h111a hupz-v5-his6 0.7671 38 157
1wlk-assembly2.cif.gz_D l122e mutant of fmn-binding protein from desulfovibrio vulgaris (miyazaki f) 0.7655 37 158
ID Description Score Start End Superfamily
5escD00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7761 37 158 2.30.110.10
5escD00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7643 37 158 2.30.110.10
af_Q57730_15_149_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7585 37 155 2.30.110.10
1wliA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7496 37 158 2.30.110.10
1wliA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7388 37 158 2.30.110.10
ID Description Score Start End GO Terms
AF-A0A5J6U793-F1-model_v4 Pyridoxamine 5'-phosphate oxidase family protein 0.9646 4 168
AF-A0A2E2YSW8-F1-model_v4 Phosphohydrolase 0.9628 19 171 GO:0016787
AF-A0A3L7UUE2-F1-model_v4 Pyridoxamine 5'-phosphate oxidase family protein 0.9624 8 171
AF-A0A6B2UNB7-F1-model_v4 Pyridoxamine 5'-phosphate oxidase family protein 0.9612 9 168
AF-A0A6L3UZR0-F1-model_v4 Pyridoxamine 5'-phosphate oxidase family protein 0.9602 10 179

Map