F261368

General Info

Members Datasets Scaffolds Average Seq Length
172 123 156 167

Family's Representative Sequence

Representative Sequence 3300046689|Ga0495613_0159964|Ga0495613_0159964_732_1208
Length 158
Sequence VNLLLTTDTHVPRRARLLPDELLGAIGAADVVFHAGDWVDEATLDLLAARSRRLVAVYGNNDGPALRAGVRFAVVHETGQARGREERCEQLFADTDVLVFGHSHIPWDTTTAGGLRLLNPGSPTDRRRQPDCTYMTAVATAGALTEVVLHRLPRRGGS

Samples

Sample ID Description Type Environment
1 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
2 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
3 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
4 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
5 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
6 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
7 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
8 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
9 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
10 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
11 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
12 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
13 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
14 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
15 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
16 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
17 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
18 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
19 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
22 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
23 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
24 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
25 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
26 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
27 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
28 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
29 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
30 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
31 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
32 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
33 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
34 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
35 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
36 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
37 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
38 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
39 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
40 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
41 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
42 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
43 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
44 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
45 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
46 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
47 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
48 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
49 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
50 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
51 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
52 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
53 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
54 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
55 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
56 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
57 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
58 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
59 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
60 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
61 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
62 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
63 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
64 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
65 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
66 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
67 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
68 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
69 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
70 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
71 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
72 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
73 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
74 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
75 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
76 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
77 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
78 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
79 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
80 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
81 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
82 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
83 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
84 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
85 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
86 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
87 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
89 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
90 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
91 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
99 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
101 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
102 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
103 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
104 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
105 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
106 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
107 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
108 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
109 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
110 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
111 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
112 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
115 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
116 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
117 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
118 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
119 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
120 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
121 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
122 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
123 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 89.53
Metatranscriptomes 1.16
Isolates 9.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.72
Nodule 1.16
Rhizoplane 3.49
Rhizosphere 75.58
Stem 0
Stem Tuber 0
Unclassified 11.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10174740 3300003316 Bacteria 1538
2 JGI25160J50197_1015769 3300003354 Bacteria 2466
3 JGI25160J50197_1053267 3300003354 Bacteria 846
4 Ga0006562J51391_1115978 3300003578 Bacteria 1400
5 Ga0006562J51391_1115979 3300003578 Bacteria 1150
6 Ga0055527_1000023 3300003760 Bacteria 204513
7 Ga0055542_1000023 3300003762 Bacteria 292964
8 Ga0055529_1000180 3300003763 Bacteria 86768
9 Ga0068852_101788479 3300005616 Bacteria 637
10 Ga0105239_10802023 3300010375 Bacteria 1079
11 Ga0157375_10990682 3300013308 Bacteria 981
12 Ga0209672_100064 3300025228 Bacteria 204609
13 Ga0209147_100965 3300025229 Bacteria 12606
14 Ga0209258_101966 3300025242 Bacteria 5965
15 Ga0209148_1000108 3300025254 Bacteria 204609
16 Ga0209233_1029249 3300025261 Bacteria 1312
17 Ga0209455_1000102 3300025272 Bacteria 204609
18 Ga0207426_1000634 3300025302 Bacteria 44548
19 Ga0207426_1005643 3300025302 Bacteria 5661
20 Ga0207426_1006419 3300025302 Bacteria 5124
21 Ga0307517_10035289 3300028786 Bacteria 5666
22 Ga0307515_10002184 3300028794 Bacteria 42959
23 Ga0307512_10387792 3300030522 Bacteria 594
24 Ga0307408_100019197 3300031548 Bacteria 4600
25 Ga0307508_10094152 3300031616 Bacteria 2586
26 Ga0307514_10420792 3300031649 Bacteria 671
27 Ga0307405_10012176 3300031731 Bacteria 4542
28 Ga0307405_10275084 3300031731 Bacteria 1264
29 Ga0307406_10204142 3300031901 Bacteria 1457
30 Ga0307406_10454827 3300031901 Bacteria 1028
31 Ga0307407_10466500 3300031903 Bacteria 919
32 Ga0307412_10007582 3300031911 Bacteria 6160
33 Ga0307412_10034312 3300031911 Bacteria 3233
34 Ga0307416_100254317 3300032002 Bacteria 1712
35 Ga0307415_100501133 3300032126 Bacteria 1062
36 Ga0307507_10028065 3300033179 Bacteria 6010
37 Ga0307510_10243100 3300033180 Bacteria 1292
38 Ga0439438_102623 3300041405 Bacteria 693
39 Ga0451853_1304358 3300041512 Bacteria 3607
40 Ga0439442_038317 3300042002 Bacteria 1005
41 Ga0439442_134535 3300042002 Bacteria 545
42 Ga0439449_0002706 3300042007 Bacteria 6902
43 Ga0439449_0031558 3300042007 Bacteria 1975
44 Ga0439449_0123070 3300042007 Bacteria 963
45 Ga0439457_000009 3300042014 Bacteria 41871
46 Ga0466972_0000654 3300044658 Bacteria 16716
47 Ga0466966_0000780 3300044684 Bacteria 20276
48 Ga0466966_0235468 3300044684 Bacteria 1104
49 Ga0466966_0299817 3300044684 Bacteria 966
50 Ga0466961_0069745 3300044693 Bacteria 2231
51 Ga0466961_0112986 3300044693 Bacteria 1708
52 Ga0466961_0525311 3300044693 Bacteria 714
53 Ga0466970_0009768 3300044765 Bacteria 4858
54 Ga0466970_0045376 3300044765 Bacteria 2340
55 Ga0466957_0086974 3300044842 Bacteria 1954
56 Ga0466958_0103831 3300045836 Bacteria 1770
57 Ga0466967_0004266 3300045976 Bacteria 9607
58 Ga0495592_0124208 3300046454 Bacteria 1812
59 Ga0495629_0008839 3300046459 Bacteria 7405
60 Ga0495629_0061812 3300046459 Bacteria 2617
61 Ga0495651_0307876 3300046462 Bacteria 1060
62 Ga0495662_0004480 3300046476 Bacteria 7010
63 Ga0495662_0113643 3300046476 Bacteria 1327
64 Ga0495664_0505890 3300046477 Bacteria 721
65 Ga0495585_0041629 3300046492 Bacteria 2576
66 Ga0495594_0196174 3300046499 Bacteria 1150
67 Ga0495618_0624380 3300046514 Bacteria 639
68 Ga0495666_0239912 3300046526 Bacteria 827
69 Ga0495652_0435869 3300046529 Bacteria 920
70 Ga0495640_0128237 3300046533 Bacteria 1643
71 Ga0495667_0132489 3300046559 Bacteria 1608
72 Ga0495667_0670987 3300046559 Bacteria 643
73 Ga0495634_0192133 3300046642 Bacteria 1272
74 Ga0495625_0002717 3300046660 Bacteria 18769
75 Ga0495635_0246525 3300046663 Bacteria 1205
76 Ga0495657_0004601 3300046675 Bacteria 11012
77 Ga0495657_0208220 3300046675 Bacteria 1189
78 Ga0495613_0053549 3300046689 Bacteria 2969
79 Ga0495613_0088114 3300046689 Bacteria 2249
80 Ga0495613_0159964 3300046689 Bacteria 1603
81 Ga0495624_0112160 3300046690 Bacteria 1676
82 Ga0495671_0522948 3300046692 Bacteria 565
83 Ga0495600_0181405 3300046809 Bacteria 1357
84 Ga0495581_0104874 3300047315 Bacteria 1643
85 Ga0495581_0521402 3300047315 Bacteria 690
86 Ga0495604_0008271 3300047317 Bacteria 8229
87 Ga0495604_0062446 3300047317 Bacteria 2846
88 Ga0495676_0174870 3300047321 Bacteria 1508
89 Ga0495675_0046416 3300047444 Bacteria 2765
90 Ga0495685_001642 3300047447 Bacteria 6898
91 Ga0495681_0004887 3300047470 Bacteria 9052
92 Ga0496104_0655293 3300048907 Bacteria 959
93 Ga0496104_1558681 3300048907 Bacteria 563
94 Ga0496108_0087975 3300048911 Bacteria 2639
95 Ga0496108_0209844 3300048911 Bacteria 1690
96 Ga0496109_0134301 3300048912 Bacteria 2311
97 Ga0496114_0627635 3300048917 Bacteria 946
98 Ga0496117_0000034 3300048920 Bacteria 328334
99 Ga0501031_0150389 3300049568 Bacteria 1521
100 Ga0501032_0004063 3300049569 Bacteria 11092
101 Ga0501032_0049376 3300049569 Bacteria 2838
102 Ga0501032_0051871 3300049569 Bacteria 2764
103 Ga0501032_0149585 3300049569 Bacteria 1536
104 Ga0501033_0013833 3300049570 Bacteria 6140
105 Ga0501033_0112128 3300049570 Bacteria 1984
106 Ga0501036_0257016 3300049572 Bacteria 1463
107 Ga0501036_0790715 3300049572 Bacteria 781
108 Ga0501037_0209873 3300049573 Bacteria 1374
109 Ga0501038_0231800 3300049574 Bacteria 1469
110 Ga0501038_0236885 3300049574 Bacteria 1450
111 Ga0501038_0319245 3300049574 Bacteria 1215
112 Ga0501038_0819063 3300049574 Bacteria 691
113 Ga0501039_0216360 3300049575 Bacteria 1506
114 Ga0501039_0442600 3300049575 Bacteria 1020
115 Ga0501040_0409195 3300049576 Bacteria 974
116 Ga0501041_0009049 3300049577 Bacteria 5859
117 Ga0501041_0882789 3300049577 Bacteria 574
118 Ga0501042_0013531 3300049578 Bacteria 5556
119 Ga0501042_0395884 3300049578 Bacteria 1000
120 Ga0501043_0097571 3300049579 Bacteria 2310
121 Ga0501043_0157236 3300049579 Bacteria 1777
122 Ga0501047_0000036 3300049581 Bacteria 195504
123 Ga0501047_0009812 3300049581 Bacteria 9046
124 Ga0501047_0089680 3300049581 Bacteria 2952
125 Ga0501047_0629317 3300049581 Bacteria 893
126 Ga0501048_0621592 3300049582 Bacteria 775
127 Ga0501067_0023817 3300049583 Bacteria 3394
128 Ga0501068_0368240 3300049584 Bacteria 924
129 Ga0501069_0040496 3300049585 Bacteria 2575
130 Ga0501070_0044560 3300049586 Bacteria 3691
131 Ga0501071_0012827 3300049587 Bacteria 5698
132 Ga0501072_0392189 3300049588 Bacteria 1101
133 Ga0501073_0031924 3300049589 Bacteria 3757
134 Ga0501074_0036776 3300049590 Bacteria 3546
135 Ga0501075_0200978 3300049591 Bacteria 1520
136 Ga0501076_0039107 3300049592 Bacteria 3724
137 Ga0501077_0033450 3300049593 Bacteria 3272
138 Ga0501079_0061516 3300049741 Bacteria 2896
139 Ga0501035_0048649 3300049822 Bacteria 3802
140 Ga0501035_0086097 3300049822 Bacteria 2769
141 Ga0501035_0099260 3300049822 Bacteria 2556
142 Ga0501035_0541386 3300049822 Bacteria 954
143 Ga0501044_0052832 3300049823 Bacteria 4184
144 Ga0501044_0099310 3300049823 Bacteria 2929
145 Ga0501044_0112498 3300049823 Bacteria 2729
146 Ga0501044_0119769 3300049823 Bacteria 2634
147 Ga0501044_0221263 3300049823 Bacteria 1843
148 Ga0501044_0428094 3300049823 Bacteria 1233
149 Ga0501045_0111154 3300049824 Bacteria 2032
150 Ga0501045_0295793 3300049824 Bacteria 1205
151 Ga0495655_0006653 3300053083 Bacteria 2113
152 Ga0500559_0002209 3300053136 Bacteria 10282
153 Ga0501084_0060885 3300054114 Bacteria 3160
154 Ga0501082_0028775 3300060353 Bacteria 4786
155 Ga0466962_0016101 3300061719 Bacteria 3606
156 Ga0530510_0092005 3300061734 Bacteria 2213

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042002 Ga0439442_134535 Ga0439442_134535_68_508 141
2 3300046689 Ga0495613_0159964 Ga0495613_0159964_732_1208 151
3 iso_pu_bacteria 2784746763 2785339241 153
4 3300003578 Ga0006562J51391_1115978 Ga0006562J51391_11159782 157
5 3300003578 Ga0006562J51391_1115979 Ga0006562J51391_11159792 157
6 3300013308 Ga0157375_10990682 Ga0157375_109906822 157
7 3300028786 Ga0307517_10035289 Ga0307517_100352894 157
8 3300028794 Ga0307515_10002184 Ga0307515_1000218412 157
9 3300030522 Ga0307512_10387792 Ga0307512_103877921 157
10 3300031616 Ga0307508_10094152 Ga0307508_100941521 157
11 3300031649 Ga0307514_10420792 Ga0307514_104207921 157
12 3300033179 Ga0307507_10028065 Ga0307507_100280653 157
13 3300033180 Ga0307510_10243100 Ga0307510_102431001 157
14 3300041512 Ga0451853_1304358 Ga0451853_1304358_1578_2063 157
15 3300042007 Ga0439449_0123070 Ga0439449_0123070_189_677 157
16 3300042014 Ga0439457_000009 Ga0439457_000009_1609_2097 157
17 3300046499 Ga0495594_0196174 Ga0495594_0196174_81_575 157
18 3300046692 Ga0495671_0522948 Ga0495671_0522948_44_538 157
19 3300047315 Ga0495581_0104874 Ga0495581_0104874_281_775 157
20 3300047447 Ga0495685_001642 Ga0495685_001642_172_666 157
21 3300048907 Ga0496104_1558681 Ga0496104_1558681_11_502 157
22 3300048911 Ga0496108_0087975 Ga0496108_0087975_319_810 157
23 3300049574 Ga0501038_0819063 Ga0501038_0819063_160_648 157
24 3300049822 Ga0501035_0086097 Ga0501035_0086097_484_969 157
25 3300003760 Ga0055527_1000023 Ga0055527_100002354 158
26 3300003762 Ga0055542_1000023 Ga0055542_1000023224 158
27 3300003763 Ga0055529_1000180 Ga0055529_100018026 158
28 3300025228 Ga0209672_100064 Ga0209672_10006455 158
29 3300025229 Ga0209147_100965 Ga0209147_10096513 158
30 3300025242 Ga0209258_101966 Ga0209258_1019662 158
31 3300025254 Ga0209148_1000108 Ga0209148_100010855 158
32 3300025261 Ga0209233_1029249 Ga0209233_10292492 158
33 3300025272 Ga0209455_1000102 Ga0209455_1000102134 158
34 iso_pu_bacteria 2862382967 2862391154 158
35 iso_pu_bacteria 2863067949 2863075654 158
36 iso_pu_bacteria 2863404153 2863410701 158
37 iso_pu_bacteria 2869068681 2869073242 158
38 iso_pu_bacteria 2966598605 2966599121 158
39 iso_pu_bacteria 2997451912 2997453551 158
40 iso_pu_bacteria 3006321560 3006327879 158
41 iso_pu_bacteria 8008558824 8008564740 158
42 iso_pu_bacteria 8048406513 8048412489 158
43 iso_pu_bacteria 2844852863 2844853519 160
44 iso_pu_bacteria 2852663356 2852664479 160
45 iso_pu_bacteria 2919391150 2919393844 160
46 iso_pu_bacteria 2953998280 2954000024 160
47 iso_pu_bacteria 8004182704 8004183742 160
48 3300003354 JGI25160J50197_1015769 JGI25160J50197_10157693 161
49 3300025302 Ga0207426_1006419 Ga0207426_10064194 161
50 3300049591 Ga0501075_0200978 Ga0501075_0200978_644_1144 161
51 3300049824 Ga0501045_0111154 Ga0501045_0111154_1449_1949 161
52 3300003354 JGI25160J50197_1053267 JGI25160J50197_10532672 162
53 3300005616 Ga0068852_101788479 Ga0068852_1017884791 162
54 3300025302 Ga0207426_1000634 Ga0207426_100063415 162
55 3300025302 Ga0207426_1005643 Ga0207426_10056433 162
56 3300032126 Ga0307415_100501133 Ga0307415_1005011331 162
57 3300042002 Ga0439442_038317 Ga0439442_038317_467_958 162
58 3300044658 Ga0466972_0000654 Ga0466972_0000654_2944_3459 162
59 3300044684 Ga0466966_0000780 Ga0466966_0000780_7120_7635 162
60 3300044693 Ga0466961_0069745 Ga0466961_0069745_1365_1880 162
61 3300044765 Ga0466970_0009768 Ga0466970_0009768_1022_1510 162
62 3300044842 Ga0466957_0086974 Ga0466957_0086974_1099_1587 162
63 3300045836 Ga0466958_0103831 Ga0466958_0103831_910_1398 162
64 3300046454 Ga0495592_0124208 Ga0495592_0124208_64_576 162
65 3300046459 Ga0495629_0008839 Ga0495629_0008839_1117_1617 162
66 3300046459 Ga0495629_0061812 Ga0495629_0061812_158_670 162
67 3300046462 Ga0495651_0307876 Ga0495651_0307876_385_897 162
68 3300046476 Ga0495662_0004480 Ga0495662_0004480_5378_5887 162
69 3300046476 Ga0495662_0113643 Ga0495662_0113643_550_1053 162
70 3300046477 Ga0495664_0505890 Ga0495664_0505890_189_701 162
71 3300046492 Ga0495585_0041629 Ga0495585_0041629_1791_2300 162
72 3300046514 Ga0495618_0624380 Ga0495618_0624380_100_612 162
73 3300046526 Ga0495666_0239912 Ga0495666_0239912_103_612 162
74 3300046529 Ga0495652_0435869 Ga0495652_0435869_172_684 162
75 3300046533 Ga0495640_0128237 Ga0495640_0128237_800_1309 162
76 3300046559 Ga0495667_0132489 Ga0495667_0132489_85_588 162
77 3300046559 Ga0495667_0670987 Ga0495667_0670987_51_560 162
78 3300046642 Ga0495634_0192133 Ga0495634_0192133_154_666 162
79 3300046660 Ga0495625_0002717 Ga0495625_0002717_10089_10589 162
80 3300046663 Ga0495635_0246525 Ga0495635_0246525_163_672 162
81 3300046675 Ga0495657_0004601 Ga0495657_0004601_302_811 162
82 3300046675 Ga0495657_0208220 Ga0495657_0208220_169_681 162
83 3300046689 Ga0495613_0053549 Ga0495613_0053549_1329_1838 162
84 3300046689 Ga0495613_0088114 Ga0495613_0088114_107_619 162
85 3300046690 Ga0495624_0112160 Ga0495624_0112160_1147_1659 162
86 3300046809 Ga0495600_0181405 Ga0495600_0181405_737_1240 162
87 3300047315 Ga0495581_0521402 Ga0495581_0521402_96_596 162
88 3300047317 Ga0495604_0008271 Ga0495604_0008271_7210_7713 162
89 3300047317 Ga0495604_0062446 Ga0495604_0062446_1983_2492 162
90 3300047321 Ga0495676_0174870 Ga0495676_0174870_868_1380 162
91 3300047444 Ga0495675_0046416 Ga0495675_0046416_1253_1756 162
92 3300047470 Ga0495681_0004887 Ga0495681_0004887_3376_3876 162
93 3300049568 Ga0501031_0150389 Ga0501031_0150389_317_820 162
94 3300049569 Ga0501032_0049376 Ga0501032_0049376_692_1192 162
95 3300049569 Ga0501032_0051871 Ga0501032_0051871_147_656 162
96 3300049569 Ga0501032_0149585 Ga0501032_0149585_139_642 162
97 3300049570 Ga0501033_0013833 Ga0501033_0013833_3631_4134 162
98 3300049570 Ga0501033_0112128 Ga0501033_0112128_963_1463 162
99 3300049572 Ga0501036_0257016 Ga0501036_0257016_269_769 162
100 3300049572 Ga0501036_0790715 Ga0501036_0790715_56_559 162
101 3300049573 Ga0501037_0209873 Ga0501037_0209873_791_1306 162
102 3300049574 Ga0501038_0231800 Ga0501038_0231800_425_925 162
103 3300049574 Ga0501038_0236885 Ga0501038_0236885_104_607 162
104 3300049575 Ga0501039_0216360 Ga0501039_0216360_584_1084 162
105 3300049576 Ga0501040_0409195 Ga0501040_0409195_198_707 162
106 3300049577 Ga0501041_0009049 Ga0501041_0009049_311_820 162
107 3300049578 Ga0501042_0395884 Ga0501042_0395884_198_707 162
108 3300049579 Ga0501043_0097571 Ga0501043_0097571_902_1402 162
109 3300049581 Ga0501047_0009812 Ga0501047_0009812_5136_5645 162
110 3300049581 Ga0501047_0089680 Ga0501047_0089680_136_639 162
111 3300049581 Ga0501047_0629317 Ga0501047_0629317_269_784 162
112 3300049582 Ga0501048_0621592 Ga0501048_0621592_69_578 162
113 3300049583 Ga0501067_0023817 Ga0501067_0023817_723_1232 162
114 3300049584 Ga0501068_0368240 Ga0501068_0368240_104_613 162
115 3300049585 Ga0501069_0040496 Ga0501069_0040496_928_1437 162
116 3300049586 Ga0501070_0044560 Ga0501070_0044560_299_796 162
117 3300049587 Ga0501071_0012827 Ga0501071_0012827_4192_4701 162
118 3300049588 Ga0501072_0392189 Ga0501072_0392189_442_951 162
119 3300049589 Ga0501073_0031924 Ga0501073_0031924_861_1370 162
120 3300049590 Ga0501074_0036776 Ga0501074_0036776_655_1164 162
121 3300049592 Ga0501076_0039107 Ga0501076_0039107_118_627 162
122 3300049593 Ga0501077_0033450 Ga0501077_0033450_2041_2550 162
123 3300049741 Ga0501079_0061516 Ga0501079_0061516_1734_2243 162
124 3300049822 Ga0501035_0048649 Ga0501035_0048649_1197_1697 162
125 3300049822 Ga0501035_0099260 Ga0501035_0099260_551_1081 162
126 3300049822 Ga0501035_0541386 Ga0501035_0541386_203_712 162
127 3300049823 Ga0501044_0099310 Ga0501044_0099310_312_821 162
128 3300049823 Ga0501044_0112498 Ga0501044_0112498_1000_1500 162
129 3300049823 Ga0501044_0221263 Ga0501044_0221263_376_906 162
130 3300049824 Ga0501045_0295793 Ga0501045_0295793_296_799 162
131 3300053083 Ga0495655_0006653 Ga0495655_0006653_177_677 162
132 3300054114 Ga0501084_0060885 Ga0501084_0060885_202_711 162
133 3300060353 Ga0501082_0028775 Ga0501082_0028775_2153_2662 162
134 3300061719 Ga0466962_0016101 Ga0466962_0016101_2354_2869 162
135 3300061734 Ga0530510_0092005 Ga0530510_0092005_1081_1590 162
136 3300048907 Ga0496104_0655293 Ga0496104_0655293_372_923 163
137 3300048917 Ga0496114_0627635 Ga0496114_0627635_168_719 163
138 3300049577 Ga0501041_0882789 Ga0501041_0882789_17_523 163
139 3300003316 rootH1_10174740 rootH1_101747402 164
140 3300010375 Ga0105239_10802023 Ga0105239_108020231 164
141 3300031548 Ga0307408_100019197 Ga0307408_1000191976 164
142 3300031731 Ga0307405_10012176 Ga0307405_100121764 164
143 3300031731 Ga0307405_10275084 Ga0307405_102750842 164
144 3300031901 Ga0307406_10204142 Ga0307406_102041422 164
145 3300031901 Ga0307406_10454827 Ga0307406_104548272 164
146 3300031903 Ga0307407_10466500 Ga0307407_104665002 164
147 3300031911 Ga0307412_10007582 Ga0307412_100075827 164
148 3300031911 Ga0307412_10034312 Ga0307412_100343124 164
149 3300032002 Ga0307416_100254317 Ga0307416_1002543173 164
150 3300041405 Ga0439438_102623 Ga0439438_102623_99_608 164
151 3300042007 Ga0439449_0002706 Ga0439449_0002706_3417_3926 164
152 3300042007 Ga0439449_0031558 Ga0439449_0031558_1218_1730 164
153 3300044684 Ga0466966_0235468 Ga0466966_0235468_339_833 164
154 3300044684 Ga0466966_0299817 Ga0466966_0299817_156_650 164
155 3300044693 Ga0466961_0112986 Ga0466961_0112986_20_532 164
156 3300044693 Ga0466961_0525311 Ga0466961_0525311_17_511 164
157 3300044765 Ga0466970_0045376 Ga0466970_0045376_1385_1897 164
158 3300045976 Ga0466967_0004266 Ga0466967_0004266_8827_9354 164
159 3300048911 Ga0496108_0209844 Ga0496108_0209844_877_1395 164
160 3300048912 Ga0496109_0134301 Ga0496109_0134301_1226_1744 164
161 3300048920 Ga0496117_0000034 Ga0496117_0000034_184531_185073 164
162 3300049569 Ga0501032_0004063 Ga0501032_0004063_5726_6229 164
163 3300049574 Ga0501038_0319245 Ga0501038_0319245_222_725 164
164 3300049575 Ga0501039_0442600 Ga0501039_0442600_319_822 164
165 3300049578 Ga0501042_0013531 Ga0501042_0013531_1222_1731 164
166 3300049579 Ga0501043_0157236 Ga0501043_0157236_465_968 164
167 3300049581 Ga0501047_0000036 Ga0501047_0000036_61564_62073 164
168 3300049823 Ga0501044_0052832 Ga0501044_0052832_2484_2993 164
169 3300049823 Ga0501044_0119769 Ga0501044_0119769_977_1480 164
170 3300049823 Ga0501044_0428094 Ga0501044_0428094_599_1192 164
171 3300053136 Ga0500559_0002209 Ga0500559_0002209_2004_2507 164
172 iso_pu_bacteria 2775506925 2776375368 164

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12850

Metallophos_2

Calcineurin-like phosphoesterase superfamily domain

1

142

0.89

PF00149

Metallophos

Calcineurin-like phosphoesterase

1

86

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
2kkn-assembly1.cif.gz_A solution nmr structure of themotoga maritima protein tm1076: northeast structural genomics consortium target vt57 0.8115 3 164
6xs5-assembly1.cif.gz_A crystal structure of human vps29 complexed with rapid-derived cyclic peptide rt-d1 0.8108 1 162
2a22-assembly1.cif.gz_A structure of vacuolar protein sorting 29 from cryptosporidium parvum 0.806 2 164
2kkn-assembly1.cif.gz_A solution nmr structure of themotoga maritima protein tm1076: northeast structural genomics consortium target vt57 0.8026 3 164
5w8m-assembly4.cif.gz_D error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8005 3 164
ID Description Score Start End Superfamily
af_A0A0N7KQF8_53_371_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8659 146 162 2.130.10.10
af_Q58040_34_189_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8272 3 162 3.60.21.10
af_A4I7S2_2_176_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8224 3 164 3.60.21.10
af_Q58040_34_189_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8176 3 162 3.60.21.10
2kknA00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8115 3 164 3.60.21.10
ID Description Score Start End GO Terms
AF-A0A7V9K7U7-F1-model_v4 Phosphoesterase (EC 3.1.4.-) 0.9802 25 164 GO:0016787
GO:0046872
AF-A0A4R7FT06-F1-model_v4 Phosphoesterase (EC 3.1.4.-) 0.9797 1 164 GO:0016787
GO:0046872
AF-A0A561SZ51-F1-model_v4 Phosphoesterase (EC 3.1.4.-) 0.9777 17 164 GO:0016787
GO:0046872
AF-A0A3A1TXH7-F1-model_v4 Phosphoesterase (EC 3.1.4.-) 0.9771 1 164 GO:0016787
GO:0046872
AF-A0A7X5ZFR9-F1-model_v4 Putative phosphoesterase 0.9761 59 164

Feature Viewer

pLDDT pTM Quality
92.4 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map