F261023
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 172 | 140 | 344 | 159 |
Family's Representative Sequence
| Representative Sequence | 3300031911|Ga0307412_10724697|Ga0307412_107246972 |
| Length | 173 |
| Sequence | VSQELVLIYARAANGVIGREGHLPWHLPADLRRFKAMTMGKAMIMGRRTFESFPGPLPGRRHIVLTRDPAWQAEGAEVVHSVDEALARAGEGEVAVIGGAQIYALLRDRAARVELTEIHADYDGDTVMPPLGPEWREVAREEHPAEGGRPAHAFVTLSRLSPSRLREGSGEGM |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 2 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 3 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 9 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 10 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 11 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 12 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 13 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 14 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 15 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 16 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 17 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 18 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 19 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 20 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 21 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 22 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 23 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 24 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 25 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 26 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 27 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 28 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 29 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 30 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 31 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 32 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 33 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 34 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 35 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 36 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 37 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 39 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 40 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 41 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 42 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 43 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 44 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 45 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 46 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 47 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 48 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 49 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 50 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 51 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 52 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 53 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 54 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 55 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 56 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 57 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 58 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 59 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 60 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 61 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 62 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 63 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 64 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 65 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 66 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 67 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 68 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 69 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 70 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 71 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 72 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 73 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 74 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 75 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 76 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 77 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 78 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 79 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 80 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 81 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 82 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 83 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 84 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 85 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 86 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 87 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 88 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 89 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 90 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 91 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 92 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 93 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 94 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 95 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 96 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 97 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 98 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 99 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 100 | 3300049771 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control | Metagenome | Rhizosphere |
| 101 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 102 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 103 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 104 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 105 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 106 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 107 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 108 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 109 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 110 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 111 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 112 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 113 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 114 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 115 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 116 | 3300053132 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 endosphere | Metagenome | Endosphere |
| 117 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 118 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 119 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 120 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 121 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 122 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 123 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 124 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 125 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 126 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 127 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 128 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 129 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 130 | 2643221588 | Altererythrobacter sp. Root672 | Isolate | Unclassified |
| 131 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 132 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
| 133 | 2882806704 | Pelagerythrobacter rhizovicinus AY-3R | Isolate | Rhizosphere |
| 134 | 2885429604 | Sphingomonas sp. WZY 27 | Isolate | Rhizosphere |
| 135 | 2928027323 | Sphingomonas sp. 1185 | Isolate | Unclassified |
| 136 | 2984555340 | Sphingomonas sp. SORGH_AS789 | Isolate | Aerial Root |
| 137 | 2984564862 | Sphingomonas sp. SORGH_AS870 | Isolate | Aerial Root |
| 138 | 2993356040 | Sphingomonas sp. SORGH_AS742 | Isolate | Aerial Root |
| 139 | 8054302542 | Novosphingobium kaempferiae Sx8-5 | Isolate | Rhizosphere |
| 140 | 8057101203 | Sphingomonas lycopersici MMSM20 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.6 |
| Metatranscriptomes | 0 |
| Isolates | 6.4 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 1.74 |
| Bulb | 0 |
| Endosphere | 16.86 |
| Nodule | 1.16 |
| Rhizoplane | 3.49 |
| Rhizosphere | 60.47 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0307412_10724697 | 3300031911 | Bacteria | 856 |
| 2 | JGI24751J29686_10049731 | 3300002459 | Bacteria | 864 |
| 3 | Ga0070670_100002057 | 3300005331 | Bacteria | 16470 |
| 4 | Ga0070668_100000030 | 3300005347 | Bacteria | 87912 |
| 5 | Ga0070669_100030539 | 3300005353 | Bacteria | 3889 |
| 6 | Ga0070669_100241153 | 3300005353 | Bacteria | 1436 |
| 7 | Ga0070671_100000125 | 3300005355 | Bacteria | 49771 |
| 8 | Ga0070667_100000071 | 3300005367 | Bacteria | 125713 |
| 9 | Ga0068853_101076744 | 3300005539 | Bacteria | 775 |
| 10 | Ga0068852_100622964 | 3300005616 | Bacteria | 1085 |
| 11 | Ga0068859_100046028 | 3300005617 | Bacteria | 4383 |
| 12 | Ga0068864_100003212 | 3300005618 | Bacteria | 13494 |
| 13 | Ga0068863_100000081 | 3300005841 | Bacteria | 106186 |
| 14 | Ga0068863_100109945 | 3300005841 | Bacteria | 2624 |
| 15 | Ga0068858_100069155 | 3300005842 | Bacteria | 3273 |
| 16 | Ga0068858_100104886 | 3300005842 | Bacteria | 2638 |
| 17 | Ga0068860_100000049 | 3300005843 | Bacteria | 208782 |
| 18 | Ga0068860_100000426 | 3300005843 | Bacteria | 53853 |
| 19 | Ga0068862_100002193 | 3300005844 | Bacteria | 17520 |
| 20 | Ga0068862_100022946 | 3300005844 | Bacteria | 5225 |
| 21 | Ga0068862_100128910 | 3300005844 | Bacteria | 2236 |
| 22 | Ga0075370_10113397 | 3300006353 | Bacteria | 1575 |
| 23 | Ga0097620_100046028 | 3300006931 | Bacteria | 4383 |
| 24 | Ga0079104_1019939 | 3300006946 | Bacteria | 1860 |
| 25 | Ga0105248_10875246 | 3300009177 | Bacteria | 1014 |
| 26 | Ga0157378_10027679 | 3300013297 | Bacteria | 5000 |
| 27 | Ga0213876_10005545 | 3300021384 | Bacteria | 6928 |
| 28 | Ga0213875_10000307 | 3300021388 | Bacteria | 46789 |
| 29 | Ga0207680_10081374 | 3300025903 | Bacteria | 2036 |
| 30 | Ga0207681_10343811 | 3300025923 | Bacteria | 1192 |
| 31 | Ga0207681_10492035 | 3300025923 | Bacteria | 1003 |
| 32 | Ga0207650_10020435 | 3300025925 | Bacteria | 4670 |
| 33 | Ga0207644_10000804 | 3300025931 | Bacteria | 19896 |
| 34 | Ga0207712_11379502 | 3300025961 | Bacteria | 630 |
| 35 | Ga0207668_10000011 | 3300025972 | Bacteria | 184484 |
| 36 | Ga0207658_10000014 | 3300025986 | Bacteria | 218248 |
| 37 | Ga0207658_10005955 | 3300025986 | Bacteria | 8328 |
| 38 | Ga0207703_10057095 | 3300026035 | Bacteria | 3182 |
| 39 | Ga0207703_10078625 | 3300026035 | Bacteria | 2741 |
| 40 | Ga0207641_10000182 | 3300026088 | Bacteria | 87316 |
| 41 | Ga0207641_10000292 | 3300026088 | Bacteria | 62689 |
| 42 | Ga0207641_10024253 | 3300026088 | Bacteria | 5000 |
| 43 | Ga0207676_10002466 | 3300026095 | Bacteria | 13199 |
| 44 | Ga0207675_100033198 | 3300026118 | Bacteria | 4810 |
| 45 | Ga0207698_10072380 | 3300026142 | Bacteria | 2740 |
| 46 | Ga0209281_1008837 | 3300027111 | Bacteria | 2409 |
| 47 | Ga0268265_10004499 | 3300028380 | Bacteria | 9648 |
| 48 | Ga0268265_10112068 | 3300028380 | Bacteria | 2229 |
| 49 | Ga0268265_10167838 | 3300028380 | Bacteria | 1872 |
| 50 | Ga0268264_10000121 | 3300028381 | Bacteria | 190368 |
| 51 | Ga0268264_10000126 | 3300028381 | Bacteria | 186138 |
| 52 | Ga0307517_10012498 | 3300028786 | Bacteria | 11641 |
| 53 | Ga0307508_10018370 | 3300031616 | Bacteria | 6357 |
| 54 | Ga0316576_10770598 | 3300031727 | Bacteria | 694 |
| 55 | Ga0307412_10246546 | 3300031911 | Bacteria | 1385 |
| 56 | Ga0307411_10041879 | 3300032005 | Bacteria | 2918 |
| 57 | Ga0316583_10005349 | 3300032133 | Bacteria | 4605 |
| 58 | Ga0316582_0505713 | 3300036647 | Bacteria | 833 |
| 59 | Ga0436364_0822555 | 3300037853 | Bacteria | 215682 |
| 60 | Ga0436365_0091094 | 3300039437 | Bacteria | 2621 |
| 61 | Ga0436365_0618881 | 3300039437 | Bacteria | 4924 |
| 62 | Ga0436363_1139245 | 3300039450 | Bacteria | 1492 |
| 63 | Ga0439461_0000109 | 3300041410 | Bacteria | 10967 |
| 64 | Ga0439465_0008127 | 3300041413 | Bacteria | 3312 |
| 65 | Ga0451853_2699784 | 3300041512 | Bacteria | 561 |
| 66 | Ga0439431_0000015 | 3300041997 | Bacteria | 27396 |
| 67 | Ga0439442_001321 | 3300042002 | Bacteria | 4930 |
| 68 | Ga0439445_0000519 | 3300042004 | Bacteria | 7769 |
| 69 | Ga0439432_000732 | 3300042006 | Bacteria | 12290 |
| 70 | Ga0439452_022571 | 3300042010 | Bacteria | 1627 |
| 71 | Ga0439462_0002602 | 3300042015 | Bacteria | 4216 |
| 72 | Ga0439462_0045548 | 3300042015 | Bacteria | 1175 |
| 73 | Ga0450909_005375 | 3300042185 | Bacteria | 1843 |
| 74 | Ga0439434_0005986 | 3300042435 | Bacteria | 3548 |
| 75 | Ga0495627_000430 | 3300046453 | Bacteria | 36446 |
| 76 | Ga0495650_0000366 | 3300046471 | Bacteria | 79144 |
| 77 | Ga0495610_0000050 | 3300046512 | Bacteria | 143781 |
| 78 | Ga0495616_0048797 | 3300046513 | Bacteria | 2125 |
| 79 | Ga0495632_0018268 | 3300046519 | Bacteria | 3851 |
| 80 | Ga0495648_0064726 | 3300046524 | Bacteria | 2153 |
| 81 | Ga0495663_0241805 | 3300046525 | Bacteria | 639 |
| 82 | Ga0495654_0040306 | 3300046530 | Bacteria | 2328 |
| 83 | Ga0495625_0387934 | 3300046660 | Bacteria | 875 |
| 84 | Ga0495671_0034550 | 3300046692 | Bacteria | 2570 |
| 85 | Ga0495649_0182371 | 3300046694 | Bacteria | 1095 |
| 86 | Ga0495649_0245366 | 3300046694 | Bacteria | 921 |
| 87 | Ga0495683_0360007 | 3300047323 | Bacteria | 612 |
| 88 | Ga0495687_001123 | 3300047443 | Bacteria | 26001 |
| 89 | Ga0495681_0000089 | 3300047470 | Bacteria | 79789 |
| 90 | Ga0495615_0000130 | 3300048090 | Bacteria | 18969 |
| 91 | Ga0496102_0000243 | 3300048905 | Bacteria | 71427 |
| 92 | Ga0496102_0602446 | 3300048905 | Bacteria | 1022 |
| 93 | Ga0496103_0008780 | 3300048906 | Bacteria | 5995 |
| 94 | Ga0496103_0065710 | 3300048906 | Bacteria | 2263 |
| 95 | Ga0496104_0012715 | 3300048907 | Bacteria | 7582 |
| 96 | Ga0496105_0012633 | 3300048908 | Bacteria | 6687 |
| 97 | Ga0496116_0001506 | 3300048919 | Bacteria | 25932 |
| 98 | Ga0496117_0000179 | 3300048920 | Bacteria | 130966 |
| 99 | Ga0496117_0151976 | 3300048920 | Bacteria | 1369 |
| 100 | Ga0496117_0500208 | 3300048920 | Bacteria | 589 |
| 101 | Ga0496118_0000030 | 3300048921 | Bacteria | 339946 |
| 102 | Ga0496118_0074128 | 3300048921 | Bacteria | 2434 |
| 103 | Ga0496119_0070212 | 3300048922 | Bacteria | 2055 |
| 104 | Ga0496120_0081571 | 3300048923 | Bacteria | 1750 |
| 105 | Ga0496121_0000723 | 3300048924 | Bacteria | 61128 |
| 106 | Ga0496121_0248873 | 3300048924 | Bacteria | 1234 |
| 107 | Ga0496121_0335072 | 3300048924 | Bacteria | 1013 |
| 108 | Ga0496122_0031488 | 3300048925 | Bacteria | 4412 |
| 109 | Ga0496123_0000830 | 3300048926 | Bacteria | 49505 |
| 110 | Ga0496124_0000264 | 3300048927 | Bacteria | 101377 |
| 111 | Ga0496124_0041460 | 3300048927 | Bacteria | 3972 |
| 112 | Ga0495682_0041914 | 3300049460 | Bacteria | 1678 |
| 113 | Ga0501292_000055 | 3300049515 | Bacteria | 22864 |
| 114 | Ga0501036_0049530 | 3300049572 | Bacteria | 3557 |
| 115 | Ga0501039_0334933 | 3300049575 | Bacteria | 1189 |
| 116 | Ga0501043_0178165 | 3300049579 | Bacteria | 1657 |
| 117 | Ga0501043_0194326 | 3300049579 | Bacteria | 1577 |
| 118 | Ga0501047_0033755 | 3300049581 | Bacteria | 4939 |
| 119 | Ga0501206_000209 | 3300049653 | Bacteria | 6770 |
| 120 | Ga0501222_002304 | 3300049662 | Bacteria | 2650 |
| 121 | Ga0501223_004348 | 3300049663 | Bacteria | 3038 |
| 122 | Ga0501227_002086 | 3300049665 | Bacteria | 4432 |
| 123 | Ga0501235_011174 | 3300049669 | Bacteria | 1966 |
| 124 | Ga0501257_042802 | 3300049686 | Bacteria | 1115 |
| 125 | Ga0501261_000226 | 3300049690 | Bacteria | 7743 |
| 126 | Ga0501225_0001514 | 3300049705 | Bacteria | 7297 |
| 127 | Ga0501274_032256 | 3300049771 | Bacteria | 597 |
| 128 | Ga0501279_000012 | 3300049775 | Bacteria | 80359 |
| 129 | Ga0501280_000005 | 3300049776 | Bacteria | 85174 |
| 130 | Ga0501281_00339 | 3300049777 | Bacteria | 4814 |
| 131 | Ga0501282_000010 | 3300049778 | Bacteria | 31798 |
| 132 | Ga0501283_020896 | 3300049779 | Bacteria | 1046 |
| 133 | Ga0501035_0025708 | 3300049822 | Bacteria | 5396 |
| 134 | nmdc:mga07m45_348_c1 | 3300050496 | Bacteria | 18873 |
| 135 | Ga0500643_000151 | 3300053087 | Bacteria | 70674 |
| 136 | Ga0500646_0121193 | 3300053090 | Bacteria | 841 |
| 137 | Ga0500647_0259857 | 3300053091 | Bacteria | 759 |
| 138 | Ga0500592_000124 | 3300053116 | Bacteria | 16659 |
| 139 | Ga0500594_0041779 | 3300053118 | Bacteria | 1257 |
| 140 | Ga0500594_0064960 | 3300053118 | Bacteria | 1060 |
| 141 | Ga0500608_000160 | 3300053122 | Bacteria | 28018 |
| 142 | Ga0500614_017056 | 3300053123 | Bacteria | 1637 |
| 143 | Ga0500618_006224 | 3300053125 | Bacteria | 3525 |
| 144 | Ga0500653_165447 | 3300053132 | Bacteria | 586 |
| 145 | Ga0500658_0105050 | 3300053134 | Bacteria | 1237 |
| 146 | Ga0500564_018596 | 3300053138 | Bacteria | 3170 |
| 147 | Ga0500564_197966 | 3300053138 | Bacteria | 827 |
| 148 | Ga0500573_0013794 | 3300053140 | Bacteria | 4561 |
| 149 | Ga0500573_0063451 | 3300053140 | Bacteria | 2114 |
| 150 | Ga0500604_0000002 | 3300053151 | Bacteria | 165603 |
| 151 | Ga0500604_0218960 | 3300053151 | Bacteria | 656 |
| 152 | Ga0500622_0141336 | 3300053156 | Bacteria | 1147 |
| 153 | Ga0500627_0007275 | 3300053158 | Bacteria | 3841 |
| 154 | Ga0500627_0389695 | 3300053158 | Bacteria | 595 |
| 155 | Ga0500630_107332 | 3300053159 | Bacteria | 1261 |
| 156 | Ga0500636_0423787 | 3300053177 | Bacteria | 610 |
| 157 | Ga0500567_003171 | 3300053723 | Bacteria | 7263 |
| 158 | Ga0500625_000025 | 3300053729 | Bacteria | 63535 |
| 159 | Ga0500645_023739 | 3300053730 | Bacteria | 1879 |
| 160 | Ga0500596_009034 | 3300053735 | Bacteria | 1568 |
| 161 | Ga0500661_012067 | 3300055283 | Bacteria | 1562 |
| 162 | 2643951008 | 2643221588 | Bacteria | 3692460 |
| 163 | 2644043046 | 2643221606 | Bacteria | 5588032 |
| 164 | 2644395523 | 2643221671 | Bacteria | 5496681 |
| 165 | 2882809376 | 2882806704 | Bacteria | 3007728 |
| 166 | 2885431464 | 2885429604 | Bacteria | 3642894 |
| 167 | 2928030982 | 2928027323 | Bacteria | 4382488 |
| 168 | 2984556134 | 2984555340 | Bacteria | 4247089 |
| 169 | 2984565758 | 2984564862 | Bacteria | 4339992 |
| 170 | 2993356769 | 2993356040 | Bacteria | 4247105 |
| 171 | 8054303975 | 8054302542 | Bacteria | 5698134 |
| 172 | 8057105664 | 8057101203 | Bacteria | 5034064 |
| 173 | Ga0307412_10724697 | |||
| 174 | JGI24751J29686_10049731 | |||
| 175 | Ga0070670_100002057 | |||
| 176 | Ga0070668_100000030 | |||
| 177 | Ga0070669_100030539 | |||
| 178 | Ga0070669_100241153 | |||
| 179 | Ga0070671_100000125 | |||
| 180 | Ga0070667_100000071 | |||
| 181 | Ga0068853_101076744 | |||
| 182 | Ga0068852_100622964 | |||
| 183 | Ga0068859_100046028 | |||
| 184 | Ga0068864_100003212 | |||
| 185 | Ga0068863_100000081 | |||
| 186 | Ga0068863_100109945 | |||
| 187 | Ga0068858_100069155 | |||
| 188 | Ga0068858_100104886 | |||
| 189 | Ga0068860_100000049 | |||
| 190 | Ga0068860_100000426 | |||
| 191 | Ga0068862_100002193 | |||
| 192 | Ga0068862_100022946 | |||
| 193 | Ga0068862_100128910 | |||
| 194 | Ga0075370_10113397 | |||
| 195 | Ga0097620_100046028 | |||
| 196 | Ga0079104_1019939 | |||
| 197 | Ga0105248_10875246 | |||
| 198 | Ga0157378_10027679 | |||
| 199 | Ga0213876_10005545 | |||
| 200 | Ga0213875_10000307 | |||
| 201 | Ga0207680_10081374 | |||
| 202 | Ga0207681_10343811 | |||
| 203 | Ga0207681_10492035 | |||
| 204 | Ga0207650_10020435 | |||
| 205 | Ga0207644_10000804 | |||
| 206 | Ga0207712_11379502 | |||
| 207 | Ga0207668_10000011 | |||
| 208 | Ga0207658_10000014 | |||
| 209 | Ga0207658_10005955 | |||
| 210 | Ga0207703_10057095 | |||
| 211 | Ga0207703_10078625 | |||
| 212 | Ga0207641_10000182 | |||
| 213 | Ga0207641_10000292 | |||
| 214 | Ga0207641_10024253 | |||
| 215 | Ga0207676_10002466 | |||
| 216 | Ga0207675_100033198 | |||
| 217 | Ga0207698_10072380 | |||
| 218 | Ga0209281_1008837 | |||
| 219 | Ga0268265_10004499 | |||
| 220 | Ga0268265_10112068 | |||
| 221 | Ga0268265_10167838 | |||
| 222 | Ga0268264_10000121 | |||
| 223 | Ga0268264_10000126 | |||
| 224 | Ga0307517_10012498 | |||
| 225 | Ga0307508_10018370 | |||
| 226 | Ga0316576_10770598 | |||
| 227 | Ga0307412_10246546 | |||
| 228 | Ga0307411_10041879 | |||
| 229 | Ga0316583_10005349 | |||
| 230 | Ga0316582_0505713 | |||
| 231 | Ga0436364_0822555 | |||
| 232 | Ga0436365_0091094 | |||
| 233 | Ga0436365_0618881 | |||
| 234 | Ga0436363_1139245 | |||
| 235 | Ga0439461_0000109 | |||
| 236 | Ga0439465_0008127 | |||
| 237 | Ga0451853_2699784 | |||
| 238 | Ga0439431_0000015 | |||
| 239 | Ga0439442_001321 | |||
| 240 | Ga0439445_0000519 | |||
| 241 | Ga0439432_000732 | |||
| 242 | Ga0439452_022571 | |||
| 243 | Ga0439462_0002602 | |||
| 244 | Ga0439462_0045548 | |||
| 245 | Ga0450909_005375 | |||
| 246 | Ga0439434_0005986 | |||
| 247 | Ga0495627_000430 | |||
| 248 | Ga0495650_0000366 | |||
| 249 | Ga0495610_0000050 | |||
| 250 | Ga0495616_0048797 | |||
| 251 | Ga0495632_0018268 | |||
| 252 | Ga0495648_0064726 | |||
| 253 | Ga0495663_0241805 | |||
| 254 | Ga0495654_0040306 | |||
| 255 | Ga0495625_0387934 | |||
| 256 | Ga0495671_0034550 | |||
| 257 | Ga0495649_0182371 | |||
| 258 | Ga0495649_0245366 | |||
| 259 | Ga0495683_0360007 | |||
| 260 | Ga0495687_001123 | |||
| 261 | Ga0495681_0000089 | |||
| 262 | Ga0495615_0000130 | |||
| 263 | Ga0496102_0000243 | |||
| 264 | Ga0496102_0602446 | |||
| 265 | Ga0496103_0008780 | |||
| 266 | Ga0496103_0065710 | |||
| 267 | Ga0496104_0012715 | |||
| 268 | Ga0496105_0012633 | |||
| 269 | Ga0496116_0001506 | |||
| 270 | Ga0496117_0000179 | |||
| 271 | Ga0496117_0151976 | |||
| 272 | Ga0496117_0500208 | |||
| 273 | Ga0496118_0000030 | |||
| 274 | Ga0496118_0074128 | |||
| 275 | Ga0496119_0070212 | |||
| 276 | Ga0496120_0081571 | |||
| 277 | Ga0496121_0000723 | |||
| 278 | Ga0496121_0248873 | |||
| 279 | Ga0496121_0335072 | |||
| 280 | Ga0496122_0031488 | |||
| 281 | Ga0496123_0000830 | |||
| 282 | Ga0496124_0000264 | |||
| 283 | Ga0496124_0041460 | |||
| 284 | Ga0495682_0041914 | |||
| 285 | Ga0501292_000055 | |||
| 286 | Ga0501036_0049530 | |||
| 287 | Ga0501039_0334933 | |||
| 288 | Ga0501043_0178165 | |||
| 289 | Ga0501043_0194326 | |||
| 290 | Ga0501047_0033755 | |||
| 291 | Ga0501206_000209 | |||
| 292 | Ga0501222_002304 | |||
| 293 | Ga0501223_004348 | |||
| 294 | Ga0501227_002086 | |||
| 295 | Ga0501235_011174 | |||
| 296 | Ga0501257_042802 | |||
| 297 | Ga0501261_000226 | |||
| 298 | Ga0501225_0001514 | |||
| 299 | Ga0501274_032256 | |||
| 300 | Ga0501279_000012 | |||
| 301 | Ga0501280_000005 | |||
| 302 | Ga0501281_00339 | |||
| 303 | Ga0501282_000010 | |||
| 304 | Ga0501283_020896 | |||
| 305 | Ga0501035_0025708 | |||
| 306 | nmdc:mga07m45_348_c1 | |||
| 307 | Ga0500643_000151 | |||
| 308 | Ga0500646_0121193 | |||
| 309 | Ga0500647_0259857 | |||
| 310 | Ga0500592_000124 | |||
| 311 | Ga0500594_0041779 | |||
| 312 | Ga0500594_0064960 | |||
| 313 | Ga0500608_000160 | |||
| 314 | Ga0500614_017056 | |||
| 315 | Ga0500618_006224 | |||
| 316 | Ga0500653_165447 | |||
| 317 | Ga0500658_0105050 | |||
| 318 | Ga0500564_018596 | |||
| 319 | Ga0500564_197966 | |||
| 320 | Ga0500573_0013794 | |||
| 321 | Ga0500573_0063451 | |||
| 322 | Ga0500604_0000002 | |||
| 323 | Ga0500604_0218960 | |||
| 324 | Ga0500622_0141336 | |||
| 325 | Ga0500627_0007275 | |||
| 326 | Ga0500627_0389695 | |||
| 327 | Ga0500630_107332 | |||
| 328 | Ga0500636_0423787 | |||
| 329 | Ga0500567_003171 | |||
| 330 | Ga0500625_000025 | |||
| 331 | Ga0500645_023739 | |||
| 332 | Ga0500596_009034 | |||
| 333 | Ga0500661_012067 | |||
| 334 | 2643951008 | |||
| 335 | 2644043046 | |||
| 336 | 2644395523 | |||
| 337 | 2882809376 | |||
| 338 | 2885431464 | |||
| 339 | 2928030982 | |||
| 340 | 2984556134 | |||
| 341 | 2984565758 | |||
| 342 | 2993356769 | |||
| 343 | 8054303975 | |||
| 344 | 8057105664 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7tj3-assembly1.cif.gz_A | crystal structure of a dihydrofolate reductase fola from stenotrophomonas maltophilia bound to nadp and p218 | 0.9555 | 4 | 162 |
| 5w3q-assembly1.cif.gz_A | l28f e.coli dhfr in complex with nadph | 0.9541 | 6 | 162 |
| 3tqb-assembly1.cif.gz_A | structure of the dihydrofolate reductase (fola) from coxiella burnetii in complex with folate | 0.951 | 5 | 161 |
| 3tqa-assembly1.cif.gz_A | structure of the dihydrofolate reductase (fola) from coxiella burnetii in complex with nadph | 0.9481 | 5 | 161 |
| 4osg-assembly4.cif.gz_D | klebsiella pneumoniae complexed with nadph and 6-ethyl-5-[(3r)-3-[3-methoxyl-5-(pyridine-4-yl)phenyl]but-1-yn-1-yl]pyrimidine-2,4-diamine (ucp1006) | 0.9461 | 6 | 162 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3tqaA00 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.9481 | 5 | 161 | 3.40.430.10 |
| 4or7A00 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.9456 | 6 | 162 | 3.40.430.10 |
| 3tqaA00 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.9366 | 5 | 161 | 3.40.430.10 |
| 4fghA00 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.9328 | 5 | 162 | 3.40.430.10 |
| 3ix9B00 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.932 | 4 | 162 | 3.40.430.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6G6YAU2-F1-model_v4 | Dihydrofolate reductase (EC 1.5.1.3) | 0.9965 | 6 | 162 |
GO:0004146
GO:0005829 GO:0006730 GO:0046452 GO:0046654 GO:0046655 GO:0050661 |
| AF-A0A4R6FR70-F1-model_v4 | deleted | 0.9942 | 3 | 162 |
|
| AF-A0A2N3DQ03-F1-model_v4 | Dihydrofolate reductase (EC 1.5.1.3) | 0.9916 | 1 | 162 |
GO:0004146
GO:0005829 GO:0006730 GO:0046452 GO:0046654 GO:0046655 GO:0050661 |
| AF-A0A292ZDX2-F1-model_v4 | dihydrofolate reductase (EC 1.5.1.3) | 0.9904 | 1 | 162 |
GO:0004146
GO:0005829 GO:0046452 GO:0046654 GO:0046655 GO:0050661 |
| AF-A0A1Q3V9J5-F1-model_v4 | dihydrofolate reductase (EC 1.5.1.3) | 0.9899 | 1 | 129 |
GO:0004146
GO:0005829 GO:0016301 GO:0046452 GO:0046654 GO:0046655 GO:0050661 |