F261023

General Info

Members Datasets Scaffolds Average Seq Length
172 140 344 159

Family's Representative Sequence

Representative Sequence 3300031911|Ga0307412_10724697|Ga0307412_107246972
Length 173
Sequence VSQELVLIYARAANGVIGREGHLPWHLPADLRRFKAMTMGKAMIMGRRTFESFPGPLPGRRHIVLTRDPAWQAEGAEVVHSVDEALARAGEGEVAVIGGAQIYALLRDRAARVELTEIHADYDGDTVMPPLGPEWREVAREEHPAEGGRPAHAFVTLSRLSPSRLREGSGEGM

Samples

Sample ID Description Type Environment
1 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
9 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
10 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
11 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
12 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
13 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
14 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
15 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
16 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
17 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
18 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
19 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
20 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
21 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
22 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
23 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
36 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
39 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
40 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
41 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
42 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
43 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
44 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
45 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
46 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
47 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
48 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
49 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
50 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
51 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
52 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
53 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
54 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
55 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
56 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
57 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
58 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
59 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
60 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
61 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
62 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
63 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
64 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
65 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
66 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
67 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
68 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
69 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
70 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
71 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
72 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
73 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
74 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
75 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
76 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
77 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
78 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
79 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
80 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
81 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
82 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
83 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
84 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
85 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
86 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
87 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
88 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
89 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
90 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
92 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
93 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
94 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
95 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
96 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
97 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
98 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
99 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
100 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
101 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
102 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
103 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
104 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
105 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
106 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
107 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
108 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
109 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
110 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
111 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
112 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
113 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
114 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
115 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
116 3300053132 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 endosphere Metagenome Endosphere
117 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
118 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
119 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
120 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
121 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
122 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
123 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
124 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
125 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
126 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
127 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
128 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
129 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
130 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
131 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
132 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
133 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
134 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
135 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
136 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
137 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
138 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
139 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere
140 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.6
Metatranscriptomes 0
Isolates 6.4

Biome Distribution

Category Percentage (%)
Aerial Root 1.74
Bulb 0
Endosphere 16.86
Nodule 1.16
Rhizoplane 3.49
Rhizosphere 60.47
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307412_10724697 3300031911 Bacteria 856
2 JGI24751J29686_10049731 3300002459 Bacteria 864
3 Ga0070670_100002057 3300005331 Bacteria 16470
4 Ga0070668_100000030 3300005347 Bacteria 87912
5 Ga0070669_100030539 3300005353 Bacteria 3889
6 Ga0070669_100241153 3300005353 Bacteria 1436
7 Ga0070671_100000125 3300005355 Bacteria 49771
8 Ga0070667_100000071 3300005367 Bacteria 125713
9 Ga0068853_101076744 3300005539 Bacteria 775
10 Ga0068852_100622964 3300005616 Bacteria 1085
11 Ga0068859_100046028 3300005617 Bacteria 4383
12 Ga0068864_100003212 3300005618 Bacteria 13494
13 Ga0068863_100000081 3300005841 Bacteria 106186
14 Ga0068863_100109945 3300005841 Bacteria 2624
15 Ga0068858_100069155 3300005842 Bacteria 3273
16 Ga0068858_100104886 3300005842 Bacteria 2638
17 Ga0068860_100000049 3300005843 Bacteria 208782
18 Ga0068860_100000426 3300005843 Bacteria 53853
19 Ga0068862_100002193 3300005844 Bacteria 17520
20 Ga0068862_100022946 3300005844 Bacteria 5225
21 Ga0068862_100128910 3300005844 Bacteria 2236
22 Ga0075370_10113397 3300006353 Bacteria 1575
23 Ga0097620_100046028 3300006931 Bacteria 4383
24 Ga0079104_1019939 3300006946 Bacteria 1860
25 Ga0105248_10875246 3300009177 Bacteria 1014
26 Ga0157378_10027679 3300013297 Bacteria 5000
27 Ga0213876_10005545 3300021384 Bacteria 6928
28 Ga0213875_10000307 3300021388 Bacteria 46789
29 Ga0207680_10081374 3300025903 Bacteria 2036
30 Ga0207681_10343811 3300025923 Bacteria 1192
31 Ga0207681_10492035 3300025923 Bacteria 1003
32 Ga0207650_10020435 3300025925 Bacteria 4670
33 Ga0207644_10000804 3300025931 Bacteria 19896
34 Ga0207712_11379502 3300025961 Bacteria 630
35 Ga0207668_10000011 3300025972 Bacteria 184484
36 Ga0207658_10000014 3300025986 Bacteria 218248
37 Ga0207658_10005955 3300025986 Bacteria 8328
38 Ga0207703_10057095 3300026035 Bacteria 3182
39 Ga0207703_10078625 3300026035 Bacteria 2741
40 Ga0207641_10000182 3300026088 Bacteria 87316
41 Ga0207641_10000292 3300026088 Bacteria 62689
42 Ga0207641_10024253 3300026088 Bacteria 5000
43 Ga0207676_10002466 3300026095 Bacteria 13199
44 Ga0207675_100033198 3300026118 Bacteria 4810
45 Ga0207698_10072380 3300026142 Bacteria 2740
46 Ga0209281_1008837 3300027111 Bacteria 2409
47 Ga0268265_10004499 3300028380 Bacteria 9648
48 Ga0268265_10112068 3300028380 Bacteria 2229
49 Ga0268265_10167838 3300028380 Bacteria 1872
50 Ga0268264_10000121 3300028381 Bacteria 190368
51 Ga0268264_10000126 3300028381 Bacteria 186138
52 Ga0307517_10012498 3300028786 Bacteria 11641
53 Ga0307508_10018370 3300031616 Bacteria 6357
54 Ga0316576_10770598 3300031727 Bacteria 694
55 Ga0307412_10246546 3300031911 Bacteria 1385
56 Ga0307411_10041879 3300032005 Bacteria 2918
57 Ga0316583_10005349 3300032133 Bacteria 4605
58 Ga0316582_0505713 3300036647 Bacteria 833
59 Ga0436364_0822555 3300037853 Bacteria 215682
60 Ga0436365_0091094 3300039437 Bacteria 2621
61 Ga0436365_0618881 3300039437 Bacteria 4924
62 Ga0436363_1139245 3300039450 Bacteria 1492
63 Ga0439461_0000109 3300041410 Bacteria 10967
64 Ga0439465_0008127 3300041413 Bacteria 3312
65 Ga0451853_2699784 3300041512 Bacteria 561
66 Ga0439431_0000015 3300041997 Bacteria 27396
67 Ga0439442_001321 3300042002 Bacteria 4930
68 Ga0439445_0000519 3300042004 Bacteria 7769
69 Ga0439432_000732 3300042006 Bacteria 12290
70 Ga0439452_022571 3300042010 Bacteria 1627
71 Ga0439462_0002602 3300042015 Bacteria 4216
72 Ga0439462_0045548 3300042015 Bacteria 1175
73 Ga0450909_005375 3300042185 Bacteria 1843
74 Ga0439434_0005986 3300042435 Bacteria 3548
75 Ga0495627_000430 3300046453 Bacteria 36446
76 Ga0495650_0000366 3300046471 Bacteria 79144
77 Ga0495610_0000050 3300046512 Bacteria 143781
78 Ga0495616_0048797 3300046513 Bacteria 2125
79 Ga0495632_0018268 3300046519 Bacteria 3851
80 Ga0495648_0064726 3300046524 Bacteria 2153
81 Ga0495663_0241805 3300046525 Bacteria 639
82 Ga0495654_0040306 3300046530 Bacteria 2328
83 Ga0495625_0387934 3300046660 Bacteria 875
84 Ga0495671_0034550 3300046692 Bacteria 2570
85 Ga0495649_0182371 3300046694 Bacteria 1095
86 Ga0495649_0245366 3300046694 Bacteria 921
87 Ga0495683_0360007 3300047323 Bacteria 612
88 Ga0495687_001123 3300047443 Bacteria 26001
89 Ga0495681_0000089 3300047470 Bacteria 79789
90 Ga0495615_0000130 3300048090 Bacteria 18969
91 Ga0496102_0000243 3300048905 Bacteria 71427
92 Ga0496102_0602446 3300048905 Bacteria 1022
93 Ga0496103_0008780 3300048906 Bacteria 5995
94 Ga0496103_0065710 3300048906 Bacteria 2263
95 Ga0496104_0012715 3300048907 Bacteria 7582
96 Ga0496105_0012633 3300048908 Bacteria 6687
97 Ga0496116_0001506 3300048919 Bacteria 25932
98 Ga0496117_0000179 3300048920 Bacteria 130966
99 Ga0496117_0151976 3300048920 Bacteria 1369
100 Ga0496117_0500208 3300048920 Bacteria 589
101 Ga0496118_0000030 3300048921 Bacteria 339946
102 Ga0496118_0074128 3300048921 Bacteria 2434
103 Ga0496119_0070212 3300048922 Bacteria 2055
104 Ga0496120_0081571 3300048923 Bacteria 1750
105 Ga0496121_0000723 3300048924 Bacteria 61128
106 Ga0496121_0248873 3300048924 Bacteria 1234
107 Ga0496121_0335072 3300048924 Bacteria 1013
108 Ga0496122_0031488 3300048925 Bacteria 4412
109 Ga0496123_0000830 3300048926 Bacteria 49505
110 Ga0496124_0000264 3300048927 Bacteria 101377
111 Ga0496124_0041460 3300048927 Bacteria 3972
112 Ga0495682_0041914 3300049460 Bacteria 1678
113 Ga0501292_000055 3300049515 Bacteria 22864
114 Ga0501036_0049530 3300049572 Bacteria 3557
115 Ga0501039_0334933 3300049575 Bacteria 1189
116 Ga0501043_0178165 3300049579 Bacteria 1657
117 Ga0501043_0194326 3300049579 Bacteria 1577
118 Ga0501047_0033755 3300049581 Bacteria 4939
119 Ga0501206_000209 3300049653 Bacteria 6770
120 Ga0501222_002304 3300049662 Bacteria 2650
121 Ga0501223_004348 3300049663 Bacteria 3038
122 Ga0501227_002086 3300049665 Bacteria 4432
123 Ga0501235_011174 3300049669 Bacteria 1966
124 Ga0501257_042802 3300049686 Bacteria 1115
125 Ga0501261_000226 3300049690 Bacteria 7743
126 Ga0501225_0001514 3300049705 Bacteria 7297
127 Ga0501274_032256 3300049771 Bacteria 597
128 Ga0501279_000012 3300049775 Bacteria 80359
129 Ga0501280_000005 3300049776 Bacteria 85174
130 Ga0501281_00339 3300049777 Bacteria 4814
131 Ga0501282_000010 3300049778 Bacteria 31798
132 Ga0501283_020896 3300049779 Bacteria 1046
133 Ga0501035_0025708 3300049822 Bacteria 5396
134 nmdc:mga07m45_348_c1 3300050496 Bacteria 18873
135 Ga0500643_000151 3300053087 Bacteria 70674
136 Ga0500646_0121193 3300053090 Bacteria 841
137 Ga0500647_0259857 3300053091 Bacteria 759
138 Ga0500592_000124 3300053116 Bacteria 16659
139 Ga0500594_0041779 3300053118 Bacteria 1257
140 Ga0500594_0064960 3300053118 Bacteria 1060
141 Ga0500608_000160 3300053122 Bacteria 28018
142 Ga0500614_017056 3300053123 Bacteria 1637
143 Ga0500618_006224 3300053125 Bacteria 3525
144 Ga0500653_165447 3300053132 Bacteria 586
145 Ga0500658_0105050 3300053134 Bacteria 1237
146 Ga0500564_018596 3300053138 Bacteria 3170
147 Ga0500564_197966 3300053138 Bacteria 827
148 Ga0500573_0013794 3300053140 Bacteria 4561
149 Ga0500573_0063451 3300053140 Bacteria 2114
150 Ga0500604_0000002 3300053151 Bacteria 165603
151 Ga0500604_0218960 3300053151 Bacteria 656
152 Ga0500622_0141336 3300053156 Bacteria 1147
153 Ga0500627_0007275 3300053158 Bacteria 3841
154 Ga0500627_0389695 3300053158 Bacteria 595
155 Ga0500630_107332 3300053159 Bacteria 1261
156 Ga0500636_0423787 3300053177 Bacteria 610
157 Ga0500567_003171 3300053723 Bacteria 7263
158 Ga0500625_000025 3300053729 Bacteria 63535
159 Ga0500645_023739 3300053730 Bacteria 1879
160 Ga0500596_009034 3300053735 Bacteria 1568
161 Ga0500661_012067 3300055283 Bacteria 1562
162 2643951008 2643221588 Bacteria 3692460
163 2644043046 2643221606 Bacteria 5588032
164 2644395523 2643221671 Bacteria 5496681
165 2882809376 2882806704 Bacteria 3007728
166 2885431464 2885429604 Bacteria 3642894
167 2928030982 2928027323 Bacteria 4382488
168 2984556134 2984555340 Bacteria 4247089
169 2984565758 2984564862 Bacteria 4339992
170 2993356769 2993356040 Bacteria 4247105
171 8054303975 8054302542 Bacteria 5698134
172 8057105664 8057101203 Bacteria 5034064
173 Ga0307412_10724697
174 JGI24751J29686_10049731
175 Ga0070670_100002057
176 Ga0070668_100000030
177 Ga0070669_100030539
178 Ga0070669_100241153
179 Ga0070671_100000125
180 Ga0070667_100000071
181 Ga0068853_101076744
182 Ga0068852_100622964
183 Ga0068859_100046028
184 Ga0068864_100003212
185 Ga0068863_100000081
186 Ga0068863_100109945
187 Ga0068858_100069155
188 Ga0068858_100104886
189 Ga0068860_100000049
190 Ga0068860_100000426
191 Ga0068862_100002193
192 Ga0068862_100022946
193 Ga0068862_100128910
194 Ga0075370_10113397
195 Ga0097620_100046028
196 Ga0079104_1019939
197 Ga0105248_10875246
198 Ga0157378_10027679
199 Ga0213876_10005545
200 Ga0213875_10000307
201 Ga0207680_10081374
202 Ga0207681_10343811
203 Ga0207681_10492035
204 Ga0207650_10020435
205 Ga0207644_10000804
206 Ga0207712_11379502
207 Ga0207668_10000011
208 Ga0207658_10000014
209 Ga0207658_10005955
210 Ga0207703_10057095
211 Ga0207703_10078625
212 Ga0207641_10000182
213 Ga0207641_10000292
214 Ga0207641_10024253
215 Ga0207676_10002466
216 Ga0207675_100033198
217 Ga0207698_10072380
218 Ga0209281_1008837
219 Ga0268265_10004499
220 Ga0268265_10112068
221 Ga0268265_10167838
222 Ga0268264_10000121
223 Ga0268264_10000126
224 Ga0307517_10012498
225 Ga0307508_10018370
226 Ga0316576_10770598
227 Ga0307412_10246546
228 Ga0307411_10041879
229 Ga0316583_10005349
230 Ga0316582_0505713
231 Ga0436364_0822555
232 Ga0436365_0091094
233 Ga0436365_0618881
234 Ga0436363_1139245
235 Ga0439461_0000109
236 Ga0439465_0008127
237 Ga0451853_2699784
238 Ga0439431_0000015
239 Ga0439442_001321
240 Ga0439445_0000519
241 Ga0439432_000732
242 Ga0439452_022571
243 Ga0439462_0002602
244 Ga0439462_0045548
245 Ga0450909_005375
246 Ga0439434_0005986
247 Ga0495627_000430
248 Ga0495650_0000366
249 Ga0495610_0000050
250 Ga0495616_0048797
251 Ga0495632_0018268
252 Ga0495648_0064726
253 Ga0495663_0241805
254 Ga0495654_0040306
255 Ga0495625_0387934
256 Ga0495671_0034550
257 Ga0495649_0182371
258 Ga0495649_0245366
259 Ga0495683_0360007
260 Ga0495687_001123
261 Ga0495681_0000089
262 Ga0495615_0000130
263 Ga0496102_0000243
264 Ga0496102_0602446
265 Ga0496103_0008780
266 Ga0496103_0065710
267 Ga0496104_0012715
268 Ga0496105_0012633
269 Ga0496116_0001506
270 Ga0496117_0000179
271 Ga0496117_0151976
272 Ga0496117_0500208
273 Ga0496118_0000030
274 Ga0496118_0074128
275 Ga0496119_0070212
276 Ga0496120_0081571
277 Ga0496121_0000723
278 Ga0496121_0248873
279 Ga0496121_0335072
280 Ga0496122_0031488
281 Ga0496123_0000830
282 Ga0496124_0000264
283 Ga0496124_0041460
284 Ga0495682_0041914
285 Ga0501292_000055
286 Ga0501036_0049530
287 Ga0501039_0334933
288 Ga0501043_0178165
289 Ga0501043_0194326
290 Ga0501047_0033755
291 Ga0501206_000209
292 Ga0501222_002304
293 Ga0501223_004348
294 Ga0501227_002086
295 Ga0501235_011174
296 Ga0501257_042802
297 Ga0501261_000226
298 Ga0501225_0001514
299 Ga0501274_032256
300 Ga0501279_000012
301 Ga0501280_000005
302 Ga0501281_00339
303 Ga0501282_000010
304 Ga0501283_020896
305 Ga0501035_0025708
306 nmdc:mga07m45_348_c1
307 Ga0500643_000151
308 Ga0500646_0121193
309 Ga0500647_0259857
310 Ga0500592_000124
311 Ga0500594_0041779
312 Ga0500594_0064960
313 Ga0500608_000160
314 Ga0500614_017056
315 Ga0500618_006224
316 Ga0500653_165447
317 Ga0500658_0105050
318 Ga0500564_018596
319 Ga0500564_197966
320 Ga0500573_0013794
321 Ga0500573_0063451
322 Ga0500604_0000002
323 Ga0500604_0218960
324 Ga0500622_0141336
325 Ga0500627_0007275
326 Ga0500627_0389695
327 Ga0500630_107332
328 Ga0500636_0423787
329 Ga0500567_003171
330 Ga0500625_000025
331 Ga0500645_023739
332 Ga0500596_009034
333 Ga0500661_012067
334 2643951008
335 2644043046
336 2644395523
337 2882809376
338 2885431464
339 2928030982
340 2984556134
341 2984565758
342 2993356769
343 8054303975
344 8057105664

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00186

DHFR_1

Dihydrofolate reductase

4

159

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7tj3-assembly1.cif.gz_A crystal structure of a dihydrofolate reductase fola from stenotrophomonas maltophilia bound to nadp and p218 0.9555 4 162
5w3q-assembly1.cif.gz_A l28f e.coli dhfr in complex with nadph 0.9541 6 162
3tqb-assembly1.cif.gz_A structure of the dihydrofolate reductase (fola) from coxiella burnetii in complex with folate 0.951 5 161
3tqa-assembly1.cif.gz_A structure of the dihydrofolate reductase (fola) from coxiella burnetii in complex with nadph 0.9481 5 161
4osg-assembly4.cif.gz_D klebsiella pneumoniae complexed with nadph and 6-ethyl-5-[(3r)-3-[3-methoxyl-5-(pyridine-4-yl)phenyl]but-1-yn-1-yl]pyrimidine-2,4-diamine (ucp1006) 0.9461 6 162
ID Description Score Start End Superfamily
3tqaA00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.9481 5 161 3.40.430.10
4or7A00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.9456 6 162 3.40.430.10
3tqaA00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.9366 5 161 3.40.430.10
4fghA00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.9328 5 162 3.40.430.10
3ix9B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.932 4 162 3.40.430.10
ID Description Score Start End GO Terms
AF-A0A6G6YAU2-F1-model_v4 Dihydrofolate reductase (EC 1.5.1.3) 0.9965 6 162 GO:0004146
GO:0005829
GO:0006730
GO:0046452
GO:0046654
GO:0046655
GO:0050661
AF-A0A4R6FR70-F1-model_v4 deleted 0.9942 3 162
AF-A0A2N3DQ03-F1-model_v4 Dihydrofolate reductase (EC 1.5.1.3) 0.9916 1 162 GO:0004146
GO:0005829
GO:0006730
GO:0046452
GO:0046654
GO:0046655
GO:0050661
AF-A0A292ZDX2-F1-model_v4 dihydrofolate reductase (EC 1.5.1.3) 0.9904 1 162 GO:0004146
GO:0005829
GO:0046452
GO:0046654
GO:0046655
GO:0050661
AF-A0A1Q3V9J5-F1-model_v4 dihydrofolate reductase (EC 1.5.1.3) 0.9899 1 129 GO:0004146
GO:0005829
GO:0016301
GO:0046452
GO:0046654
GO:0046655
GO:0050661

Map