F260824
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 172 | 103 | 344 | 199 |
Family's Representative Sequence
| Representative Sequence | 3300025903|Ga0207680_10065034|Ga0207680_100650343 |
| Length | 218 |
| Sequence | MWSPKLGANSGFDRSFYMIAFLQGKLVEAIPTQVLLEVNGIGYEVLIPLSSFDKLPQPGQPVKLLTHLVIREDAHILYGFMSGPERELFRLLINNVSGIGPKIALNVLSGISVTAFRGAVANQDIKALSQISGVGKKTAERVVVELKDRIGVAGAWEALSAQRALSPEDQKLNDASLALIALGFKQVEAHEAVRKAQTALGPQTTVEDLVRACLRKGS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 3 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 5 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 9 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 11 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 12 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 13 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 16 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 17 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 18 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 19 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 20 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 21 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 22 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 23 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 24 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 25 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 26 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 27 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 28 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 29 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 30 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 31 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 32 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 33 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 34 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 35 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 36 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 37 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 41 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 42 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 43 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 44 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 45 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 46 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 47 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 48 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 49 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 50 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 51 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 52 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 53 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 54 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 55 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 56 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 57 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 58 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 59 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 60 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 61 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 62 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 63 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 64 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 65 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 66 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 67 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 68 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 69 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 70 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 71 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 72 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 73 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 74 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 75 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 76 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 77 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 78 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 79 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 80 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 81 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 82 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 83 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 84 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 85 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 86 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 87 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 88 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 89 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 90 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 91 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 92 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 96 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 97 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 98 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 99 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 100 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 101 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 103 | 2786546517 | Verrucomicrobia bacterium LW23 | Isolate | Rhizoplane |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.42 |
| Metatranscriptomes | 0 |
| Isolates | 0.58 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.16 |
| Rhizosphere | 97.09 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 25 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207680_10065034 | 3300025903 | Unclassified | 2238 |
| 2 | Ga0070690_100050959 | 3300005330 | Unclassified | 2641 |
| 3 | Ga0070666_10081053 | 3300005335 | Unclassified | 2218 |
| 4 | Ga0068868_100208226 | 3300005338 | Bacteria | 1633 |
| 5 | Ga0070689_100109734 | 3300005340 | Bacteria | 2193 |
| 6 | Ga0070689_100257814 | 3300005340 | Unclassified | 1440 |
| 7 | Ga0070687_100274823 | 3300005343 | Bacteria | 1058 |
| 8 | Ga0070675_100248738 | 3300005354 | Bacteria | 1555 |
| 9 | Ga0068867_100112523 | 3300005459 | Bacteria | 2093 |
| 10 | Ga0070702_100109021 | 3300005615 | Bacteria | 1713 |
| 11 | Ga0068864_100626752 | 3300005618 | Bacteria | 1045 |
| 12 | Ga0068863_100072113 | 3300005841 | Unclassified | 3268 |
| 13 | Ga0068863_101025485 | 3300005841 | Bacteria | 828 |
| 14 | Ga0068863_101296679 | 3300005841 | Bacteria | 735 |
| 15 | Ga0068858_100067913 | 3300005842 | Unclassified | 3302 |
| 16 | Ga0068858_100697234 | 3300005842 | Bacteria | 988 |
| 17 | Ga0070717_10094487 | 3300006028 | Unclassified | 2529 |
| 18 | Ga0070712_100487734 | 3300006175 | Bacteria | 1031 |
| 19 | Ga0097621_100203193 | 3300006237 | Bacteria | 1721 |
| 20 | Ga0097621_100287401 | 3300006237 | Bacteria | 1449 |
| 21 | Ga0068871_100008434 | 3300006358 | Bacteria | 7412 |
| 22 | Ga0075428_100268276 | 3300006844 | Unclassified | 1837 |
| 23 | Ga0075429_100209925 | 3300006880 | Bacteria | 1706 |
| 24 | Ga0075435_100521330 | 3300007076 | Unclassified | 1028 |
| 25 | Ga0075435_100827661 | 3300007076 | Bacteria | 806 |
| 26 | Ga0105240_10081616 | 3300009093 | Bacteria | 3973 |
| 27 | Ga0105240_10782691 | 3300009093 | Unclassified | 1035 |
| 28 | Ga0111539_10607627 | 3300009094 | Bacteria | 1274 |
| 29 | Ga0111539_11145732 | 3300009094 | Bacteria | 904 |
| 30 | Ga0105245_10267895 | 3300009098 | Bacteria | 1665 |
| 31 | Ga0105242_10479381 | 3300009176 | Unclassified | 1179 |
| 32 | Ga0105242_10549557 | 3300009176 | Unclassified | 1107 |
| 33 | Ga0105242_10740025 | 3300009176 | Bacteria | 967 |
| 34 | Ga0105248_10442443 | 3300009177 | Unclassified | 1464 |
| 35 | Ga0157374_10253841 | 3300013296 | Bacteria | 1731 |
| 36 | Ga0157374_10592946 | 3300013296 | Bacteria | 1118 |
| 37 | Ga0157375_10000113 | 3300013308 | Bacteria | 78155 |
| 38 | Ga0163163_10000020 | 3300014325 | Bacteria | 196885 |
| 39 | Ga0163163_10084104 | 3300014325 | Unclassified | 3187 |
| 40 | Ga0163163_10085629 | 3300014325 | Bacteria | 3160 |
| 41 | Ga0163163_10130167 | 3300014325 | Unclassified | 2556 |
| 42 | Ga0157379_10185181 | 3300014968 | Bacteria | 1881 |
| 43 | Ga0157379_10257208 | 3300014968 | Unclassified | 1586 |
| 44 | Ga0157376_10084628 | 3300014969 | Bacteria | 2731 |
| 45 | Ga0157376_10529504 | 3300014969 | Bacteria | 1163 |
| 46 | Ga0213876_10047989 | 3300021384 | Bacteria | 2257 |
| 47 | Ga0207699_10381143 | 3300025906 | Bacteria | 1001 |
| 48 | Ga0207695_10082902 | 3300025913 | Bacteria | 3240 |
| 49 | Ga0207693_10306454 | 3300025915 | Bacteria | 1244 |
| 50 | Ga0207670_10222534 | 3300025936 | Bacteria | 1445 |
| 51 | Ga0207711_10858294 | 3300025941 | Unclassified | 845 |
| 52 | Ga0207711_11063669 | 3300025941 | Bacteria | 749 |
| 53 | Ga0207708_10352828 | 3300026075 | Unclassified | 1207 |
| 54 | Ga0207702_11099288 | 3300026078 | Unclassified | 789 |
| 55 | Ga0207641_10194393 | 3300026088 | Bacteria | 1867 |
| 56 | Ga0207641_10224197 | 3300026088 | Bacteria | 1745 |
| 57 | Ga0207674_10474499 | 3300026116 | Unclassified | 1209 |
| 58 | Ga0265337_1004461 | 3300028556 | Bacteria | 5803 |
| 59 | Ga0265338_10002770 | 3300028800 | Bacteria | 25657 |
| 60 | Ga0265338_10003961 | 3300028800 | Bacteria | 20398 |
| 61 | Ga0265338_10004144 | 3300028800 | Bacteria | 19817 |
| 62 | Ga0265338_10016423 | 3300028800 | Bacteria | 8057 |
| 63 | Ga0265338_10021449 | 3300028800 | Bacteria | 6736 |
| 64 | Ga0265338_10608952 | 3300028800 | Bacteria | 760 |
| 65 | Ga0265324_10041872 | 3300029957 | Bacteria | 1584 |
| 66 | Ga0265320_10001026 | 3300031240 | Bacteria | 20812 |
| 67 | Ga0265320_10001499 | 3300031240 | Bacteria | 17011 |
| 68 | Ga0265320_10078354 | 3300031240 | Bacteria | 1546 |
| 69 | Ga0265340_10001390 | 3300031247 | Bacteria | 13870 |
| 70 | Ga0265327_10014060 | 3300031251 | Bacteria | 5265 |
| 71 | Ga0265316_10622421 | 3300031344 | Bacteria | 764 |
| 72 | Ga0307409_100291774 | 3300031995 | Bacteria | 1513 |
| 73 | Ga0307416_100140682 | 3300032002 | Bacteria | 2193 |
| 74 | Ga0307416_100597777 | 3300032002 | Bacteria | 1183 |
| 75 | Ga0307411_10071582 | 3300032005 | Unclassified | 2351 |
| 76 | Ga0373926_0011725 | 3300035083 | Bacteria | 2955 |
| 77 | Ga0373954_0001454 | 3300035118 | Bacteria | 9615 |
| 78 | Ga0373954_0013528 | 3300035118 | Bacteria | 3638 |
| 79 | Ga0373954_0267040 | 3300035118 | Bacteria | 843 |
| 80 | Ga0373956_0010112 | 3300035119 | Bacteria | 3853 |
| 81 | Ga0373931_0068621 | 3300035691 | Bacteria | 1930 |
| 82 | Ga0373931_0295179 | 3300035691 | Bacteria | 999 |
| 83 | Ga0373931_0554799 | 3300035691 | Bacteria | 747 |
| 84 | Ga0373931_0848268 | 3300035691 | Unclassified | 611 |
| 85 | Ga0373935_0002549 | 3300035692 | Bacteria | 10447 |
| 86 | Ga0373935_0536434 | 3300035692 | Unclassified | 852 |
| 87 | Ga0373927_0017499 | 3300035695 | Bacteria | 4715 |
| 88 | Ga0373927_0176749 | 3300035695 | Unclassified | 1400 |
| 89 | Ga0373933_0061674 | 3300035724 | Bacteria | 2263 |
| 90 | Ga0373947_0010722 | 3300035725 | Bacteria | 5260 |
| 91 | Ga0373937_0004433 | 3300036401 | Bacteria | 11932 |
| 92 | Ga0373937_0157838 | 3300036401 | Bacteria | 2127 |
| 93 | Ga0373937_0936669 | 3300036401 | Bacteria | 815 |
| 94 | Ga0373937_1051883 | 3300036401 | Bacteria | 763 |
| 95 | Ga0373925_0006933 | 3300037068 | Bacteria | 8289 |
| 96 | Ga0373925_0117077 | 3300037068 | Bacteria | 2065 |
| 97 | Ga0436365_0049465 | 3300039437 | Bacteria | 17099 |
| 98 | Ga0436362_0386383 | 3300039453 | Bacteria | 1415 |
| 99 | Ga0451853_1000939 | 3300041512 | Unclassified | 934 |
| 100 | Ga0451577_0000986 | 3300042876 | Bacteria | 41404 |
| 101 | Ga0451577_0003019 | 3300042876 | Bacteria | 19162 |
| 102 | Ga0451577_0015358 | 3300042876 | Bacteria | 7125 |
| 103 | Ga0451577_0092512 | 3300042876 | Bacteria | 2700 |
| 104 | Ga0451577_0129077 | 3300042876 | Bacteria | 2267 |
| 105 | Ga0453684_0014306 | 3300044712 | Bacteria | 12716 |
| 106 | Ga0453684_0053054 | 3300044712 | Bacteria | 5295 |
| 107 | Ga0453684_0059420 | 3300044712 | Bacteria | 4929 |
| 108 | Ga0453684_0884276 | 3300044712 | Bacteria | 958 |
| 109 | Ga0451576_0045034 | 3300045051 | Bacteria | 4649 |
| 110 | Ga0451576_0162833 | 3300045051 | Bacteria | 2328 |
| 111 | Ga0451576_0183113 | 3300045051 | Bacteria | 2187 |
| 112 | Ga0451576_0211736 | 3300045051 | Bacteria | 2024 |
| 113 | Ga0451576_0232100 | 3300045051 | Unclassified | 1927 |
| 114 | Ga0495592_0046503 | 3300046454 | Bacteria | 3235 |
| 115 | Ga0495629_0041244 | 3300046459 | Bacteria | 3248 |
| 116 | Ga0495629_0229956 | 3300046459 | Unclassified | 1278 |
| 117 | Ga0495641_0020165 | 3300046461 | Bacteria | 3390 |
| 118 | Ga0495651_0049547 | 3300046462 | Bacteria | 3242 |
| 119 | Ga0495580_0587605 | 3300046472 | Bacteria | 737 |
| 120 | Ga0495618_0001265 | 3300046514 | Bacteria | 17122 |
| 121 | Ga0495618_0168957 | 3300046514 | Unclassified | 1392 |
| 122 | Ga0495628_0115555 | 3300046516 | Bacteria | 2061 |
| 123 | Ga0495628_0376716 | 3300046516 | Unclassified | 1040 |
| 124 | Ga0495630_0000226 | 3300046517 | Bacteria | 44816 |
| 125 | Ga0495630_0158256 | 3300046517 | Bacteria | 1724 |
| 126 | Ga0495630_0185259 | 3300046517 | Bacteria | 1588 |
| 127 | Ga0495630_0486851 | 3300046517 | Bacteria | 946 |
| 128 | Ga0495630_0521441 | 3300046517 | Unclassified | 911 |
| 129 | Ga0495666_0004285 | 3300046526 | Bacteria | 7198 |
| 130 | Ga0495666_0083347 | 3300046526 | Bacteria | 1511 |
| 131 | Ga0495665_0072087 | 3300046531 | Unclassified | 1819 |
| 132 | Ga0495586_0000114 | 3300046535 | Bacteria | 48074 |
| 133 | Ga0495586_0000121 | 3300046535 | Bacteria | 47320 |
| 134 | Ga0495586_0078323 | 3300046535 | Bacteria | 1813 |
| 135 | Ga0495586_0178745 | 3300046535 | Bacteria | 1200 |
| 136 | Ga0495645_0274223 | 3300046543 | Unclassified | 1112 |
| 137 | Ga0495622_0017357 | 3300046557 | Bacteria | 3350 |
| 138 | Ga0495667_0102093 | 3300046559 | Unclassified | 1855 |
| 139 | Ga0495634_0000333 | 3300046642 | Bacteria | 45524 |
| 140 | Ga0495634_0016189 | 3300046642 | Bacteria | 5336 |
| 141 | Ga0495635_0016532 | 3300046663 | Bacteria | 5155 |
| 142 | Ga0495635_0230616 | 3300046663 | Bacteria | 1251 |
| 143 | Ga0495599_0028859 | 3300046678 | Bacteria | 3477 |
| 144 | Ga0495599_0153195 | 3300046678 | Unclassified | 1427 |
| 145 | Ga0495646_0373795 | 3300046680 | Unclassified | 744 |
| 146 | Ga0495647_0020148 | 3300046681 | Bacteria | 2392 |
| 147 | Ga0495647_0041302 | 3300046681 | Bacteria | 1756 |
| 148 | Ga0495658_0243856 | 3300046683 | Unclassified | 1129 |
| 149 | Ga0495613_0011913 | 3300046689 | Bacteria | 6464 |
| 150 | Ga0495624_0160646 | 3300046690 | Bacteria | 1373 |
| 151 | Ga0495624_0195712 | 3300046690 | Bacteria | 1228 |
| 152 | Ga0495600_0204272 | 3300046809 | Bacteria | 1268 |
| 153 | Ga0495581_0059171 | 3300047315 | Unclassified | 2214 |
| 154 | Ga0495604_0150805 | 3300047317 | Bacteria | 1652 |
| 155 | Ga0495604_0502547 | 3300047317 | Unclassified | 786 |
| 156 | Ga0495674_0000940 | 3300047319 | Bacteria | 27835 |
| 157 | Ga0495674_0130344 | 3300047319 | Bacteria | 2119 |
| 158 | Ga0495674_0380994 | 3300047319 | Bacteria | 1141 |
| 159 | Ga0495676_0013842 | 3300047321 | Bacteria | 7233 |
| 160 | Ga0495676_0248008 | 3300047321 | Unclassified | 1216 |
| 161 | Ga0495676_0315460 | 3300047321 | Bacteria | 1051 |
| 162 | Ga0495680_0002752 | 3300047322 | Bacteria | 17756 |
| 163 | Ga0495614_0189746 | 3300048089 | Unclassified | 927 |
| 164 | Ga0496112_0958977 | 3300048915 | Bacteria | 776 |
| 165 | Ga0501034_0141739 | 3300049571 | Unclassified | 2383 |
| 166 | Ga0501047_0144189 | 3300049581 | Unclassified | 2259 |
| 167 | nmdc:mga09592_189554_c1 | 3300050508 | Bacteria | 1780 |
| 168 | nmdc:mga06r32_337265_c1 | 3300050510 | Bacteria | 1492 |
| 169 | nmdc:mga08y16_406824_c1 | 3300050511 | Unclassified | 1392 |
| 170 | Ga0495601_0402709 | 3300053077 | Bacteria | 887 |
| 171 | Ga0590075_079140 | 3300059424 | Bacteria | 851 |
| 172 | 2787435305 | 2786546517 | Bacteria | 6614109 |
| 173 | Ga0207680_10065034 | |||
| 174 | Ga0070690_100050959 | |||
| 175 | Ga0070666_10081053 | |||
| 176 | Ga0068868_100208226 | |||
| 177 | Ga0070689_100109734 | |||
| 178 | Ga0070689_100257814 | |||
| 179 | Ga0070687_100274823 | |||
| 180 | Ga0070675_100248738 | |||
| 181 | Ga0068867_100112523 | |||
| 182 | Ga0070702_100109021 | |||
| 183 | Ga0068864_100626752 | |||
| 184 | Ga0068863_100072113 | |||
| 185 | Ga0068863_101025485 | |||
| 186 | Ga0068863_101296679 | |||
| 187 | Ga0068858_100067913 | |||
| 188 | Ga0068858_100697234 | |||
| 189 | Ga0070717_10094487 | |||
| 190 | Ga0070712_100487734 | |||
| 191 | Ga0097621_100203193 | |||
| 192 | Ga0097621_100287401 | |||
| 193 | Ga0068871_100008434 | |||
| 194 | Ga0075428_100268276 | |||
| 195 | Ga0075429_100209925 | |||
| 196 | Ga0075435_100521330 | |||
| 197 | Ga0075435_100827661 | |||
| 198 | Ga0105240_10081616 | |||
| 199 | Ga0105240_10782691 | |||
| 200 | Ga0111539_10607627 | |||
| 201 | Ga0111539_11145732 | |||
| 202 | Ga0105245_10267895 | |||
| 203 | Ga0105242_10479381 | |||
| 204 | Ga0105242_10549557 | |||
| 205 | Ga0105242_10740025 | |||
| 206 | Ga0105248_10442443 | |||
| 207 | Ga0157374_10253841 | |||
| 208 | Ga0157374_10592946 | |||
| 209 | Ga0157375_10000113 | |||
| 210 | Ga0163163_10000020 | |||
| 211 | Ga0163163_10084104 | |||
| 212 | Ga0163163_10085629 | |||
| 213 | Ga0163163_10130167 | |||
| 214 | Ga0157379_10185181 | |||
| 215 | Ga0157379_10257208 | |||
| 216 | Ga0157376_10084628 | |||
| 217 | Ga0157376_10529504 | |||
| 218 | Ga0213876_10047989 | |||
| 219 | Ga0207699_10381143 | |||
| 220 | Ga0207695_10082902 | |||
| 221 | Ga0207693_10306454 | |||
| 222 | Ga0207670_10222534 | |||
| 223 | Ga0207711_10858294 | |||
| 224 | Ga0207711_11063669 | |||
| 225 | Ga0207708_10352828 | |||
| 226 | Ga0207702_11099288 | |||
| 227 | Ga0207641_10194393 | |||
| 228 | Ga0207641_10224197 | |||
| 229 | Ga0207674_10474499 | |||
| 230 | Ga0265337_1004461 | |||
| 231 | Ga0265338_10002770 | |||
| 232 | Ga0265338_10003961 | |||
| 233 | Ga0265338_10004144 | |||
| 234 | Ga0265338_10016423 | |||
| 235 | Ga0265338_10021449 | |||
| 236 | Ga0265338_10608952 | |||
| 237 | Ga0265324_10041872 | |||
| 238 | Ga0265320_10001026 | |||
| 239 | Ga0265320_10001499 | |||
| 240 | Ga0265320_10078354 | |||
| 241 | Ga0265340_10001390 | |||
| 242 | Ga0265327_10014060 | |||
| 243 | Ga0265316_10622421 | |||
| 244 | Ga0307409_100291774 | |||
| 245 | Ga0307416_100140682 | |||
| 246 | Ga0307416_100597777 | |||
| 247 | Ga0307411_10071582 | |||
| 248 | Ga0373926_0011725 | |||
| 249 | Ga0373954_0001454 | |||
| 250 | Ga0373954_0013528 | |||
| 251 | Ga0373954_0267040 | |||
| 252 | Ga0373956_0010112 | |||
| 253 | Ga0373931_0068621 | |||
| 254 | Ga0373931_0295179 | |||
| 255 | Ga0373931_0554799 | |||
| 256 | Ga0373931_0848268 | |||
| 257 | Ga0373935_0002549 | |||
| 258 | Ga0373935_0536434 | |||
| 259 | Ga0373927_0017499 | |||
| 260 | Ga0373927_0176749 | |||
| 261 | Ga0373933_0061674 | |||
| 262 | Ga0373947_0010722 | |||
| 263 | Ga0373937_0004433 | |||
| 264 | Ga0373937_0157838 | |||
| 265 | Ga0373937_0936669 | |||
| 266 | Ga0373937_1051883 | |||
| 267 | Ga0373925_0006933 | |||
| 268 | Ga0373925_0117077 | |||
| 269 | Ga0436365_0049465 | |||
| 270 | Ga0436362_0386383 | |||
| 271 | Ga0451853_1000939 | |||
| 272 | Ga0451577_0000986 | |||
| 273 | Ga0451577_0003019 | |||
| 274 | Ga0451577_0015358 | |||
| 275 | Ga0451577_0092512 | |||
| 276 | Ga0451577_0129077 | |||
| 277 | Ga0453684_0014306 | |||
| 278 | Ga0453684_0053054 | |||
| 279 | Ga0453684_0059420 | |||
| 280 | Ga0453684_0884276 | |||
| 281 | Ga0451576_0045034 | |||
| 282 | Ga0451576_0162833 | |||
| 283 | Ga0451576_0183113 | |||
| 284 | Ga0451576_0211736 | |||
| 285 | Ga0451576_0232100 | |||
| 286 | Ga0495592_0046503 | |||
| 287 | Ga0495629_0041244 | |||
| 288 | Ga0495629_0229956 | |||
| 289 | Ga0495641_0020165 | |||
| 290 | Ga0495651_0049547 | |||
| 291 | Ga0495580_0587605 | |||
| 292 | Ga0495618_0001265 | |||
| 293 | Ga0495618_0168957 | |||
| 294 | Ga0495628_0115555 | |||
| 295 | Ga0495628_0376716 | |||
| 296 | Ga0495630_0000226 | |||
| 297 | Ga0495630_0158256 | |||
| 298 | Ga0495630_0185259 | |||
| 299 | Ga0495630_0486851 | |||
| 300 | Ga0495630_0521441 | |||
| 301 | Ga0495666_0004285 | |||
| 302 | Ga0495666_0083347 | |||
| 303 | Ga0495665_0072087 | |||
| 304 | Ga0495586_0000114 | |||
| 305 | Ga0495586_0000121 | |||
| 306 | Ga0495586_0078323 | |||
| 307 | Ga0495586_0178745 | |||
| 308 | Ga0495645_0274223 | |||
| 309 | Ga0495622_0017357 | |||
| 310 | Ga0495667_0102093 | |||
| 311 | Ga0495634_0000333 | |||
| 312 | Ga0495634_0016189 | |||
| 313 | Ga0495635_0016532 | |||
| 314 | Ga0495635_0230616 | |||
| 315 | Ga0495599_0028859 | |||
| 316 | Ga0495599_0153195 | |||
| 317 | Ga0495646_0373795 | |||
| 318 | Ga0495647_0020148 | |||
| 319 | Ga0495647_0041302 | |||
| 320 | Ga0495658_0243856 | |||
| 321 | Ga0495613_0011913 | |||
| 322 | Ga0495624_0160646 | |||
| 323 | Ga0495624_0195712 | |||
| 324 | Ga0495600_0204272 | |||
| 325 | Ga0495581_0059171 | |||
| 326 | Ga0495604_0150805 | |||
| 327 | Ga0495604_0502547 | |||
| 328 | Ga0495674_0000940 | |||
| 329 | Ga0495674_0130344 | |||
| 330 | Ga0495674_0380994 | |||
| 331 | Ga0495676_0013842 | |||
| 332 | Ga0495676_0248008 | |||
| 333 | Ga0495676_0315460 | |||
| 334 | Ga0495680_0002752 | |||
| 335 | Ga0495614_0189746 | |||
| 336 | Ga0496112_0958977 | |||
| 337 | Ga0501034_0141739 | |||
| 338 | Ga0501047_0144189 | |||
| 339 | nmdc:mga09592_189554_c1 | |||
| 340 | nmdc:mga06r32_337265_c1 | |||
| 341 | nmdc:mga08y16_406824_c1 | |||
| 342 | Ga0495601_0402709 | |||
| 343 | Ga0590075_079140 | |||
| 344 | 2787435305 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1ixs-assembly1.cif.gz_A | structure of ruvb complexed with ruva domain iii | 0.864 | 153 | 201 |
| 1ixs-assembly1.cif.gz_A | structure of ruvb complexed with ruva domain iii | 0.8175 | 153 | 201 |
| 6zjo-assembly1.cif.gz_A | crystal structure of staphylococcus aureus rsga. | 0.7813 | 6 | 29 |
| 4nps-assembly1.cif.gz_A | crystal structure of bep1 protein (virb-translocated bartonella effector protein) from bartonella clarridgeiae | 0.7697 | 4 | 49 |
| 3vyt-assembly1.cif.gz_A-2 | crystal structure of the hypc-hypd-hype complex (form i inward) | 0.7585 | 4 | 49 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2ztcA03 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain | 0.9551 | 155 | 197 | 1.10.8.10 |
| 2zteA02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain | 0.9518 | 65 | 132 | 1.10.150.20 |
| 1bvsA02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain | 0.9504 | 68 | 135 | 1.10.150.20 |
| 2ztdB03 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain | 0.9497 | 157 | 197 | 1.10.8.10 |
| 1d8lB01 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain | 0.9497 | 68 | 132 | 1.10.150.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-X0XHZ1-F1-model_v4 | DNA helicase Holliday junction RuvA type domain-containing protein | 0.9918 | 1 | 49 |
GO:0003677
GO:0005524 GO:0006281 GO:0006310 GO:0009378 |
| AF-X0XHZ1-F1-model_v4 | DNA helicase Holliday junction RuvA type domain-containing protein | 0.9723 | 1 | 49 |
GO:0003677
GO:0005524 GO:0006281 GO:0006310 GO:0009378 |
| AF-A0A2V8KIF1-F1-model_v4 | Holliday junction branch migration protein RuvA | 0.9712 | 1 | 47 |
GO:0003677
GO:0005524 GO:0006281 GO:0006310 GO:0009378 |
| AF-A0A7C6SFX0-F1-model_v4 | deleted | 0.9689 | 1 | 47 |
|
| AF-A0A356XC81-F1-model_v4 | Holliday junction branch migration protein RuvA | 0.9613 | 1 | 49 |
GO:0003677
GO:0005524 GO:0006281 GO:0006310 GO:0009378 |