F260824

General Info

Members Datasets Scaffolds Average Seq Length
172 103 344 199

Family's Representative Sequence

Representative Sequence 3300025903|Ga0207680_10065034|Ga0207680_100650343
Length 218
Sequence MWSPKLGANSGFDRSFYMIAFLQGKLVEAIPTQVLLEVNGIGYEVLIPLSSFDKLPQPGQPVKLLTHLVIREDAHILYGFMSGPERELFRLLINNVSGIGPKIALNVLSGISVTAFRGAVANQDIKALSQISGVGKKTAERVVVELKDRIGVAGAWEALSAQRALSPEDQKLNDASLALIALGFKQVEAHEAVRKAQTALGPQTTVEDLVRACLRKGS

Samples

Sample ID Description Type Environment
1 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
9 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
10 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
11 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
12 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
13 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
14 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
15 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
16 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
17 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
18 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
19 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
20 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
21 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
22 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
23 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
24 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
25 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
26 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
27 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
28 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
29 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
30 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
31 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
41 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
42 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
43 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
44 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
45 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
46 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
47 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
48 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
49 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
50 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
51 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
52 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
53 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
54 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
55 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
56 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
57 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
58 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
59 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
60 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
61 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
62 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
63 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
64 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
65 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
66 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
67 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
68 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
69 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
70 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
71 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
72 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
73 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
74 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
75 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
76 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
77 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
78 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
79 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
80 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
81 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
82 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
83 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
84 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
85 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
86 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
87 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
88 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
89 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
90 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
91 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
92 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
93 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
94 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
95 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
96 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
98 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
99 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
100 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
101 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
102 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
103 2786546517 Verrucomicrobia bacterium LW23 Isolate Rhizoplane

Type Distribution

Type Percentage (%)
Metagenomes 99.42
Metatranscriptomes 0
Isolates 0.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.16
Rhizosphere 97.09
Stem 0
Stem Tuber 0
Unclassified 25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207680_10065034 3300025903 Unclassified 2238
2 Ga0070690_100050959 3300005330 Unclassified 2641
3 Ga0070666_10081053 3300005335 Unclassified 2218
4 Ga0068868_100208226 3300005338 Bacteria 1633
5 Ga0070689_100109734 3300005340 Bacteria 2193
6 Ga0070689_100257814 3300005340 Unclassified 1440
7 Ga0070687_100274823 3300005343 Bacteria 1058
8 Ga0070675_100248738 3300005354 Bacteria 1555
9 Ga0068867_100112523 3300005459 Bacteria 2093
10 Ga0070702_100109021 3300005615 Bacteria 1713
11 Ga0068864_100626752 3300005618 Bacteria 1045
12 Ga0068863_100072113 3300005841 Unclassified 3268
13 Ga0068863_101025485 3300005841 Bacteria 828
14 Ga0068863_101296679 3300005841 Bacteria 735
15 Ga0068858_100067913 3300005842 Unclassified 3302
16 Ga0068858_100697234 3300005842 Bacteria 988
17 Ga0070717_10094487 3300006028 Unclassified 2529
18 Ga0070712_100487734 3300006175 Bacteria 1031
19 Ga0097621_100203193 3300006237 Bacteria 1721
20 Ga0097621_100287401 3300006237 Bacteria 1449
21 Ga0068871_100008434 3300006358 Bacteria 7412
22 Ga0075428_100268276 3300006844 Unclassified 1837
23 Ga0075429_100209925 3300006880 Bacteria 1706
24 Ga0075435_100521330 3300007076 Unclassified 1028
25 Ga0075435_100827661 3300007076 Bacteria 806
26 Ga0105240_10081616 3300009093 Bacteria 3973
27 Ga0105240_10782691 3300009093 Unclassified 1035
28 Ga0111539_10607627 3300009094 Bacteria 1274
29 Ga0111539_11145732 3300009094 Bacteria 904
30 Ga0105245_10267895 3300009098 Bacteria 1665
31 Ga0105242_10479381 3300009176 Unclassified 1179
32 Ga0105242_10549557 3300009176 Unclassified 1107
33 Ga0105242_10740025 3300009176 Bacteria 967
34 Ga0105248_10442443 3300009177 Unclassified 1464
35 Ga0157374_10253841 3300013296 Bacteria 1731
36 Ga0157374_10592946 3300013296 Bacteria 1118
37 Ga0157375_10000113 3300013308 Bacteria 78155
38 Ga0163163_10000020 3300014325 Bacteria 196885
39 Ga0163163_10084104 3300014325 Unclassified 3187
40 Ga0163163_10085629 3300014325 Bacteria 3160
41 Ga0163163_10130167 3300014325 Unclassified 2556
42 Ga0157379_10185181 3300014968 Bacteria 1881
43 Ga0157379_10257208 3300014968 Unclassified 1586
44 Ga0157376_10084628 3300014969 Bacteria 2731
45 Ga0157376_10529504 3300014969 Bacteria 1163
46 Ga0213876_10047989 3300021384 Bacteria 2257
47 Ga0207699_10381143 3300025906 Bacteria 1001
48 Ga0207695_10082902 3300025913 Bacteria 3240
49 Ga0207693_10306454 3300025915 Bacteria 1244
50 Ga0207670_10222534 3300025936 Bacteria 1445
51 Ga0207711_10858294 3300025941 Unclassified 845
52 Ga0207711_11063669 3300025941 Bacteria 749
53 Ga0207708_10352828 3300026075 Unclassified 1207
54 Ga0207702_11099288 3300026078 Unclassified 789
55 Ga0207641_10194393 3300026088 Bacteria 1867
56 Ga0207641_10224197 3300026088 Bacteria 1745
57 Ga0207674_10474499 3300026116 Unclassified 1209
58 Ga0265337_1004461 3300028556 Bacteria 5803
59 Ga0265338_10002770 3300028800 Bacteria 25657
60 Ga0265338_10003961 3300028800 Bacteria 20398
61 Ga0265338_10004144 3300028800 Bacteria 19817
62 Ga0265338_10016423 3300028800 Bacteria 8057
63 Ga0265338_10021449 3300028800 Bacteria 6736
64 Ga0265338_10608952 3300028800 Bacteria 760
65 Ga0265324_10041872 3300029957 Bacteria 1584
66 Ga0265320_10001026 3300031240 Bacteria 20812
67 Ga0265320_10001499 3300031240 Bacteria 17011
68 Ga0265320_10078354 3300031240 Bacteria 1546
69 Ga0265340_10001390 3300031247 Bacteria 13870
70 Ga0265327_10014060 3300031251 Bacteria 5265
71 Ga0265316_10622421 3300031344 Bacteria 764
72 Ga0307409_100291774 3300031995 Bacteria 1513
73 Ga0307416_100140682 3300032002 Bacteria 2193
74 Ga0307416_100597777 3300032002 Bacteria 1183
75 Ga0307411_10071582 3300032005 Unclassified 2351
76 Ga0373926_0011725 3300035083 Bacteria 2955
77 Ga0373954_0001454 3300035118 Bacteria 9615
78 Ga0373954_0013528 3300035118 Bacteria 3638
79 Ga0373954_0267040 3300035118 Bacteria 843
80 Ga0373956_0010112 3300035119 Bacteria 3853
81 Ga0373931_0068621 3300035691 Bacteria 1930
82 Ga0373931_0295179 3300035691 Bacteria 999
83 Ga0373931_0554799 3300035691 Bacteria 747
84 Ga0373931_0848268 3300035691 Unclassified 611
85 Ga0373935_0002549 3300035692 Bacteria 10447
86 Ga0373935_0536434 3300035692 Unclassified 852
87 Ga0373927_0017499 3300035695 Bacteria 4715
88 Ga0373927_0176749 3300035695 Unclassified 1400
89 Ga0373933_0061674 3300035724 Bacteria 2263
90 Ga0373947_0010722 3300035725 Bacteria 5260
91 Ga0373937_0004433 3300036401 Bacteria 11932
92 Ga0373937_0157838 3300036401 Bacteria 2127
93 Ga0373937_0936669 3300036401 Bacteria 815
94 Ga0373937_1051883 3300036401 Bacteria 763
95 Ga0373925_0006933 3300037068 Bacteria 8289
96 Ga0373925_0117077 3300037068 Bacteria 2065
97 Ga0436365_0049465 3300039437 Bacteria 17099
98 Ga0436362_0386383 3300039453 Bacteria 1415
99 Ga0451853_1000939 3300041512 Unclassified 934
100 Ga0451577_0000986 3300042876 Bacteria 41404
101 Ga0451577_0003019 3300042876 Bacteria 19162
102 Ga0451577_0015358 3300042876 Bacteria 7125
103 Ga0451577_0092512 3300042876 Bacteria 2700
104 Ga0451577_0129077 3300042876 Bacteria 2267
105 Ga0453684_0014306 3300044712 Bacteria 12716
106 Ga0453684_0053054 3300044712 Bacteria 5295
107 Ga0453684_0059420 3300044712 Bacteria 4929
108 Ga0453684_0884276 3300044712 Bacteria 958
109 Ga0451576_0045034 3300045051 Bacteria 4649
110 Ga0451576_0162833 3300045051 Bacteria 2328
111 Ga0451576_0183113 3300045051 Bacteria 2187
112 Ga0451576_0211736 3300045051 Bacteria 2024
113 Ga0451576_0232100 3300045051 Unclassified 1927
114 Ga0495592_0046503 3300046454 Bacteria 3235
115 Ga0495629_0041244 3300046459 Bacteria 3248
116 Ga0495629_0229956 3300046459 Unclassified 1278
117 Ga0495641_0020165 3300046461 Bacteria 3390
118 Ga0495651_0049547 3300046462 Bacteria 3242
119 Ga0495580_0587605 3300046472 Bacteria 737
120 Ga0495618_0001265 3300046514 Bacteria 17122
121 Ga0495618_0168957 3300046514 Unclassified 1392
122 Ga0495628_0115555 3300046516 Bacteria 2061
123 Ga0495628_0376716 3300046516 Unclassified 1040
124 Ga0495630_0000226 3300046517 Bacteria 44816
125 Ga0495630_0158256 3300046517 Bacteria 1724
126 Ga0495630_0185259 3300046517 Bacteria 1588
127 Ga0495630_0486851 3300046517 Bacteria 946
128 Ga0495630_0521441 3300046517 Unclassified 911
129 Ga0495666_0004285 3300046526 Bacteria 7198
130 Ga0495666_0083347 3300046526 Bacteria 1511
131 Ga0495665_0072087 3300046531 Unclassified 1819
132 Ga0495586_0000114 3300046535 Bacteria 48074
133 Ga0495586_0000121 3300046535 Bacteria 47320
134 Ga0495586_0078323 3300046535 Bacteria 1813
135 Ga0495586_0178745 3300046535 Bacteria 1200
136 Ga0495645_0274223 3300046543 Unclassified 1112
137 Ga0495622_0017357 3300046557 Bacteria 3350
138 Ga0495667_0102093 3300046559 Unclassified 1855
139 Ga0495634_0000333 3300046642 Bacteria 45524
140 Ga0495634_0016189 3300046642 Bacteria 5336
141 Ga0495635_0016532 3300046663 Bacteria 5155
142 Ga0495635_0230616 3300046663 Bacteria 1251
143 Ga0495599_0028859 3300046678 Bacteria 3477
144 Ga0495599_0153195 3300046678 Unclassified 1427
145 Ga0495646_0373795 3300046680 Unclassified 744
146 Ga0495647_0020148 3300046681 Bacteria 2392
147 Ga0495647_0041302 3300046681 Bacteria 1756
148 Ga0495658_0243856 3300046683 Unclassified 1129
149 Ga0495613_0011913 3300046689 Bacteria 6464
150 Ga0495624_0160646 3300046690 Bacteria 1373
151 Ga0495624_0195712 3300046690 Bacteria 1228
152 Ga0495600_0204272 3300046809 Bacteria 1268
153 Ga0495581_0059171 3300047315 Unclassified 2214
154 Ga0495604_0150805 3300047317 Bacteria 1652
155 Ga0495604_0502547 3300047317 Unclassified 786
156 Ga0495674_0000940 3300047319 Bacteria 27835
157 Ga0495674_0130344 3300047319 Bacteria 2119
158 Ga0495674_0380994 3300047319 Bacteria 1141
159 Ga0495676_0013842 3300047321 Bacteria 7233
160 Ga0495676_0248008 3300047321 Unclassified 1216
161 Ga0495676_0315460 3300047321 Bacteria 1051
162 Ga0495680_0002752 3300047322 Bacteria 17756
163 Ga0495614_0189746 3300048089 Unclassified 927
164 Ga0496112_0958977 3300048915 Bacteria 776
165 Ga0501034_0141739 3300049571 Unclassified 2383
166 Ga0501047_0144189 3300049581 Unclassified 2259
167 nmdc:mga09592_189554_c1 3300050508 Bacteria 1780
168 nmdc:mga06r32_337265_c1 3300050510 Bacteria 1492
169 nmdc:mga08y16_406824_c1 3300050511 Unclassified 1392
170 Ga0495601_0402709 3300053077 Bacteria 887
171 Ga0590075_079140 3300059424 Bacteria 851
172 2787435305 2786546517 Bacteria 6614109
173 Ga0207680_10065034
174 Ga0070690_100050959
175 Ga0070666_10081053
176 Ga0068868_100208226
177 Ga0070689_100109734
178 Ga0070689_100257814
179 Ga0070687_100274823
180 Ga0070675_100248738
181 Ga0068867_100112523
182 Ga0070702_100109021
183 Ga0068864_100626752
184 Ga0068863_100072113
185 Ga0068863_101025485
186 Ga0068863_101296679
187 Ga0068858_100067913
188 Ga0068858_100697234
189 Ga0070717_10094487
190 Ga0070712_100487734
191 Ga0097621_100203193
192 Ga0097621_100287401
193 Ga0068871_100008434
194 Ga0075428_100268276
195 Ga0075429_100209925
196 Ga0075435_100521330
197 Ga0075435_100827661
198 Ga0105240_10081616
199 Ga0105240_10782691
200 Ga0111539_10607627
201 Ga0111539_11145732
202 Ga0105245_10267895
203 Ga0105242_10479381
204 Ga0105242_10549557
205 Ga0105242_10740025
206 Ga0105248_10442443
207 Ga0157374_10253841
208 Ga0157374_10592946
209 Ga0157375_10000113
210 Ga0163163_10000020
211 Ga0163163_10084104
212 Ga0163163_10085629
213 Ga0163163_10130167
214 Ga0157379_10185181
215 Ga0157379_10257208
216 Ga0157376_10084628
217 Ga0157376_10529504
218 Ga0213876_10047989
219 Ga0207699_10381143
220 Ga0207695_10082902
221 Ga0207693_10306454
222 Ga0207670_10222534
223 Ga0207711_10858294
224 Ga0207711_11063669
225 Ga0207708_10352828
226 Ga0207702_11099288
227 Ga0207641_10194393
228 Ga0207641_10224197
229 Ga0207674_10474499
230 Ga0265337_1004461
231 Ga0265338_10002770
232 Ga0265338_10003961
233 Ga0265338_10004144
234 Ga0265338_10016423
235 Ga0265338_10021449
236 Ga0265338_10608952
237 Ga0265324_10041872
238 Ga0265320_10001026
239 Ga0265320_10001499
240 Ga0265320_10078354
241 Ga0265340_10001390
242 Ga0265327_10014060
243 Ga0265316_10622421
244 Ga0307409_100291774
245 Ga0307416_100140682
246 Ga0307416_100597777
247 Ga0307411_10071582
248 Ga0373926_0011725
249 Ga0373954_0001454
250 Ga0373954_0013528
251 Ga0373954_0267040
252 Ga0373956_0010112
253 Ga0373931_0068621
254 Ga0373931_0295179
255 Ga0373931_0554799
256 Ga0373931_0848268
257 Ga0373935_0002549
258 Ga0373935_0536434
259 Ga0373927_0017499
260 Ga0373927_0176749
261 Ga0373933_0061674
262 Ga0373947_0010722
263 Ga0373937_0004433
264 Ga0373937_0157838
265 Ga0373937_0936669
266 Ga0373937_1051883
267 Ga0373925_0006933
268 Ga0373925_0117077
269 Ga0436365_0049465
270 Ga0436362_0386383
271 Ga0451853_1000939
272 Ga0451577_0000986
273 Ga0451577_0003019
274 Ga0451577_0015358
275 Ga0451577_0092512
276 Ga0451577_0129077
277 Ga0453684_0014306
278 Ga0453684_0053054
279 Ga0453684_0059420
280 Ga0453684_0884276
281 Ga0451576_0045034
282 Ga0451576_0162833
283 Ga0451576_0183113
284 Ga0451576_0211736
285 Ga0451576_0232100
286 Ga0495592_0046503
287 Ga0495629_0041244
288 Ga0495629_0229956
289 Ga0495641_0020165
290 Ga0495651_0049547
291 Ga0495580_0587605
292 Ga0495618_0001265
293 Ga0495618_0168957
294 Ga0495628_0115555
295 Ga0495628_0376716
296 Ga0495630_0000226
297 Ga0495630_0158256
298 Ga0495630_0185259
299 Ga0495630_0486851
300 Ga0495630_0521441
301 Ga0495666_0004285
302 Ga0495666_0083347
303 Ga0495665_0072087
304 Ga0495586_0000114
305 Ga0495586_0000121
306 Ga0495586_0078323
307 Ga0495586_0178745
308 Ga0495645_0274223
309 Ga0495622_0017357
310 Ga0495667_0102093
311 Ga0495634_0000333
312 Ga0495634_0016189
313 Ga0495635_0016532
314 Ga0495635_0230616
315 Ga0495599_0028859
316 Ga0495599_0153195
317 Ga0495646_0373795
318 Ga0495647_0020148
319 Ga0495647_0041302
320 Ga0495658_0243856
321 Ga0495613_0011913
322 Ga0495624_0160646
323 Ga0495624_0195712
324 Ga0495600_0204272
325 Ga0495581_0059171
326 Ga0495604_0150805
327 Ga0495604_0502547
328 Ga0495674_0000940
329 Ga0495674_0130344
330 Ga0495674_0380994
331 Ga0495676_0013842
332 Ga0495676_0248008
333 Ga0495676_0315460
334 Ga0495680_0002752
335 Ga0495614_0189746
336 Ga0496112_0958977
337 Ga0501034_0141739
338 Ga0501047_0144189
339 nmdc:mga09592_189554_c1
340 nmdc:mga06r32_337265_c1
341 nmdc:mga08y16_406824_c1
342 Ga0495601_0402709
343 Ga0590075_079140
344 2787435305

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01330

RuvA_N

RuvA N terminal domain

18

79

0.99

PF07499

RuvA_C

RuvA, C-terminal domain

170

217

0.96

PF14520

HHH_5

Helix-hairpin-helix domain

89

148

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ixs-assembly1.cif.gz_A structure of ruvb complexed with ruva domain iii 0.864 153 201
1ixs-assembly1.cif.gz_A structure of ruvb complexed with ruva domain iii 0.8175 153 201
6zjo-assembly1.cif.gz_A crystal structure of staphylococcus aureus rsga. 0.7813 6 29
4nps-assembly1.cif.gz_A crystal structure of bep1 protein (virb-translocated bartonella effector protein) from bartonella clarridgeiae 0.7697 4 49
3vyt-assembly1.cif.gz_A-2 crystal structure of the hypc-hypd-hype complex (form i inward) 0.7585 4 49
ID Description Score Start End Superfamily
2ztcA03 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain 0.9551 155 197 1.10.8.10
2zteA02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain 0.9518 65 132 1.10.150.20
1bvsA02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain 0.9504 68 135 1.10.150.20
2ztdB03 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain 0.9497 157 197 1.10.8.10
1d8lB01 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain 0.9497 68 132 1.10.150.20
ID Description Score Start End GO Terms
AF-X0XHZ1-F1-model_v4 DNA helicase Holliday junction RuvA type domain-containing protein 0.9918 1 49 GO:0003677
GO:0005524
GO:0006281
GO:0006310
GO:0009378
AF-X0XHZ1-F1-model_v4 DNA helicase Holliday junction RuvA type domain-containing protein 0.9723 1 49 GO:0003677
GO:0005524
GO:0006281
GO:0006310
GO:0009378
AF-A0A2V8KIF1-F1-model_v4 Holliday junction branch migration protein RuvA 0.9712 1 47 GO:0003677
GO:0005524
GO:0006281
GO:0006310
GO:0009378
AF-A0A7C6SFX0-F1-model_v4 deleted 0.9689 1 47
AF-A0A356XC81-F1-model_v4 Holliday junction branch migration protein RuvA 0.9613 1 49 GO:0003677
GO:0005524
GO:0006281
GO:0006310
GO:0009378

Map