F260710

General Info

Members Datasets Scaffolds Average Seq Length
172 126 344 143

Family's Representative Sequence

Representative Sequence 3300010375|Ga0105239_11149094|Ga0105239_111490942
Length 140
Sequence MNIYHTDGSASPNPGPGGFAVVLEGRPAVLGGEPSGAETTNIRMEGYAIIAALKHAAGQPCEIYSDSEFWIKVITIWSIPWEANGWHKKGGIKNLDIVQEVCALYKQSQAKLIWVRGHNNDPGNELADHWANKAREGARV

Samples

Sample ID Description Type Environment
1 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
33 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
34 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
35 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
36 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
47 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
48 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
49 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013874 Rhizosphere microbial communities from switchgrass harvested rhizosphere in Austin, TX, USA - RS_213 Metagenome Rhizosphere
56 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
57 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
84 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
85 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
86 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
87 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
88 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
89 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
90 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
91 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
92 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
93 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
94 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
95 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
96 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
97 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
98 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
99 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
100 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
101 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
102 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
103 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
104 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
105 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
106 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
107 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
108 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
109 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
110 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
111 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
112 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
113 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
114 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
115 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
116 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
117 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
118 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
119 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
120 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
121 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
122 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
123 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
124 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
125 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
126 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 27.33
Nodule 0
Rhizoplane 2.33
Rhizosphere 69.19
Stem 0
Stem Tuber 0
Unclassified 10.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105239_11149094 3300010375 Bacteria 894
2 JGI24736J21556_1007461 3300001904 Bacteria 1837
3 JGI24737J22298_10073761 3300001990 Bacteria 1018
4 JGI24743J22301_10022108 3300001991 Bacteria 1218
5 JGI24742J22300_10000039 3300002244 Bacteria 19127
6 rootH2_10000244 3300003320 Bacteria 697651
7 JGI26145J50221_1015271 3300003371 Unclassified 709
8 Ga0070658_10000064 3300005327 Bacteria 106537
9 Ga0070676_10001123 3300005328 Bacteria 13375
10 Ga0070676_10058737 3300005328 Bacteria 2280
11 Ga0070683_100854078 3300005329 Bacteria 873
12 Ga0070666_10000333 3300005335 Bacteria 29797
13 Ga0070660_100159991 3300005339 Bacteria 1814
14 Ga0070689_100507101 3300005340 Bacteria 1034
15 Ga0070668_100735415 3300005347 Unclassified 872
16 Ga0070675_101275026 3300005354 Bacteria 677
17 Ga0070674_100000772 3300005356 Bacteria 16434
18 Ga0070674_100014908 3300005356 Unclassified 4840
19 Ga0070674_100504286 3300005356 Bacteria 1008
20 Ga0070673_100000650 3300005364 Bacteria 19053
21 Ga0070673_100305231 3300005364 Bacteria 1402
22 Ga0070688_100132031 3300005365 Unclassified 1686
23 Ga0070659_100447409 3300005366 Bacteria 1095
24 Ga0070667_100000662 3300005367 Bacteria 33424
25 Ga0070678_100002198 3300005456 Bacteria 10607
26 Ga0070678_100003647 3300005456 Bacteria 8596
27 Ga0070681_10005243 3300005458 Bacteria 12521
28 Ga0070681_10359417 3300005458 Bacteria 1366
29 Ga0070685_10000497 3300005466 Bacteria 22741
30 Ga0070685_10002243 3300005466 Bacteria 9974
31 Ga0070679_100157324 3300005530 Bacteria 2247
32 Ga0070684_101191569 3300005535 Unclassified 716
33 Ga0070684_101194693 3300005535 Bacteria 715
34 Ga0068853_100004387 3300005539 Bacteria 10923
35 Ga0070665_100094684 3300005548 Unclassified 2991
36 Ga0068855_100000003 3300005563 Bacteria 589862
37 Ga0068855_100414557 3300005563 Bacteria 1474
38 Ga0068855_102117521 3300005563 Unclassified 566
39 Ga0068857_100205296 3300005577 Bacteria 1797
40 Ga0068856_100004258 3300005614 Bacteria 14292
41 Ga0068861_102598396 3300005719 Bacteria 510
42 Ga0075365_10000194 3300006038 Bacteria 20050
43 Ga0075365_10000407 3300006038 Bacteria 15813
44 Ga0075365_10418506 3300006038 Bacteria 946
45 Ga0075364_10046035 3300006051 Bacteria 2840
46 Ga0075364_10257228 3300006051 Bacteria 1187
47 Ga0075364_10421413 3300006051 Bacteria 911
48 Ga0075362_10005700 3300006177 Bacteria 4582
49 Ga0075369_10000003 3300006186 Bacteria 205269
50 Ga0075369_10326475 3300006186 Bacteria 718
51 Ga0075366_10003390 3300006195 Bacteria 8399
52 Ga0097621_100000002 3300006237 Bacteria 172240
53 Ga0075370_10030283 3300006353 Bacteria 3018
54 Ga0068871_100002126 3300006358 Bacteria 13428
55 Ga0068871_101685955 3300006358 Bacteria 601
56 Ga0068865_100272065 3300006881 Bacteria 1345
57 Ga0105245_10000002 3300009098 Bacteria 634374
58 Ga0105243_10463913 3300009148 Bacteria 1191
59 Ga0105241_10000007 3300009174 Bacteria 343524
60 Ga0105241_10011359 3300009174 Bacteria 6528
61 Ga0105242_10001160 3300009176 Bacteria 20745
62 Ga0105242_10016782 3300009176 Bacteria 5698
63 Ga0105248_10066864 3300009177 Unclassified 4035
64 Ga0105032_108299 3300009979 Bacteria 856
65 Ga0105032_110449 3300009979 Bacteria 751
66 Ga0105030_103523 3300009987 Bacteria 1348
67 Ga0105239_10014731 3300010375 Bacteria 8672
68 Ga0157373_10499169 3300013100 Bacteria 879
69 Ga0157371_10003754 3300013102 Bacteria 13599
70 Ga0157369_10000104 3300013105 Bacteria 118133
71 Ga0157374_10000018 3300013296 Bacteria 286683
72 Ga0157374_10000225 3300013296 Bacteria 52365
73 Ga0157378_10089816 3300013297 Bacteria 2792
74 Ga0157378_10718531 3300013297 Bacteria 1020
75 Ga0163162_11584796 3300013306 Unclassified 747
76 Ga0157372_10006190 3300013307 Bacteria 12719
77 Ga0157514_105107 3300013874 Bacteria 667
78 Ga0157377_10011453 3300014745 Bacteria 4427
79 Ga0207680_10000245 3300025903 Bacteria 26140
80 Ga0207647_10000032 3300025904 Bacteria 103110
81 Ga0207645_10002852 3300025907 Bacteria 13403
82 Ga0207645_10067062 3300025907 Bacteria 2294
83 Ga0207705_10000065 3300025909 Bacteria 137123
84 Ga0207654_10000002 3300025911 Bacteria 1460142
85 Ga0207654_10005274 3300025911 Bacteria 6528
86 Ga0207707_10024665 3300025912 Bacteria 5263
87 Ga0207657_10172936 3300025919 Bacteria 1749
88 Ga0207652_10126450 3300025921 Bacteria 2277
89 Ga0207659_11120782 3300025926 Bacteria 677
90 Ga0207687_10000001 3300025927 Bacteria 1130810
91 Ga0207687_10000008 3300025927 Bacteria 497738
92 Ga0207686_10003300 3300025934 Bacteria 8678
93 Ga0207686_10011377 3300025934 Bacteria 4872
94 Ga0207669_10006931 3300025937 Bacteria 5213
95 Ga0207669_10407597 3300025937 Bacteria 1066
96 Ga0207691_10135391 3300025940 Bacteria 2173
97 Ga0207711_10273698 3300025941 Bacteria 1554
98 Ga0207661_10794549 3300025944 Bacteria 871
99 Ga0207667_10000008 3300025949 Bacteria 625138
100 Ga0207651_10001353 3300025960 Bacteria 11092
101 Ga0207712_10001763 3300025961 Bacteria 14436
102 Ga0207668_10267027 3300025972 Bacteria 1397
103 Ga0207668_10662641 3300025972 Bacteria 914
104 Ga0207658_10010093 3300025986 Bacteria 6414
105 Ga0207702_10028650 3300026078 Unclassified 4630
106 Ga0207641_10020601 3300026088 Bacteria 5418
107 Ga0207675_102429786 3300026118 Bacteria 536
108 Ga0207683_10006783 3300026121 Bacteria 9803
109 Ga0207683_10014733 3300026121 Bacteria 6657
110 Ga0209974_10001934 3300027876 Bacteria 7561
111 Ga0268266_10017091 3300028379 Bacteria 6194
112 Ga0268266_10210829 3300028379 Bacteria 1781
113 Ga0265331_10454869 3300031250 Unclassified 575
114 Ga0395900_0063436 3300037418 Bacteria 3798
115 Ga0395900_0087063 3300037418 Bacteria 3211
116 Ga0395901_0001399 3300038443 Bacteria 25208
117 Ga0395901_0092106 3300038443 Bacteria 3173
118 Ga0395901_1123166 3300038443 Bacteria 755
119 Ga0451807_1045773 3300041486 Bacteria 1022
120 Ga0451833_0458009 3300041491 Bacteria 1174
121 Ga0439431_0263587 3300041997 Unclassified 513
122 Ga0450919_033934 3300042121 Bacteria 588
123 Ga0495629_0030222 3300046459 Bacteria 3842
124 Ga0495582_0344112 3300046473 Unclassified 858
125 Ga0495587_0283675 3300046536 Bacteria 928
126 Ga0495622_0000051 3300046557 Bacteria 105674
127 Ga0495588_0000158 3300046674 Bacteria 91168
128 Ga0495658_0000297 3300046683 Bacteria 28276
129 Ga0495658_0628109 3300046683 Unclassified 688
130 Ga0495600_0046359 3300046809 Unclassified 2836
131 Ga0495660_0000035 3300046810 Bacteria 199140
132 Ga0495672_0141945 3300047320 Bacteria 1253
133 Ga0495676_0331185 3300047321 Bacteria 1021
134 Ga0496100_0777467 3300048903 Bacteria 749
135 Ga0496104_0470131 3300048907 Bacteria 1169
136 Ga0496112_0011675 3300048915 Bacteria 8036
137 nmdc:mga03683_2285_c1 3300050489 Bacteria 5922
138 nmdc:mga00v17_12415_c1 3300050491 Bacteria 4700
139 nmdc:mga00v17_15262_c1 3300050491 Bacteria 4308
140 nmdc:mga00v17_235439_c1 3300050491 Bacteria 1187
141 nmdc:mga0yw44_1005624_c1 3300050492 Bacteria 564
142 nmdc:mga0yw44_11108_c1 3300050492 Bacteria 4629
143 nmdc:mga0yw44_13_c1 3300050492 Bacteria 120183
144 nmdc:mga0yw44_318_c1 3300050492 Bacteria 16768
145 nmdc:mga0k408_113_c1 3300050493 Bacteria 39351
146 nmdc:mga07m45_45504_c1 3300050496 Unclassified 1798
147 nmdc:mga0sz30_1_c1 3300050516 Bacteria 796501
148 nmdc:mga0sz30_4843_c3 3300050516 Bacteria 988
149 Ga0500610_0000002 3300053079 Bacteria 166752
150 Ga0500644_0000018 3300053088 Bacteria 104498
151 Ga0500583_0000166 3300053092 Bacteria 27346
152 Ga0500583_0006863 3300053092 Bacteria 3957
153 Ga0500651_0000249 3300053093 Bacteria 33002
154 Ga0500651_0000381 3300053093 Bacteria 24265
155 Ga0500651_0004900 3300053093 Bacteria 7568
156 Ga0500566_0000001 3300053094 Bacteria 1101031
157 Ga0500650_0000001 3300053098 Bacteria 818797
158 Ga0500554_089801 3300053102 Bacteria 1020
159 Ga0500594_0000001 3300053118 Bacteria 1178472
160 Ga0500614_000001 3300053123 Bacteria 1274484
161 Ga0500614_000173 3300053123 Bacteria 16487
162 Ga0500628_047109 3300053129 Unclassified 1009
163 Ga0500642_0017453 3300053130 Bacteria 2751
164 Ga0500655_007668 3300053133 Bacteria 1943
165 Ga0500577_0000562 3300053142 Bacteria 9566
166 Ga0500577_0035832 3300053142 Bacteria 1772
167 Ga0500579_016424 3300053143 Unclassified 4779
168 Ga0500589_000018 3300053147 Bacteria 101866
169 Ga0500616_0000005 3300053153 Bacteria 961725
170 Ga0500616_0088013 3300053153 Bacteria 1545
171 Ga0500622_0110595 3300053156 Bacteria 1343
172 Ga0500649_000002 3300053722 Bacteria 145889
173 Ga0105239_11149094
174 JGI24736J21556_1007461
175 JGI24737J22298_10073761
176 JGI24743J22301_10022108
177 JGI24742J22300_10000039
178 rootH2_10000244
179 JGI26145J50221_1015271
180 Ga0070658_10000064
181 Ga0070676_10001123
182 Ga0070676_10058737
183 Ga0070683_100854078
184 Ga0070666_10000333
185 Ga0070660_100159991
186 Ga0070689_100507101
187 Ga0070668_100735415
188 Ga0070675_101275026
189 Ga0070674_100000772
190 Ga0070674_100014908
191 Ga0070674_100504286
192 Ga0070673_100000650
193 Ga0070673_100305231
194 Ga0070688_100132031
195 Ga0070659_100447409
196 Ga0070667_100000662
197 Ga0070678_100002198
198 Ga0070678_100003647
199 Ga0070681_10005243
200 Ga0070681_10359417
201 Ga0070685_10000497
202 Ga0070685_10002243
203 Ga0070679_100157324
204 Ga0070684_101191569
205 Ga0070684_101194693
206 Ga0068853_100004387
207 Ga0070665_100094684
208 Ga0068855_100000003
209 Ga0068855_100414557
210 Ga0068855_102117521
211 Ga0068857_100205296
212 Ga0068856_100004258
213 Ga0068861_102598396
214 Ga0075365_10000194
215 Ga0075365_10000407
216 Ga0075365_10418506
217 Ga0075364_10046035
218 Ga0075364_10257228
219 Ga0075364_10421413
220 Ga0075362_10005700
221 Ga0075369_10000003
222 Ga0075369_10326475
223 Ga0075366_10003390
224 Ga0097621_100000002
225 Ga0075370_10030283
226 Ga0068871_100002126
227 Ga0068871_101685955
228 Ga0068865_100272065
229 Ga0105245_10000002
230 Ga0105243_10463913
231 Ga0105241_10000007
232 Ga0105241_10011359
233 Ga0105242_10001160
234 Ga0105242_10016782
235 Ga0105248_10066864
236 Ga0105032_108299
237 Ga0105032_110449
238 Ga0105030_103523
239 Ga0105239_10014731
240 Ga0157373_10499169
241 Ga0157371_10003754
242 Ga0157369_10000104
243 Ga0157374_10000018
244 Ga0157374_10000225
245 Ga0157378_10089816
246 Ga0157378_10718531
247 Ga0163162_11584796
248 Ga0157372_10006190
249 Ga0157514_105107
250 Ga0157377_10011453
251 Ga0207680_10000245
252 Ga0207647_10000032
253 Ga0207645_10002852
254 Ga0207645_10067062
255 Ga0207705_10000065
256 Ga0207654_10000002
257 Ga0207654_10005274
258 Ga0207707_10024665
259 Ga0207657_10172936
260 Ga0207652_10126450
261 Ga0207659_11120782
262 Ga0207687_10000001
263 Ga0207687_10000008
264 Ga0207686_10003300
265 Ga0207686_10011377
266 Ga0207669_10006931
267 Ga0207669_10407597
268 Ga0207691_10135391
269 Ga0207711_10273698
270 Ga0207661_10794549
271 Ga0207667_10000008
272 Ga0207651_10001353
273 Ga0207712_10001763
274 Ga0207668_10267027
275 Ga0207668_10662641
276 Ga0207658_10010093
277 Ga0207702_10028650
278 Ga0207641_10020601
279 Ga0207675_102429786
280 Ga0207683_10006783
281 Ga0207683_10014733
282 Ga0209974_10001934
283 Ga0268266_10017091
284 Ga0268266_10210829
285 Ga0265331_10454869
286 Ga0395900_0063436
287 Ga0395900_0087063
288 Ga0395901_0001399
289 Ga0395901_0092106
290 Ga0395901_1123166
291 Ga0451807_1045773
292 Ga0451833_0458009
293 Ga0439431_0263587
294 Ga0450919_033934
295 Ga0495629_0030222
296 Ga0495582_0344112
297 Ga0495587_0283675
298 Ga0495622_0000051
299 Ga0495588_0000158
300 Ga0495658_0000297
301 Ga0495658_0628109
302 Ga0495600_0046359
303 Ga0495660_0000035
304 Ga0495672_0141945
305 Ga0495676_0331185
306 Ga0496100_0777467
307 Ga0496104_0470131
308 Ga0496112_0011675
309 nmdc:mga03683_2285_c1
310 nmdc:mga00v17_12415_c1
311 nmdc:mga00v17_15262_c1
312 nmdc:mga00v17_235439_c1
313 nmdc:mga0yw44_1005624_c1
314 nmdc:mga0yw44_11108_c1
315 nmdc:mga0yw44_13_c1
316 nmdc:mga0yw44_318_c1
317 nmdc:mga0k408_113_c1
318 nmdc:mga07m45_45504_c1
319 nmdc:mga0sz30_1_c1
320 nmdc:mga0sz30_4843_c3
321 Ga0500610_0000002
322 Ga0500644_0000018
323 Ga0500583_0000166
324 Ga0500583_0006863
325 Ga0500651_0000249
326 Ga0500651_0000381
327 Ga0500651_0004900
328 Ga0500566_0000001
329 Ga0500650_0000001
330 Ga0500554_089801
331 Ga0500594_0000001
332 Ga0500614_000001
333 Ga0500614_000173
334 Ga0500628_047109
335 Ga0500642_0017453
336 Ga0500655_007668
337 Ga0500577_0000562
338 Ga0500577_0035832
339 Ga0500579_016424
340 Ga0500589_000018
341 Ga0500616_0000005
342 Ga0500616_0088013
343 Ga0500622_0110595
344 Ga0500649_000002

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00075

RNase_H

RNase H

1

136

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wsg-assembly3.cif.gz_C co-crystal structure of e.coli rnase hi active site mutant (e48a/d134n*) with mn2+ 0.8929 2 137
3qin-assembly1.cif.gz_A crystal structure of hiv-1 rnase h p15 with engineered e. coli loop and pyrimidinol carboxylic acid inhibitor 0.8813 2 136
2z1j-assembly1.cif.gz_A crystal structure of e.coli rnase hi surface charged mutant(q4r/t40e/q72h/q76k/q80e/t92k/q105k/q113r/q115k/n143k/t145k) 0.8793 2 137
3v1r-assembly1.cif.gz_A crystal structures of the reverse transcriptase-associated ribonuclease h domain of xmrv with inhibitor beta-thujaplicinol 0.8747 3 140
3aa2-assembly1.cif.gz_A a52i e. coli rnase hi 0.8729 2 138
ID Description Score Start End Superfamily
af_Q86MG7_99_246_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8893 3 137 3.30.420.10
af_A4HSS0_32_246_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8558 4 136 3.30.420.10
af_A0A1D8PQ03_48_227_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8496 2 138 3.30.420.10
2qkkN00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8489 1 135 3.30.420.10
af_Q9XVE6_2_138_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8471 1 121 3.30.420.10
ID Description Score Start End GO Terms
AF-A0A4Q3MDD1-F1-model_v4 deleted 0.9924 1 139
AF-A0A839JGT8-F1-model_v4 ribonuclease H (EC 3.1.26.4) 0.9858 1 137 GO:0003676
GO:0004523
GO:0043137
AF-A0A2E8JNN2-F1-model_v4 ribonuclease H (EC 3.1.26.4) 0.9828 1 139 GO:0003676
GO:0004523
GO:0043137
AF-A0A4Q3MDD1-F1-model_v4 deleted 0.9451 1 139
AF-A0A2E8JNN2-F1-model_v4 ribonuclease H (EC 3.1.26.4) 0.9418 1 139 GO:0003676
GO:0004523
GO:0043137

Map