F260684

General Info

Members Datasets Scaffolds Average Seq Length
172 107 344 179

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_10905151|Ga0105248_109051512
Length 211
Sequence VAPEAGVARCRAGLTPVPHVFLKSTMPAPLRKHLHASLLASVLALVGCAGEPARPMPTVAHVDLPRFMGDWYVIANIPTFIEKGAHNAVESYQLALDGTIETTFTFRAGGFDGEPRRYQPHGFVLDRQTNALWGMQFIWPVKADYRIVYLADDYSQTVVARAARDYVWIMARRPTISDADYQHLVDVVARQGYDVSQLQRVPQRWPSGAPG

Samples

Sample ID Description Type Environment
1 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
9 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
10 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
11 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
12 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
13 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
14 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
15 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
16 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
17 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
18 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
19 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
20 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
21 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
22 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
23 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
24 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
25 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
26 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
27 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
39 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
40 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
41 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
42 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
43 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
44 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
45 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
46 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
47 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
48 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
49 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
50 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
51 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
52 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
53 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
54 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
55 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
56 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
57 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
58 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
59 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
60 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
61 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
62 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
63 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
64 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
65 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
66 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
67 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
68 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
69 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
70 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
71 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
72 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
73 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
74 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
75 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
76 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
77 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
78 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
79 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
80 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
81 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
82 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
83 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
84 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
85 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
86 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
87 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
88 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
89 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
90 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
91 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
92 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
93 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
94 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
95 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
96 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
97 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
98 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
99 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
100 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
101 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
102 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
103 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
104 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
105 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
106 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
107 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.93
Metatranscriptomes 2.33
Isolates 1.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.49
Nodule 0
Rhizoplane 0
Rhizosphere 93.6
Stem 0
Stem Tuber 0
Unclassified 11.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105248_10905151 3300009177 Bacteria 996
2 rootH2_10144626 3300003320 Bacteria 1124
3 Ga0070666_10262604 3300005335 Bacteria 1224
4 Ga0070682_100031254 3300005337 Bacteria 3219
5 Ga0070660_100020847 3300005339 Bacteria 4825
6 Ga0070660_100057943 3300005339 Bacteria 3002
7 Ga0070671_100141173 3300005355 Bacteria 2033
8 Ga0070659_100026438 3300005366 Bacteria 4467
9 Ga0070659_100054086 3300005366 Bacteria 3161
10 Ga0070659_100075733 3300005366 Bacteria 2682
11 Ga0070700_100776401 3300005441 Bacteria 769
12 Ga0070694_100139659 3300005444 Bacteria 1758
13 Ga0068853_100052186 3300005539 Bacteria 3522
14 Ga0068853_100123012 3300005539 Bacteria 2316
15 Ga0068853_100972784 3300005539 Bacteria 817
16 Ga0068855_100311844 3300005563 Bacteria 1740
17 Ga0068866_10523611 3300005718 Bacteria 788
18 Ga0068860_100362464 3300005843 Bacteria 1428
19 Ga0075362_10047485 3300006177 Bacteria 1913
20 Ga0068865_100101095 3300006881 Bacteria 2111
21 Ga0075435_100175972 3300007076 Bacteria 1807
22 Ga0075435_100356890 3300007076 Unclassified 1253
23 Ga0105241_10174499 3300009174 Bacteria 1778
24 Ga0105241_10205419 3300009174 Bacteria 1648
25 Ga0105241_10830060 3300009174 Bacteria 853
26 Ga0105237_10346479 3300009545 Bacteria 1490
27 Ga0105238_10476582 3300009551 Bacteria 1247
28 Ga0157373_10053175 3300013100 Bacteria 2880
29 Ga0157373_10154511 3300013100 Bacteria 1614
30 Ga0157371_10009827 3300013102 Bacteria 7500
31 Ga0157371_10028534 3300013102 Bacteria 4040
32 Ga0157370_10100677 3300013104 Bacteria 2707
33 Ga0157372_10040295 3300013307 Bacteria 5159
34 Ga0157380_10115338 3300014326 Bacteria 2265
35 Ga0182008_10039315 3300014497 Bacteria 2364
36 Ga0157376_12037819 3300014969 Bacteria 612
37 Ga0207654_10298353 3300025911 Bacteria 1095
38 Ga0207671_10242322 3300025914 Bacteria 1416
39 Ga0207657_10144161 3300025919 Bacteria 1944
40 Ga0207694_10459776 3300025924 Bacteria 1063
41 Ga0207694_10778557 3300025924 Bacteria 808
42 Ga0207690_10001760 3300025932 Bacteria 13300
43 Ga0207690_10067942 3300025932 Bacteria 2446
44 Ga0207690_10199368 3300025932 Bacteria 1519
45 Ga0207706_10613240 3300025933 Bacteria 934
46 Ga0207667_10107580 3300025949 Bacteria 2877
47 Ga0207639_10058486 3300026041 Bacteria 2965
48 Ga0207639_10185848 3300026041 Bacteria 1771
49 Ga0207648_10255428 3300026089 Bacteria 1563
50 Ga0207674_10276584 3300026116 Bacteria 1627
51 Ga0268264_10537152 3300028381 Bacteria 1145
52 Ga0265330_10024808 3300031235 Bacteria 2719
53 Ga0265332_10000887 3300031238 Bacteria 18029
54 Ga0265325_10072227 3300031241 Bacteria 1730
55 Ga0265329_10004315 3300031242 Bacteria 5949
56 Ga0265339_10091785 3300031249 Bacteria 1591
57 Ga0265331_10003767 3300031250 Bacteria 9624
58 Ga0265327_10001396 3300031251 Bacteria 30800
59 Ga0265327_10003138 3300031251 Bacteria 16230
60 Ga0265316_10017665 3300031344 Bacteria 6154
61 Ga0265316_10142262 3300031344 Bacteria 1801
62 Ga0316575_10013079 3300031665 Bacteria 3095
63 Ga0316575_10027953 3300031665 Bacteria 2196
64 Ga0316575_10029337 3300031665 Bacteria 2148
65 Ga0316579_10012253 3300031691 Bacteria 3664
66 Ga0316579_10140211 3300031691 Unclassified 1165
67 Ga0265314_10021811 3300031711 Bacteria 4917
68 Ga0265342_10127765 3300031712 Bacteria 1426
69 Ga0265342_10149904 3300031712 Bacteria 1295
70 Ga0316576_10027510 3300031727 Unclassified 4000
71 Ga0316576_10232940 3300031727 Bacteria 1384
72 Ga0316576_10252935 3300031727 Bacteria 1322
73 Ga0316576_10312538 3300031727 Bacteria 1173
74 Ga0316576_10338992 3300031727 Unclassified 1120
75 Ga0316576_10356673 3300031727 Unclassified 1087
76 Ga0316578_10013124 3300031728 Bacteria 4383
77 Ga0316578_10040576 3300031728 Bacteria 2691
78 Ga0316578_10069998 3300031728 Unclassified 2076
79 Ga0316577_10037693 3300031733 Bacteria 2703
80 Ga0316577_10113783 3300031733 Bacteria 1519
81 Ga0316583_10056683 3300032133 Bacteria 1376
82 Ga0316583_10068817 3300032133 Unclassified 1238
83 Ga0316583_10173852 3300032133 Unclassified 749
84 Ga0316585_10003504 3300032137 Bacteria 4321
85 Ga0316585_10004446 3300032137 Bacteria 3902
86 Ga0316585_10014211 3300032137 Bacteria 2378
87 Ga0316585_10017614 3300032137 Bacteria 2161
88 Ga0316585_10035638 3300032137 Unclassified 1576
89 Ga0316580_10002962 3300032139 Bacteria 4766
90 Ga0316580_10020893 3300032139 Unclassified 2017
91 Ga0316580_10035662 3300032139 Bacteria 1539
92 Ga0316580_10073663 3300032139 Bacteria 1045
93 Ga0316592_1049974 3300033524 Unclassified 933
94 Ga0316586_1015366 3300033527 Unclassified 1218
95 Ga0316588_1018827 3300033528 Bacteria 1549
96 Ga0316596_1023124 3300033541 Unclassified 1590
97 Ga0373956_0322703 3300035119 Bacteria 736
98 Ga0316574_0004024 3300035398 Bacteria 7662
99 Ga0316574_0005593 3300035398 Bacteria 6714
100 Ga0316574_0027665 3300035398 Bacteria 3416
101 Ga0316574_0060208 3300035398 Bacteria 2383
102 Ga0316574_0228276 3300035398 Bacteria 1192
103 Ga0373933_0234650 3300035724 Bacteria 1179
104 Ga0373933_0272809 3300035724 Bacteria 1092
105 Ga0373937_0072447 3300036401 Bacteria 3178
106 Ga0316582_0000244 3300036647 Bacteria 18059
107 Ga0316582_0001048 3300036647 Bacteria 11579
108 Ga0316582_0001148 3300036647 Bacteria 11277
109 Ga0316582_0048617 3300036647 Bacteria 2682
110 Ga0316584_0001748 3300036712 Bacteria 13352
111 Ga0316584_0003422 3300036712 Bacteria 10297
112 Ga0316584_0006962 3300036712 Bacteria 7691
113 Ga0316584_0020911 3300036712 Bacteria 4752
114 Ga0316584_0034518 3300036712 Bacteria 3750
115 Ga0316584_0042008 3300036712 Bacteria 3410
116 Ga0316584_0065957 3300036712 Bacteria 2712
117 Ga0316584_0116842 3300036712 Bacteria 1995
118 Ga0316584_0165833 3300036712 Bacteria 1640
119 Ga0316584_0304692 3300036712 Unclassified 1153
120 Ga0316581_0027044 3300037588 Bacteria 1714
121 Ga0395901_0256046 3300038443 Bacteria 1823
122 Ga0400487_03138 3300039110 Bacteria 4349
123 Ga0450894_009244 3300042131 Bacteria 1277
124 Ga0450896_005299 3300042133 Bacteria 1757
125 Ga0450899_023555 3300042135 Unclassified 728
126 Ga0450907_018507 3300042146 Bacteria 1166
127 Ga0450908_007029 3300042184 Bacteria 2130
128 Ga0450918_015514 3300042531 Bacteria 1324
129 Ga0451577_0020758 3300042876 Bacteria 6022
130 Ga0439440_0129035 3300042993 Bacteria 710
131 Ga0453684_0043241 3300044712 Bacteria 6059
132 Ga0501034_0000224 3300049571 Bacteria 107481
133 Ga0501037_0057089 3300049573 Bacteria 2850
134 Ga0501037_0376771 3300049573 Bacteria 976
135 Ga0501038_0358747 3300049574 Bacteria 1134
136 Ga0501039_0225794 3300049575 Bacteria 1472
137 Ga0501041_0062527 3300049577 Bacteria 2279
138 Ga0501042_0037787 3300049578 Bacteria 3427
139 Ga0501046_0337178 3300049580 Bacteria 1096
140 Ga0501068_0004405 3300049584 Bacteria 7658
141 Ga0501070_0096327 3300049586 Bacteria 2448
142 Ga0501070_0696572 3300049586 Bacteria 804
143 Ga0501072_0002629 3300049588 Bacteria 13467
144 Ga0501072_0069682 3300049588 Bacteria 2777
145 Ga0501072_0111647 3300049588 Bacteria 2176
146 Ga0501073_0004182 3300049589 Bacteria 10828
147 Ga0501074_0017231 3300049590 Bacteria 5242
148 Ga0501074_0439041 3300049590 Bacteria 926
149 Ga0501075_0018889 3300049591 Bacteria 4996
150 Ga0501075_0259124 3300049591 Bacteria 1325
151 Ga0501075_0759802 3300049591 Bacteria 738
152 Ga0501079_0033476 3300049741 Bacteria 3953
153 Ga0501079_0056337 3300049741 Bacteria 3033
154 Ga0501080_0003598 3300049742 Bacteria 13645
155 Ga0501080_0477150 3300049742 Bacteria 1116
156 Ga0501081_0031946 3300049743 Bacteria 3569
157 Ga0501083_0021092 3300049744 Bacteria 4528
158 Ga0501044_0110087 3300049823 Bacteria 2763
159 nmdc:mga03683_75565_c1 3300050489 Unclassified 1447
160 nmdc:mga0k408_215617_c1 3300050493 Unclassified 1146
161 nmdc:mga0k408_51717_c1 3300050493 Bacteria 2380
162 nmdc:mga0rr50_341712_c1 3300050513 Unclassified 1258
163 Ga0495595_0317183 3300053084 Bacteria 785
164 Ga0500594_0035377 3300053118 Unclassified 1339
165 Ga0500616_0012467 3300053153 Bacteria 4973
166 Ga0501084_0032420 3300054114 Bacteria 4371
167 Ga0501082_0063928 3300060353 Bacteria 3168
168 Ga0501082_0074400 3300060353 Bacteria 2926
169 Ga0530510_0015276 3300061734 Bacteria 5424
170 2538834348 2537561836 Bacteria 3910579
171 2643828737 2643221562 Bacteria 4048635
172 2895398054 2895395659 Bacteria 3983269
173 Ga0105248_10905151
174 rootH2_10144626
175 Ga0070666_10262604
176 Ga0070682_100031254
177 Ga0070660_100020847
178 Ga0070660_100057943
179 Ga0070671_100141173
180 Ga0070659_100026438
181 Ga0070659_100054086
182 Ga0070659_100075733
183 Ga0070700_100776401
184 Ga0070694_100139659
185 Ga0068853_100052186
186 Ga0068853_100123012
187 Ga0068853_100972784
188 Ga0068855_100311844
189 Ga0068866_10523611
190 Ga0068860_100362464
191 Ga0075362_10047485
192 Ga0068865_100101095
193 Ga0075435_100175972
194 Ga0075435_100356890
195 Ga0105241_10174499
196 Ga0105241_10205419
197 Ga0105241_10830060
198 Ga0105237_10346479
199 Ga0105238_10476582
200 Ga0157373_10053175
201 Ga0157373_10154511
202 Ga0157371_10009827
203 Ga0157371_10028534
204 Ga0157370_10100677
205 Ga0157372_10040295
206 Ga0157380_10115338
207 Ga0182008_10039315
208 Ga0157376_12037819
209 Ga0207654_10298353
210 Ga0207671_10242322
211 Ga0207657_10144161
212 Ga0207694_10459776
213 Ga0207694_10778557
214 Ga0207690_10001760
215 Ga0207690_10067942
216 Ga0207690_10199368
217 Ga0207706_10613240
218 Ga0207667_10107580
219 Ga0207639_10058486
220 Ga0207639_10185848
221 Ga0207648_10255428
222 Ga0207674_10276584
223 Ga0268264_10537152
224 Ga0265330_10024808
225 Ga0265332_10000887
226 Ga0265325_10072227
227 Ga0265329_10004315
228 Ga0265339_10091785
229 Ga0265331_10003767
230 Ga0265327_10001396
231 Ga0265327_10003138
232 Ga0265316_10017665
233 Ga0265316_10142262
234 Ga0316575_10013079
235 Ga0316575_10027953
236 Ga0316575_10029337
237 Ga0316579_10012253
238 Ga0316579_10140211
239 Ga0265314_10021811
240 Ga0265342_10127765
241 Ga0265342_10149904
242 Ga0316576_10027510
243 Ga0316576_10232940
244 Ga0316576_10252935
245 Ga0316576_10312538
246 Ga0316576_10338992
247 Ga0316576_10356673
248 Ga0316578_10013124
249 Ga0316578_10040576
250 Ga0316578_10069998
251 Ga0316577_10037693
252 Ga0316577_10113783
253 Ga0316583_10056683
254 Ga0316583_10068817
255 Ga0316583_10173852
256 Ga0316585_10003504
257 Ga0316585_10004446
258 Ga0316585_10014211
259 Ga0316585_10017614
260 Ga0316585_10035638
261 Ga0316580_10002962
262 Ga0316580_10020893
263 Ga0316580_10035662
264 Ga0316580_10073663
265 Ga0316592_1049974
266 Ga0316586_1015366
267 Ga0316588_1018827
268 Ga0316596_1023124
269 Ga0373956_0322703
270 Ga0316574_0004024
271 Ga0316574_0005593
272 Ga0316574_0027665
273 Ga0316574_0060208
274 Ga0316574_0228276
275 Ga0373933_0234650
276 Ga0373933_0272809
277 Ga0373937_0072447
278 Ga0316582_0000244
279 Ga0316582_0001048
280 Ga0316582_0001148
281 Ga0316582_0048617
282 Ga0316584_0001748
283 Ga0316584_0003422
284 Ga0316584_0006962
285 Ga0316584_0020911
286 Ga0316584_0034518
287 Ga0316584_0042008
288 Ga0316584_0065957
289 Ga0316584_0116842
290 Ga0316584_0165833
291 Ga0316584_0304692
292 Ga0316581_0027044
293 Ga0395901_0256046
294 Ga0400487_03138
295 Ga0450894_009244
296 Ga0450896_005299
297 Ga0450899_023555
298 Ga0450907_018507
299 Ga0450908_007029
300 Ga0450918_015514
301 Ga0451577_0020758
302 Ga0439440_0129035
303 Ga0453684_0043241
304 Ga0501034_0000224
305 Ga0501037_0057089
306 Ga0501037_0376771
307 Ga0501038_0358747
308 Ga0501039_0225794
309 Ga0501041_0062527
310 Ga0501042_0037787
311 Ga0501046_0337178
312 Ga0501068_0004405
313 Ga0501070_0096327
314 Ga0501070_0696572
315 Ga0501072_0002629
316 Ga0501072_0069682
317 Ga0501072_0111647
318 Ga0501073_0004182
319 Ga0501074_0017231
320 Ga0501074_0439041
321 Ga0501075_0018889
322 Ga0501075_0259124
323 Ga0501075_0759802
324 Ga0501079_0033476
325 Ga0501079_0056337
326 Ga0501080_0003598
327 Ga0501080_0477150
328 Ga0501081_0031946
329 Ga0501083_0021092
330 Ga0501044_0110087
331 nmdc:mga03683_75565_c1
332 nmdc:mga0k408_215617_c1
333 nmdc:mga0k408_51717_c1
334 nmdc:mga0rr50_341712_c1
335 Ga0495595_0317183
336 Ga0500594_0035377
337 Ga0500616_0012467
338 Ga0501084_0032420
339 Ga0501082_0063928
340 Ga0501082_0074400
341 Ga0530510_0015276
342 2538834348
343 2643828737
344 2895398054

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08212

Lipocalin_2

Lipocalin-like domain

62

203

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
6vri-assembly1.cif.gz_B crystal structure of the wtblc-split protein 0.9393 116 168
2aco-assembly1.cif.gz_B xray structure of blc dimer in complex with vaccenic acid 0.9373 27 175
1qwd-assembly1.cif.gz_B crystal structure of a bacterial lipocalin, the blc gene product from e. coli 0.937 27 175
3mbt-assembly1.cif.gz_A structure of monomeric blc from e. coli 0.9279 27 175
8wb2-assembly1.cif.gz_A heme-bound arabidopsis thaliana temperature-induced lipocalin 0.9277 27 175
ID Description Score Start End Superfamily
1qwdB00 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.937 27 175 2.40.128.20
3mbtA00 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.9279 27 175 2.40.128.20
af_Q38JE7_14_176_2.40.128.20 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.9167 24 175 2.40.128.20
3mbtA00 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.9161 27 175 2.40.128.20
af_Q55CV8_22_181_2.40.128.20 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.911 27 179 2.40.128.20
ID Description Score Start End GO Terms
AF-A0A3B9R309-F1-model_v4 Outer membrane lipoprotein Blc 0.9891 24 175 GO:0006950
GO:0008289
GO:0009279
AF-A0A432LUF9-F1-model_v4 Outer membrane lipoprotein Blc 0.989 27 175 GO:0006950
GO:0008289
GO:0009279
AF-A0A3C1WY33-F1-model_v4 Lipocalin/cytosolic fatty-acid binding domain-containing protein 0.9871 26 175 GO:0006950
AF-A0A1Y1SFY0-F1-model_v4 Outer membrane lipoprotein Blc 0.9868 31 175 GO:0006950
GO:0008289
GO:0009279
AF-A0A370F4I8-F1-model_v4 Outer membrane lipoprotein Blc 0.9867 39 175 GO:0006950
GO:0008289
GO:0009279

Map