F259883

General Info

Members Datasets Scaffolds Average Seq Length
172 122 104 182

Family's Representative Sequence

Representative Sequence 3300002737|JGI25162J39368_1001420|JGI25162J39368_100142010
Length 190
Sequence MAKTLKITPSKLTGACLIEPVVHGDHRGFFMESYNEQLMNQQGINYKFIQDNQSLSAQHGVLRGLHYQLNPKAQTKLIRVISGVIYDVIVDIRQGSPTFGQWEGFILSEHNHRQLLVPKGFAHGFCTLVPNTQVLYKVDEYYSPENDRGISWSDPALGIDWPTSSPTLSDKDQRHPLLQDAEINFNFEVK

Samples

Sample ID Description Type Environment
1 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
2 2548877040 Paenibacillus sonchi X19-5 Isolate Rhizosphere
3 2571042143 Paenibacillus graminis RSA19 Isolate Unclassified
4 2571042588 Paenibacillus zanthoxyli JH29 Isolate Unclassified
5 2576861424 Paenibacillus sabinae T27 Isolate Rhizosphere
6 2579778775 Paenibacillus durus P3L-5 Isolate Unclassified
7 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
8 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
9 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
10 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
11 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
12 2728368933 Paenibacillus jilunlii DSM 23019 Isolate Rhizosphere
13 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
14 2738541295 Bacillus sp. OK085 Isolate Unclassified
15 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
16 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
17 2818991459 Paenibacillus sp. 597 Isolate Unclassified
18 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
19 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
20 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
21 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
22 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
23 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
24 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
25 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
26 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
27 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
28 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
29 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
30 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
31 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
32 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
33 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
34 2939702853 Paenibacillus sp. PvR008 Isolate Rhizosphere
35 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
36 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
37 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
38 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
39 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
40 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
41 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
42 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
43 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
44 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
45 2980182181 Paenibacillus cymbidii R196 Isolate Unclassified
46 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
47 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
48 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
49 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
50 2984527788 Paenibacillus sp. SORGH_AS306 Isolate Aerial Root
51 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
52 2996706504 Paenibacillus sp. OT2-17 Isolate Rhizosphere
53 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
54 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
55 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
56 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
57 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
58 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
59 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
60 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
61 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
62 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
63 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
64 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
65 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
66 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
70 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
72 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
73 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
76 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
77 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
78 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
79 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
80 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
81 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
82 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
83 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
84 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
85 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
86 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
87 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
88 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
89 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
90 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
91 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
92 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
93 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
94 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
95 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
96 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
97 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
98 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
99 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
100 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
101 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
102 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
103 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
104 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
105 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
106 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
107 3300049547 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
108 3300049548 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
109 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
110 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
111 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
112 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
113 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
114 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
115 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
116 8002317523 Cohnella sp. GbtcB17 Isolate Unclassified
117 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
118 8054465665 Paenibacillus sonchi IIRRBNF1 Isolate Rhizosphere
119 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
120 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified
121 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
122 8057733483 Paenibacillus apiarius MW-14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 41.28
Metatranscriptomes 19.19
Isolates 39.53

Biome Distribution

Category Percentage (%)
Aerial Root 0.58
Bulb 0
Endosphere 16.86
Nodule 0.58
Rhizoplane 2.33
Rhizosphere 51.74
Stem 0
Stem Tuber 0
Unclassified 27.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1001420 3300002737 Bacteria 13016
2 JGI25159J45721_1004006 3300002987 Bacteria 5013
3 JGI25151J46595_10001801 3300003187 Bacteria 13839
4 JGI25151J46595_10019315 3300003187 Bacteria 2897
5 JGI25151J46595_10076716 3300003187 Bacteria 986
6 JGI25151J46595_10127173 3300003187 Bacteria 640
7 Ga0055538_1000114 3300003751 Bacteria 61531
8 Ga0055538_1000617 3300003751 Bacteria 11606
9 Ga0055535_1008724 3300003761 Bacteria 1800
10 Ga0055541_1000286 3300003841 Bacteria 17140
11 Ga0055541_1000364 3300003841 Bacteria 14025
12 Ga0055541_1001124 3300003841 Bacteria 6002
13 Ga0070691_10178446 3300005341 Bacteria 1104
14 Ga0070696_100420368 3300005546 Bacteria 1049
15 Ga0105251_10011489 3300009011 Bacteria 5056
16 Ga0105251_10150811 3300009011 Bacteria 1050
17 Ga0105244_10007013 3300009036 Bacteria 7211
18 Ga0105244_10017088 3300009036 Bacteria 4111
19 Ga0105250_10029100 3300009092 Bacteria 2223
20 Ga0182005_1032039 3300015265 Bacteria 1431
21 Ga0209784_100075 3300025224 Bacteria 139902
22 Ga0209566_100091 3300025225 Bacteria 141100
23 Ga0209566_100142 3300025225 Bacteria 86059
24 Ga0209566_100286 3300025225 Bacteria 46407
25 Ga0209566_100448 3300025225 Bacteria 30404
26 Ga0209566_103294 3300025225 Bacteria 2539
27 Ga0209566_104776 3300025225 Bacteria 1790
28 Ga0209147_110599 3300025229 Bacteria 1051
29 Ga0209437_100449 3300025233 Bacteria 34010
30 Ga0209258_100723 3300025242 Bacteria 22046
31 Ga0209130_1000802 3300025284 Bacteria 26664
32 Ga0209025_1000043 3300025294 Bacteria 350458
33 Ga0209025_1000946 3300025294 Bacteria 44053
34 Ga0209025_1001323 3300025294 Bacteria 33574
35 Ga0209025_1001456 3300025294 Bacteria 30945
36 Ga0209025_1004208 3300025294 Bacteria 12690
37 Ga0209025_1005173 3300025294 Bacteria 10791
38 Ga0207696_1070255 3300025711 Bacteria 974
39 Ga0207655_1006125 3300025728 Bacteria 8026
40 Ga0237817_10002 3300030083 Bacteria 100594
41 Ga0307406_10484937 3300031901 Bacteria 999
42 Ga0307409_101089169 3300031995 Bacteria 820
43 Ga0316584_0379264 3300036712 Bacteria 1011
44 Ga0395899_0002037 3300037312 Bacteria 16641
45 Ga0395899_0002041 3300037312 Bacteria 16629
46 Ga0237819_00517 3300038705 Bacteria 12967
47 Ga0496107_0319312 3300048910 Bacteria 1156
48 Ga0496112_0924080 3300048915 Bacteria 794
49 Ga0496113_0123067 3300048916 Bacteria 2030
50 Ga0496113_0747393 3300048916 Bacteria 779
51 Ga0496116_0017254 3300048919 Bacteria 5612
52 Ga0496116_0023199 3300048919 Bacteria 4627
53 Ga0496116_0125352 3300048919 Bacteria 1476
54 Ga0496117_0098700 3300048920 Bacteria 1856
55 Ga0496117_0109191 3300048920 Bacteria 1728
56 Ga0496117_0225572 3300048920 Bacteria 1039
57 Ga0496118_0046496 3300048921 Bacteria 3376
58 Ga0496118_0050250 3300048921 Bacteria 3203
59 Ga0496119_0051620 3300048922 Bacteria 2526
60 Ga0496120_0018884 3300048923 Bacteria 4429
61 Ga0496121_0004014 3300048924 Bacteria 20267
62 Ga0496121_0022019 3300048924 Bacteria 6208
63 Ga0496122_0058314 3300048925 Bacteria 2859
64 Ga0496122_0077706 3300048925 Bacteria 2329
65 Ga0496122_0377661 3300048925 Bacteria 729
66 Ga0496123_0018119 3300048926 Bacteria 5624
67 Ga0496123_0290846 3300048926 Bacteria 785
68 Ga0496124_0147078 3300048927 Bacteria 1853
69 Ga0496125_0001931 3300048928 Bacteria 28332
70 Ga0496125_0002025 3300048928 Bacteria 27455
71 Ga0496126_0005818 3300048929 Bacteria 13940
72 Ga0501343_000016 3300049132 Bacteria 6464
73 Ga0501305_007392 3300049161 Bacteria 1393
74 Ga0501305_026021 3300049161 Bacteria 890
75 Ga0501312_009920 3300049528 Bacteria 1264
76 Ga0501313_008529 3300049529 Bacteria 1142
77 Ga0501314_006308 3300049530 Bacteria 1031
78 Ga0501315_002444 3300049531 Bacteria 1746
79 Ga0501315_004057 3300049531 Bacteria 1507
80 Ga0501316_000150 3300049532 Bacteria 3782
81 Ga0501316_006532 3300049532 Bacteria 1242
82 Ga0501317_000413 3300049533 Bacteria 2936
83 Ga0501317_003070 3300049533 Bacteria 1632
84 Ga0501317_007895 3300049533 Bacteria 1213
85 Ga0501318_003248 3300049534 Bacteria 1478
86 Ga0501318_007541 3300049534 Bacteria 1140
87 Ga0501320_007146 3300049536 Bacteria 1067
88 Ga0501320_033428 3300049536 Bacteria 649
89 Ga0501321_004063 3300049537 Bacteria 1379
90 Ga0501321_038568 3300049537 Bacteria 664
91 Ga0501323_000888 3300049539 Bacteria 2438
92 Ga0501331_00725 3300049547 Bacteria 1443
93 Ga0501332_07233 3300049548 Bacteria 706
94 Ga0501333_000994 3300049549 Bacteria 1451
95 Ga0501334_00441 3300049550 Bacteria 1881
96 Ga0501334_05116 3300049550 Bacteria 859
97 Ga0501335_002856 3300049551 Bacteria 1430
98 Ga0501335_003987 3300049551 Bacteria 1272
99 Ga0501335_024680 3300049551 Bacteria 656
100 Ga0501336_003606 3300049552 Bacteria 1055
101 Ga0501337_003360 3300049553 Bacteria 1015
102 Ga0501337_003410 3300049553 Bacteria 1009
103 Ga0501337_005730 3300049553 Bacteria 836
104 Ga0501338_00245 3300049554 Bacteria 2255

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2864733723 2864739589 156
2 3300049536 Ga0501320_033428 Ga0501320_033428_41_523 159
3 3300049548 Ga0501332_07233 Ga0501332_07233_158_640 159
4 3300003187 JGI25151J46595_10076716 JGI25151J46595_100767162 172
5 3300025294 Ga0209025_1000946 Ga0209025_100094614 173
6 3300025229 Ga0209147_110599 Ga0209147_1105992 175
7 iso_pu_bacteria 8055632911 8055637040 175
8 3300049537 Ga0501321_038568 Ga0501321_038568_117_650 176
9 iso_pu_bacteria 2939669807 2939671709 176
10 iso_pu_bacteria 2585428059 2587740199 177
11 iso_pu_bacteria 2643221676 2644425339 177
12 iso_pu_bacteria 2643221676 2644425346 177
13 iso_pu_bacteria 2721755693 2723606247 177
14 iso_pu_bacteria 2751185905 2753808568 177
15 iso_pu_bacteria 2818991459 2819671303 177
16 iso_pu_bacteria 2857453340 2857455297 177
17 iso_pu_bacteria 2919425241 2919425727 177
18 iso_pu_bacteria 2938649242 2938654614 177
19 iso_pu_bacteria 2971410472 2971412360 177
20 iso_pu_bacteria 2984527788 2984531222 177
21 iso_pu_bacteria 648028048 648172241 177
22 iso_pu_bacteria 8056533031 8056533160 177
23 iso_pu_bacteria 2512564039 2512730021 178
24 iso_pu_bacteria 2548877040 2550903714 178
25 iso_pu_bacteria 2728369359 2730136870 178
26 iso_pu_bacteria 2802428803 2802438129 178
27 iso_pu_bacteria 2889276214 2889276799 178
28 iso_pu_bacteria 2889295896 2889299752 178
29 iso_pu_bacteria 2904595352 2904596512 178
30 iso_pu_bacteria 2904755435 2904755830 178
31 iso_pu_bacteria 2907202186 2907207355 178
32 iso_pu_bacteria 2919425241 2919430256 178
33 iso_pu_bacteria 2939702853 2939706746 178
34 iso_pu_bacteria 2945991243 2945996203 178
35 iso_pu_bacteria 2968558590 2968564776 178
36 iso_pu_bacteria 2980125574 2980130313 178
37 iso_pu_bacteria 2981284811 2981287167 178
38 iso_pu_bacteria 2981289755 2981292115 178
39 iso_pu_bacteria 2981980479 2981982797 178
40 iso_pu_bacteria 2981985349 2981987413 178
41 iso_pu_bacteria 2988225383 2988231309 178
42 iso_pu_bacteria 2996706504 2996707007 178
43 iso_pu_bacteria 8054795415 8054801500 178
44 iso_pu_bacteria 8057733483 8057735208 178
45 3300005341 Ga0070691_10178446 Ga0070691_101784462 179
46 3300005546 Ga0070696_100420368 Ga0070696_1004203682 179
47 3300048919 Ga0496116_0023199 Ga0496116_0023199_3422_3961 179
48 3300048924 Ga0496121_0022019 Ga0496121_0022019_4352_4891 179
49 iso_pu_bacteria 2571042143 2571531871 179
50 iso_pu_bacteria 2728368933 2728531398 179
51 iso_pu_bacteria 2864997549 2865000367 179
52 iso_pu_bacteria 2971403814 2971410428 179
53 iso_pu_bacteria 8054465665 8054471374 179
54 3300015265 Ga0182005_1032039 Ga0182005_10320392 180
55 3300031901 Ga0307406_10484937 Ga0307406_104849372 180
56 3300036712 Ga0316584_0379264 Ga0316584_0379264_93_656 180
57 3300048925 Ga0496122_0377661 Ga0496122_0377661_135_692 180
58 iso_pu_bacteria 2939679117 2939680668 180
59 3300003841 Ga0055541_1000364 Ga0055541_100036411 181
60 3300009036 Ga0105244_10007013 Ga0105244_100070136 181
61 3300025225 Ga0209566_100142 Ga0209566_10014224 181
62 3300025225 Ga0209566_104776 Ga0209566_1047762 181
63 3300025728 Ga0207655_1006125 Ga0207655_10061255 181
64 3300037312 Ga0395899_0002037 Ga0395899_0002037_6988_7533 181
65 3300048926 Ga0496123_0290846 Ga0496123_0290846_20_565 181
66 3300048929 Ga0496126_0005818 Ga0496126_0005818_4952_5497 181
67 iso_pu_bacteria 2571042588 2573037793 181
68 iso_pu_bacteria 2576861424 2578338955 181
69 iso_pu_bacteria 2579778775 2580931352 181
70 iso_pu_bacteria 2619619294 2621277414 181
71 iso_pu_bacteria 2728368933 2728530503 181
72 iso_pu_bacteria 2738541295 2738817343 181
73 iso_pu_bacteria 2881636855 2881638099 181
74 iso_pu_bacteria 2925326138 2925334361 181
75 iso_pu_bacteria 2947426588 2947432017 181
76 iso_pu_bacteria 2956897341 2956898693 181
77 iso_pu_bacteria 2971403814 2971408968 181
78 iso_pu_bacteria 2971511577 2971514453 181
79 iso_pu_bacteria 2980176882 2980180665 181
80 iso_pu_bacteria 2988225383 2988229920 181
81 iso_pu_bacteria 3001892409 3001895047 181
82 iso_pu_bacteria 8022621104 8022626725 181
83 3300003187 JGI25151J46595_10001801 JGI25151J46595_100018018 182
84 3300003187 JGI25151J46595_10127173 JGI25151J46595_101271731 182
85 3300003751 Ga0055538_1000114 Ga0055538_100011450 182
86 3300003751 Ga0055538_1000617 Ga0055538_10006176 182
87 3300003761 Ga0055535_1008724 Ga0055535_10087242 182
88 3300003841 Ga0055541_1001124 Ga0055541_10011246 182
89 3300025224 Ga0209784_100075 Ga0209784_100075114 182
90 3300025225 Ga0209566_100448 Ga0209566_10044816 182
91 3300025242 Ga0209258_100723 Ga0209258_1007233 182
92 3300025294 Ga0209025_1001323 Ga0209025_100132319 182
93 3300025294 Ga0209025_1005173 Ga0209025_10051738 182
94 3300037312 Ga0395899_0002041 Ga0395899_0002041_7742_8290 182
95 3300048919 Ga0496116_0017254 Ga0496116_0017254_488_1036 182
96 3300048920 Ga0496117_0098700 Ga0496117_0098700_275_823 182
97 3300048920 Ga0496117_0109191 Ga0496117_0109191_136_684 182
98 3300048920 Ga0496117_0225572 Ga0496117_0225572_473_1021 182
99 3300048921 Ga0496118_0046496 Ga0496118_0046496_1359_1907 182
100 3300048921 Ga0496118_0050250 Ga0496118_0050250_1084_1632 182
101 3300048922 Ga0496119_0051620 Ga0496119_0051620_907_1455 182
102 3300048923 Ga0496120_0018884 Ga0496120_0018884_3694_4242 182
103 3300048924 Ga0496121_0004014 Ga0496121_0004014_3386_3934 182
104 3300048925 Ga0496122_0077706 Ga0496122_0077706_900_1448 182
105 3300048928 Ga0496125_0002025 Ga0496125_0002025_11183_11731 182
106 iso_pu_bacteria 2643221543 2643736864 182
107 iso_pu_bacteria 2925326138 2925333964 182
108 iso_pu_bacteria 2929206907 2929207473 182
109 iso_pu_bacteria 2946053406 2946058893 182
110 iso_pu_bacteria 2956897341 2956902603 182
111 iso_pu_bacteria 2980182181 2980186722 182
112 iso_pu_bacteria 8002317523 8002317726 182
113 3300009011 Ga0105251_10011489 Ga0105251_100114895 184
114 3300025225 Ga0209566_100286 Ga0209566_1002867 184
115 3300048927 Ga0496124_0147078 Ga0496124_0147078_1201_1755 184
116 3300002987 JGI25159J45721_1004006 JGI25159J45721_10040065 185
117 3300003187 JGI25151J46595_10019315 JGI25151J46595_100193153 185
118 3300009011 Ga0105251_10150811 Ga0105251_101508111 185
119 3300009092 Ga0105250_10029100 Ga0105250_100291002 185
120 3300025284 Ga0209130_1000802 Ga0209130_100080211 185
121 3300025294 Ga0209025_1001456 Ga0209025_10014564 185
122 3300025294 Ga0209025_1004208 Ga0209025_10042082 185
123 3300025711 Ga0207696_1070255 Ga0207696_10702552 185
124 3300030083 Ga0237817_10002 Ga0237817_1000250 185
125 3300038705 Ga0237819_00517 Ga0237819_00517_11972_12529 185
126 3300048910 Ga0496107_0319312 Ga0496107_0319312_482_1042 185
127 3300048915 Ga0496112_0924080 Ga0496112_0924080_58_618 185
128 3300048916 Ga0496113_0123067 Ga0496113_0123067_291_851 185
129 3300048916 Ga0496113_0747393 Ga0496113_0747393_33_593 185
130 3300048925 Ga0496122_0058314 Ga0496122_0058314_1479_2039 185
131 3300048926 Ga0496123_0018119 Ga0496123_0018119_1164_1724 185
132 3300048928 Ga0496125_0001931 Ga0496125_0001931_14699_15259 185
133 3300049132 Ga0501343_000016 Ga0501343_000016_4891_5451 185
134 3300049161 Ga0501305_007392 Ga0501305_007392_582_1142 185
135 3300049161 Ga0501305_026021 Ga0501305_026021_146_706 185
136 3300049528 Ga0501312_009920 Ga0501312_009920_210_770 185
137 3300049530 Ga0501314_006308 Ga0501314_006308_260_820 185
138 3300049531 Ga0501315_002444 Ga0501315_002444_210_770 185
139 3300049531 Ga0501315_004057 Ga0501315_004057_614_1174 185
140 3300049532 Ga0501316_000150 Ga0501316_000150_1794_2354 185
141 3300049532 Ga0501316_006532 Ga0501316_006532_246_806 185
142 3300049533 Ga0501317_000413 Ga0501317_000413_1536_2096 185
143 3300049533 Ga0501317_003070 Ga0501317_003070_270_830 185
144 3300049533 Ga0501317_007895 Ga0501317_007895_36_596 185
145 3300049534 Ga0501318_003248 Ga0501318_003248_597_1157 185
146 3300049534 Ga0501318_007541 Ga0501318_007541_32_592 185
147 3300049536 Ga0501320_007146 Ga0501320_007146_444_1004 185
148 3300049537 Ga0501321_004063 Ga0501321_004063_311_871 185
149 3300049539 Ga0501323_000888 Ga0501323_000888_1466_2026 185
150 3300049547 Ga0501331_00725 Ga0501331_00725_276_836 185
151 3300049549 Ga0501333_000994 Ga0501333_000994_296_856 185
152 3300049550 Ga0501334_00441 Ga0501334_00441_300_860 185
153 3300049551 Ga0501335_002856 Ga0501335_002856_204_764 185
154 3300049552 Ga0501336_003606 Ga0501336_003606_223_783 185
155 3300049553 Ga0501337_003410 Ga0501337_003410_213_773 185
156 3300049554 Ga0501338_00245 Ga0501338_00245_276_836 185
157 iso_pu_bacteria 2904490793 2904494329 185
158 3300025225 Ga0209566_103294 Ga0209566_1032944 186
159 3300025294 Ga0209025_1000043 Ga0209025_1000043141 186
160 3300031995 Ga0307409_101089169 Ga0307409_1010891691 186
161 3300048919 Ga0496116_0125352 Ga0496116_0125352_458_1018 186
162 3300049529 Ga0501313_008529 Ga0501313_008529_30_593 186
163 3300049550 Ga0501334_05116 Ga0501334_05116_23_586 186
164 3300049551 Ga0501335_003987 Ga0501335_003987_408_971 186
165 3300049551 Ga0501335_024680 Ga0501335_024680_63_626 186
166 3300049553 Ga0501337_003360 Ga0501337_003360_251_814 186
167 3300049553 Ga0501337_005730 Ga0501337_005730_248_811 186
168 3300003841 Ga0055541_1000286 Ga0055541_10002865 187
169 3300025225 Ga0209566_100091 Ga0209566_10009144 187
170 3300002737 JGI25162J39368_1001420 JGI25162J39368_100142010 190
171 3300009036 Ga0105244_10017088 Ga0105244_100170885 190
172 3300025233 Ga0209437_100449 Ga0209437_1004495 190

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00908

dTDP_sugar_isom

dTDP-4-dehydrorhamnose 3,5-epimerase

9

180

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ryk-assembly1.cif.gz_B 1.63 angstrom resolution crystal structure of dtdp-4-dehydrorhamnose 3,5-epimerase (rfbc) from bacillus anthracis str. ames with tdp and ppi bound 0.9893 4 177
3ryk-assembly1.cif.gz_B 1.63 angstrom resolution crystal structure of dtdp-4-dehydrorhamnose 3,5-epimerase (rfbc) from bacillus anthracis str. ames with tdp and ppi bound 0.9782 4 177
7pvi-assembly1.cif.gz_BBB dtdp-sugar epimerase 0.9636 1 189
5buv-assembly2.cif.gz_B-2 x-ray structure of wbca from yersinia enterocolitica 0.9628 3 177
6ndr-assembly1.cif.gz_B crystal structure of dtdp-6-deoxy-d-glucose-3,5-epimerase rmlc from legionella pneumophila philadelphia 1 in complex with dtdp-4-keto-l-rhamnose 0.9552 5 189
ID Description Score Start End Superfamily
2ixcB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.963 6 180 2.60.120.10
5buvB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9628 3 177 2.60.120.10
5buvB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9521 3 177 2.60.120.10
2c0zA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.952 6 180 2.60.120.10
2b9uD00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9517 3 183 2.60.120.10
ID Description Score Start End GO Terms
AF-W7YHD8-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 1.002 31 185 GO:0000271
GO:0005829
GO:0008830
GO:0019305
AF-A0A117I327-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 1.001 6 186 GO:0000271
GO:0005829
GO:0008830
GO:0019305
AF-A0A7W3SVA3-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 1.001 6 186 GO:0000271
GO:0005829
GO:0008830
GO:0019305
AF-A0A841U5G3-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 1.001 6 187 GO:0000271
GO:0005829
GO:0008830
GO:0019305
AF-A0A6L8V2G0-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 1.001 6 185 GO:0000271
GO:0005829
GO:0008830
GO:0019305

Feature Viewer

pLDDT pTM Quality
95.84 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map